HHsearch alignment for GI: 254781056 and conserved domain: cd00737

>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
Probab=100.00  E-value=1.3e-43  Score=279.88  Aligned_cols=133  Identities=46%  Similarity=0.840  Sum_probs=127.1

Q ss_pred             CCHHHHHHHHHHCCCCEEEECCCCCCCCEECCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHH
Q ss_conf             89999999997538422000378888770234887773206886499999999999999999999971110135999999
Q gi|254781056|r   28 VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRL  107 (171)
Q Consensus        28 ~s~~~i~lik~~EG~~~~~Y~D~~~g~~TIGyG~t~~~v~~g~~iT~~~a~~ll~~di~~~~~~~~~~~~~~~~l~~~~~  107 (171)
T Consensus         1 is~~gi~~ik~~EG~~~~~Y~D-~~G~~TIGyGht~~-~~~g~~iT~~ea~~ll~~dl~~~~~~v~~~~~--~~l~~~~~   76 (133)
T cd00737           1 ISQAGLALIKRFEGCRLTPYKD-PAGVWTIGYGHTGG-VVPGMTITEEQADALLAKDLAKAERAVNRAVK--VPLTQNQF   76 (133)
T ss_pred             CCHHHHHHHHHHHCCCCEEEEC-CCCCEEEEECCCCC-CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCC--CCCCHHHH
T ss_conf             9989999999983882032778-99984781086248-88998409999999999999999999998668--99999999


Q ss_pred             HHHHHHHHCCCCCCCCCHHHHHHHHCCCHHHHHHHHHHHHCCCCEECCHHHHHHHHH
Q ss_conf             998766413682010271688999879989999999997408983361069999999
Q gi|254781056|r  108 VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE  164 (171)
Q Consensus       108 ~ALvs~ayN~G~~~~~~s~~~~~l~~gd~~~a~~e~~~w~~~ggk~~~GL~~RR~~E  164 (171)
T Consensus        77 ~Alvs~ayN~G~g~~~~st~~~~ln~G~~~~a~~~~~~w~~~~g~~~~GL~~RR~~E  133 (133)
T cd00737          77 DALVSFAFNVGAGAFRTSTLLRKLNAGDWAGACAQLPRWVKAGGKVLPGLVRRREAE  133 (133)
T ss_pred             HHHHHHHHCCCCCCCCHHHHHHHHHCCCHHHHHHHHHHHHHCCCEECHHHHHHHHCC
T ss_conf             999998760686633252899999877999999999834324979858789888449