BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781056|ref|YP_003065469.1| phage-related lysozyme
[Candidatus Liberibacter asiaticus str. psy62]
         (171 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040733|gb|ACT57529.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 171

 Score =  351 bits (900), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 171/171 (100%), Positives = 171/171 (100%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG
Sbjct: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60

Query: 61  HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
           HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG
Sbjct: 61  HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES
Sbjct: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171


>gi|315121922|ref|YP_004062411.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495324|gb|ADR51923.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 149

 Score =  157 bits (398), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 80/144 (55%), Positives = 98/144 (68%), Gaps = 1/144 (0%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +P+ LI ++K FEGLRL AYR    G WTIGYGHTG+DV E + ITEK+A D L  D SK
Sbjct: 1   MPHLLIDLVKGFEGLRLKAYR-CSAGIWTIGYGHTGNDVFENLAITEKQANDLLKWDVSK 59

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            L+ +   SP L +  ENR+ A+ DFVFNLGIG Y  ST ++RVD +DW  A+ E  KW 
Sbjct: 60  CLSQVFTVSPILINAGENRISAIGDFVFNLGIGRYRNSTLRKRVDREDWINASHEICKWV 119

Query: 148 KAGGKVLPGLVKRRDAEVKLLLES 171
            AGGK L GLV RR+ E  LLL+S
Sbjct: 120 FAGGKKLKGLVIRREIEADLLLKS 143


>gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str.
           psy62]
 gi|254040735|gb|ACT57531.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str.
           psy62]
          Length = 102

 Score =  154 bits (388), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 82/100 (82%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129
           MTIT KEAED LL D    L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ
Sbjct: 1   MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60

Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           RVDAQDWEKAAEECKKWTKAGG+ L G+  RR     +LL
Sbjct: 61  RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100


>gi|315122498|ref|YP_004062987.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495900|gb|ADR52499.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 146

 Score =  151 bits (382), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 75/145 (51%), Positives = 97/145 (66%), Gaps = 1/145 (0%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           I +P  L+ ++K FEG RL AY+    G WTIGYGHTG+DV + + ITE++AE  L +D 
Sbjct: 2   IIIPPLLLNLIKRFEGQRLKAYQ-CPAGVWTIGYGHTGNDVFKDLVITEQKAESLLKQDV 60

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            K L  + + SP+L    ENR+ A+ DFVFNLGI  Y KST ++RVD  DW+ A++ECKK
Sbjct: 61  LKFLTQVFKISPSLIDAGENRISAIGDFVFNLGIARYRKSTLRKRVDVGDWKSASDECKK 120

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLE 170
           W  AG K L GLV RR  E  LLL+
Sbjct: 121 WCFAGQKKLRGLVLRRKVEADLLLK 145


>gi|315122565|ref|YP_004063054.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495967|gb|ADR52566.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 133

 Score =  140 bits (352), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 1/133 (0%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +P  LI ++K  EGL L+AYR    G WTIGYGHTG DV E + ITE++A+D L  D SK
Sbjct: 1   MPQLLIDLIKRLEGLLLSAYR-CPVGIWTIGYGHTGKDVFENLVITEQQADDLLKWDVSK 59

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            L+ +   SP L +  ENR+  + DFVFN GIG Y   T ++ VD++DW+ A+ ECK+W 
Sbjct: 60  CLSQVFTVSPILINAGENRISDIGDFVFNCGIGRYRARTLRKCVDSEDWKSASHECKRWV 119

Query: 148 KAGGKVLPGLVKR 160
            +GGK L GLV R
Sbjct: 120 FSGGKKLKGLVAR 132


>gi|152982881|ref|YP_001354478.1| phage-related lysozyme [Janthinobacterium sp. Marseille]
 gi|151282958|gb|ABR91368.1| phage-related lysozyme [Janthinobacterium sp. Marseille]
          Length = 174

 Score =  125 bits (314), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/155 (43%), Positives = 85/155 (54%), Gaps = 11/155 (7%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDI---------GGGAWTIGYGHTGSDVTEGMTITEKE 76
           I VP A I++ K FEG      R +           G WTIGYGH      +   ITE E
Sbjct: 21  IEVPKAAIELAKRFEGFERRVKRGVEITAIPYICPAGFWTIGYGHLCDP--KHPPITEAE 78

Query: 77  AEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW 136
           AE +L++D   +L   L   P L +  E RL AV DF FNLG+G    ST ++RV+ +DW
Sbjct: 79  AEVYLVRDLQTALAATLRFCPVLATEPEGRLAAVVDFTFNLGVGRLQTSTLRRRVNQRDW 138

Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
             AA E ++W   GGKVLPGLV RR+AE   LL +
Sbjct: 139 PTAASELRRWVYGGGKVLPGLVTRREAEAAWLLRN 173


>gi|161525479|ref|YP_001580491.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC
           17616]
 gi|189349792|ref|YP_001945420.1| lysozyme [Burkholderia multivorans ATCC 17616]
 gi|160342908|gb|ABX15994.1| glycoside hydrolase family 24 [Burkholderia multivorans ATCC 17616]
 gi|189333814|dbj|BAG42884.1| lysozyme [Burkholderia multivorans ATCC 17616]
          Length = 154

 Score =  125 bits (313), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 82/154 (53%), Gaps = 10/154 (6%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEA 77
           I VP A I++ K FEG       D           G WTIGYGH      +   ITE +A
Sbjct: 2   IAVPQAAIELAKRFEGFHRVPKHDPNRAYPYICPAGYWTIGYGHLCDP--KHPPITETDA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E +L  D   +LN  L   P L +  E RL A+ DF FNLG G    ST ++R++ +DW 
Sbjct: 60  ERYLAADLMTALNATLRYCPVLATEPEKRLAAIVDFTFNLGAGRLQTSTLRRRINQRDWH 119

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
            A +E ++W   GGKVLPGLV RR+AE   LL +
Sbjct: 120 SAGQELRRWVYGGGKVLPGLVTRREAEATCLLRA 153


>gi|17545602|ref|NP_519004.1| lysozyme (endolysin) protein [Ralstonia solanacearum GMI1000]
 gi|17427895|emb|CAD14585.1| putative lysozyme (endolysin) protein [Ralstonia solanacearum
           GMI1000]
          Length = 153

 Score =  123 bits (309), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 65/149 (43%), Positives = 81/149 (54%), Gaps = 10/149 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEAED 79
           VP A I + K FEG    A  D           G WT+GYGH   D T    IT+ +AE 
Sbjct: 4   VPQAAIALAKRFEGFHRVARVDPTRAQPYVCPAGFWTVGYGHL-CDPTHP-PITQAQAEV 61

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
           +L  D   +LN  L   P L +  + RL A+ DF FNLG G    ST ++RV+ +DW  A
Sbjct: 62  YLAADLVTALNATLRYCPVLAAEPQGRLAAIVDFTFNLGAGRLQTSTLRRRVNQRDWSAA 121

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A E ++W   GGKVLPGL  RR+AEV LL
Sbjct: 122 ASELRRWVYGGGKVLPGLAARREAEVALL 150


>gi|152983117|ref|YP_001354418.1| phage-related lysozyme [Janthinobacterium sp. Marseille]
 gi|151283194|gb|ABR91604.1| phage-related lysozyme [Janthinobacterium sp. Marseille]
          Length = 171

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 88/151 (58%), Gaps = 11/151 (7%)

Query: 28  VPNALIKMLKEFEGLR--------LTAYRDI-GGGAWTIGYGHTGSDVTEGMTITEKEAE 78
           VP + I++ K FEG          +TA   +   G WTIGYGH  +   +   IT++EAE
Sbjct: 22  VPQSAIELAKRFEGFEKRVKRGTEITAVPYVCPAGFWTIGYGHLCAQ--DHPPITQEEAE 79

Query: 79  DFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
            +L +D  K+L   L   P L +  E RL A+ DF FNLG G    ST ++R++ +DW  
Sbjct: 80  AYLAQDLVKALRATLRYCPVLATEPERRLAAIVDFTFNLGAGRLQTSTLRRRINQRDWAS 139

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           AA+E ++W   GG+VLPGLV RR+ EV +LL
Sbjct: 140 AAQELRRWIYGGGRVLPGLVGRRNVEVLMLL 170


>gi|53803105|ref|YP_115084.1| prophage LambdaMc01, lysozyme [Methylococcus capsulatus str. Bath]
 gi|53756866|gb|AAU91157.1| prophage LambdaMc01, lysozyme [Methylococcus capsulatus str. Bath]
          Length = 152

 Score =  122 bits (305), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 81/151 (53%), Gaps = 10/151 (6%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIG--------GGAWTIGYGHTGSDVTEGMTITEKEA 77
           I VP   I + K FEG       D G         G WTIGYGH   D T    ITE EA
Sbjct: 2   IAVPQTAIDLAKRFEGFHRVPKTDPGRAHPYICPAGYWTIGYGHL-CDSTHA-PITEAEA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E +L +D   +L   L   P L + SE RL A+ DF FNLG G    ST ++RV+ +DW 
Sbjct: 60  EVYLARDLQMALAATLRYCPVLATESEGRLAAIVDFTFNLGAGRLQTSTLRRRVNQRDWM 119

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            A +E ++W   GGKVLPGLV RR AE  LL
Sbjct: 120 AAGDEIQRWAYGGGKVLPGLVLRRKAERVLL 150


>gi|300697169|ref|YP_003747830.1| lysozyme (endolysin) protein [Ralstonia solanacearum CFBP2957]
 gi|299073893|emb|CBJ53424.1| lysozyme (Endolysin) protein [Ralstonia solanacearum CFBP2957]
          Length = 153

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 82/151 (54%), Gaps = 10/151 (6%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEA 77
           I VP A I++ K FEG       D           G WTIGYGH        +T+ + EA
Sbjct: 2   IVVPQAAIELAKRFEGFHRVPKTDPMRAHPYVCPAGYWTIGYGHLCDQAHPPITVPQAEA 61

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
             +L  D   +LN +L   P L +  E RL A+ DF FNLG G    ST ++R++ +DW 
Sbjct: 62  --YLAADFVVALNAVLRFCPVLATEPEGRLAAIVDFTFNLGAGRLQSSTLRRRINQRDWI 119

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            AA E ++W   GGKVLPGL+ RR+AEV LL
Sbjct: 120 AAAAELRRWIYGGGKVLPGLLARREAEVALL 150


>gi|255020359|ref|ZP_05292427.1| putative lysozyme (endolysin) protein [Acidithiobacillus caldus
           ATCC 51756]
 gi|254970279|gb|EET27773.1| putative lysozyme (endolysin) protein [Acidithiobacillus caldus
           ATCC 51756]
          Length = 160

 Score =  121 bits (304), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 81/151 (53%), Gaps = 10/151 (6%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIG--------GGAWTIGYGHTGSDVTEGMTITEKEA 77
           I VP A I + K FEG    A  D G         G WTIGYGH      +   ITE EA
Sbjct: 2   ITVPQAAIDLAKRFEGFHRVAKNDPGRAHPYVCPAGYWTIGYGHLCD--PKHPPITEAEA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E +L +D   +L   L   P L +  E RL A+ DF FNLG G    ST ++RV+ +DW 
Sbjct: 60  EAYLAQDLKAALAATLRYCPVLATEPEGRLAAIVDFTFNLGAGRLQTSTLRRRVNQRDWR 119

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            A +E ++W   GG++LPGL  RR+AEV  L
Sbjct: 120 GATQELRRWVYGGGRILPGLALRREAEVAHL 150


>gi|17547911|ref|NP_521313.1| lysozyme (endolysin) protein [Ralstonia solanacearum GMI1000]
 gi|17430217|emb|CAD16980.1| probable phage-related lysozyme (muraminidase) protein [Ralstonia
           solanacearum GMI1000]
          Length = 153

 Score =  120 bits (302), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 83/153 (54%), Gaps = 12/153 (7%)

Query: 24  NKIPVPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEK 75
             IP+P   I++ K FEG    A  D           G WT+GYGH   D T    IT+ 
Sbjct: 2   TNIPLPA--IELAKHFEGFHRVARVDPTRAQPYVCPAGFWTVGYGHL-CDPTHP-PITQA 57

Query: 76  EAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD 135
           +AE +L  D   +LN  L   P L +  + RL A+ DF FNLG G    ST ++RV+ +D
Sbjct: 58  QAEVYLAADLVTALNATLRYCPVLAAEPQGRLAAIVDFTFNLGAGRLQTSTLRRRVNQRD 117

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           W  AA E ++W   GGKVLPGL  RR+AEV LL
Sbjct: 118 WSAAASELRRWVYGGGKVLPGLAARREAEVALL 150


>gi|78358460|ref|YP_389909.1| prophage LambdaMc01, lysozyme [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
 gi|78220865|gb|ABB40214.1| prophage LambdaMc01, lysozyme [Desulfovibrio desulfuricans subsp.
           desulfuricans str. G20]
          Length = 148

 Score =  118 bits (296), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 79/147 (53%), Gaps = 10/147 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIG--------GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           I + K FEG       D G         G WTIGYGH      +   ITE EAE +L +D
Sbjct: 3   IDLAKRFEGFHRVPKTDPGRAHPYICPAGFWTIGYGHLCDP--KHPPITEAEAEVYLARD 60

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
              +L   L   P L +  E+RL A+ DF FNLG G    ST ++R++ +DW  AA E +
Sbjct: 61  LQSALAATLRYCPVLATEPESRLAAIVDFTFNLGAGRLQTSTLRRRINRRDWPAAATELR 120

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLES 171
           +W   GG+VLPGLV RR+AE   LL +
Sbjct: 121 RWVYGGGRVLPGLVTRREAEATCLLRA 147


>gi|299067555|emb|CBJ38757.1| Lysozyme (Lysis protein) (Muramidase) (Endolysin) (Protein gp19)
           [Ralstonia solanacearum CMR15]
          Length = 153

 Score =  118 bits (295), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 81/151 (53%), Gaps = 10/151 (6%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEA 77
           I VP A I+++K FEG       D           G WTIGYGH        +T+ + EA
Sbjct: 2   IVVPQAAIELVKHFEGFHRVPKVDPMRAHPYVCPAGFWTIGYGHLCDPAHPPITLAQAEA 61

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
             +L  D   +LN  L   P L + +  RL A+ DF FNLG G    ST ++R++ +DW 
Sbjct: 62  --YLAADLMAALNATLRYCPVLATEAGTRLAAIVDFTFNLGAGRLQTSTVRRRINQRDWI 119

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
             A E ++W   GGKVLPGL+ RR+AEV LL
Sbjct: 120 AVANELRRWVYGGGKVLPGLLARREAEVALL 150


>gi|315122346|ref|YP_004062835.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495748|gb|ADR52347.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 102

 Score =  116 bits (291), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 55/102 (53%), Positives = 72/102 (70%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129
           M ITE++A+D L +D SK L+ +   SP L    ENR+ A+ DFVFNLGIG Y  ST ++
Sbjct: 1   MAITEQQADDLLKRDISKCLSQVFTVSPILIHAGENRISAIGDFVFNLGIGRYRASTLRK 60

Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
            VDA+DW+ A+ ECK+W  AGGK L GLV RR+ E +LLLE+
Sbjct: 61  CVDAEDWKSASHECKRWVFAGGKKLKGLVARREIEAELLLEN 102


>gi|30250453|ref|NP_842523.1| glycoside hydrolase family protein [Nitrosomonas europaea ATCC
           19718]
 gi|30139294|emb|CAD86446.1| Glycoside hydrolase family 24 [Nitrosomonas europaea ATCC 19718]
          Length = 154

 Score =  115 bits (289), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 81/151 (53%), Gaps = 11/151 (7%)

Query: 28  VPNALIKMLKEFEGLRLTAYRD---------IGGGAWTIGYGHTGSDVTEGMTITEKEAE 78
           +P A I + K FEG       D            G WTIGYG       +   I E+E E
Sbjct: 4   IPQAAIALAKRFEGFHKVPKSDPLRRARPYICLAGYWTIGYGRLCK--PDHPPIDEEEGE 61

Query: 79  DFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
            +L +D  K+L   L   P L +  E+RL A+ DF FNLG G    ST ++R++ +DW  
Sbjct: 62  AYLYQDLRKALAATLRYCPVLATEPESRLAAIVDFTFNLGAGRLQTSTMRRRINQRDWLS 121

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A +E ++W   GGKVLPGLV RR+AEV LL+
Sbjct: 122 AGQELRRWVHGGGKVLPGLVARREAEVLLLV 152


>gi|222112354|ref|YP_002554618.1| glycoside hydrolase family 24 [Acidovorax ebreus TPSY]
 gi|221731798|gb|ACM34618.1| glycoside hydrolase family 24 [Acidovorax ebreus TPSY]
          Length = 156

 Score =  115 bits (289), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 62/149 (41%), Positives = 79/149 (53%), Gaps = 10/149 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIG--------GGAWTIGYGHTGSDVTEGMTITEKEAED 79
           VP   I++ K FEG       D G         G WTIGYGH      +   I E EAE 
Sbjct: 4   VPKTAIELAKRFEGFHRVPKADPGRAHPYICPAGYWTIGYGHLCDP--KHPPINETEAEV 61

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
           +L +D   + N  L   P L +  E R+ A+ DF FNLG G    ST ++RV+ +DW  A
Sbjct: 62  YLARDLMTAFNAALRYCPVLATEPEARVAALVDFTFNLGAGRLQTSTLRRRVNQRDWAGA 121

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A E ++W   GG+VLPGLV RR+AE  LL
Sbjct: 122 AIELRRWAYGGGRVLPGLVLRREAECVLL 150


>gi|300689970|ref|YP_003750965.1| lysozyme (lysis protein) (Muramidase) (Endolysin) (protein gp19)
           [Ralstonia solanacearum PSI07]
 gi|299077030|emb|CBJ49645.1| Lysozyme (Lysis protein) (Muramidase) (Endolysin) (Protein gp19)
           [Ralstonia solanacearum PSI07]
          Length = 153

 Score =  115 bits (287), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/151 (41%), Positives = 78/151 (51%), Gaps = 10/151 (6%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEA 77
           I VP A  ++ K FEG       D           G WTIGYGH   D T    IT+ +A
Sbjct: 2   IVVPRAAFEIAKHFEGFHRVPKADPLRAHPYVCPAGYWTIGYGHL-CDPTHP-PITQAQA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E +L  D   +LN  L   P L    E RL A+ DF FNLG G    ST ++R++ +DW 
Sbjct: 60  EVYLAADLVTALNATLRYCPVLAVEPEGRLAAIIDFTFNLGAGRLQTSTLRRRINQRDWA 119

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
             A E ++W   G KVLPGL  RR+AEV LL
Sbjct: 120 AVANELRRWVYGGDKVLPGLAARREAEVALL 150


>gi|300697184|ref|YP_003747845.1| lysozyme (endolysin) protein [Ralstonia solanacearum CFBP2957]
 gi|299073908|emb|CBJ53439.1| lysozyme (Endolysin) protein [Ralstonia solanacearum CFBP2957]
          Length = 154

 Score =  114 bits (285), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 61/149 (40%), Positives = 79/149 (53%), Gaps = 11/149 (7%)

Query: 28  VPNALIKMLKEFEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEAED 79
           VP + + + K FEG    A  D           G WTIGYGH        +T+ + EA  
Sbjct: 6   VPQSAVDLAKRFEGFHRMAKLDPTRAHPYVCPAGYWTIGYGHLCDPAHPPITVAQAEA-- 63

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
           +L  D   +LN  L   P L +T   RL A+ DF FNLG G    ST ++R++ +DW  A
Sbjct: 64  YLAADLVTALNATLRCCPVL-ATEPMRLSAIVDFTFNLGAGRLQTSTLRRRINQRDWIAA 122

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A E ++W   GGKVLPGL  RR+AEV LL
Sbjct: 123 AAELRRWVYGGGKVLPGLFARREAEVALL 151


>gi|309780962|ref|ZP_07675701.1| phage lysozyme [Ralstonia sp. 5_7_47FAA]
 gi|330824642|ref|YP_004387945.1| glycoside hydrolase family 24 [Alicycliphilus denitrificans K601]
 gi|308920265|gb|EFP65923.1| phage lysozyme [Ralstonia sp. 5_7_47FAA]
 gi|329310014|gb|AEB84429.1| glycoside hydrolase family 24 [Alicycliphilus denitrificans K601]
          Length = 134

 Score =  112 bits (280), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 75/129 (58%), Gaps = 3/129 (2%)

Query: 41  GLRLTAYRDI-GGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           G+ +TA   I   G WTIGYGH      +   ITE EAE +L +D   +L   L   P L
Sbjct: 4   GIEITAIPYICPAGFWTIGYGHFCDP--KHPPITEAEAEAYLARDLQTALAATLRYCPVL 61

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
            +  E+R+  + DF FNLG G    ST ++R++ +DW  AA E ++W   GGKVLPGL  
Sbjct: 62  ATEPESRIATIVDFTFNLGAGRLQTSTLRRRINQRDWSAAATELRRWVYGGGKVLPGLFA 121

Query: 160 RRDAEVKLL 168
           RR+AE+ LL
Sbjct: 122 RREAEISLL 130


>gi|49206939|ref|YP_026136.1| Mur1 [Serratia entomophila]
 gi|48995186|gb|AAT48337.1| Mur1 [Serratia entomophila]
          Length = 141

 Score =  112 bits (279), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 59/138 (42%), Positives = 88/138 (63%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++K FEGLRL AY+      W+IGYGHT + V     ITE +A  FL +D ++S   +
Sbjct: 8   LKLIKHFEGLRLRAYQ-CSANVWSIGYGHT-AGVGPDDVITEGQAISFLRQDVAESERAV 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +        ++N+  A+  FVFNLG+GN+  ST  ++++A D++ AA+E  +W  AGGK
Sbjct: 66  NQYVHV--PLTQNQFDALVSFVFNLGVGNFRTSTLLKKLNAGDYDGAAQEFGRWIHAGGK 123

Query: 153 VLPGLVKRRDAEVKLLLE 170
            LPGLV+RR+AE  L L+
Sbjct: 124 ALPGLVRRREAESALFLK 141


>gi|34496182|ref|NP_900397.1| phage-related lysozyme [Chromobacterium violaceum ATCC 12472]
 gi|34102036|gb|AAQ58403.1| probable phage-related lysozyme [Chromobacterium violaceum ATCC
           12472]
          Length = 146

 Score =  111 bits (278), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 88/139 (63%), Gaps = 3/139 (2%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           A I ++K+FEG+RL AY+D+ G  WTIGYGHTG DV  GMTIT+++A+  L  D  K   
Sbjct: 6   AGISLIKQFEGVRLAAYQDMVG-VWTIGYGHTGPDVKAGMTITQQQADQLLAADLEKFET 64

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            + ++   +   + N+  A+  F +NLG+GN   ST  + ++  D++ AA +  +W +AG
Sbjct: 65  GVRKA--VIVPLNANQFSALVSFSYNLGLGNLRSSTLLRLLNKGDYDGAAAQFPRWNRAG 122

Query: 151 GKVLPGLVKRRDAEVKLLL 169
           G+ +PGL +RR AE  L L
Sbjct: 123 GQAVPGLTRRRKAEQALFL 141


>gi|319407458|emb|CBI81108.1| phage-related lysozyme [Bartonella sp. 1-1C]
          Length = 220

 Score =  107 bits (268), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 62/139 (44%), Positives = 86/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT S     V EGMTITEK+AE  L KD  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNSAGKPLVYEGMTITEKQAEKLLCKDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + E +  +  T E +  A+  F +N+G   ++ ST  ++++  ++E    E +KWTK
Sbjct: 68  ENAV-ERAVTVPLTDE-QFAALVSFCYNVGTTAFSNSTLLKKLNKGEYEAVPSELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLHGLVHRRAAEAGL 144


>gi|299138984|ref|ZP_07032161.1| Lysozyme [Acidobacterium sp. MP5ACTX8]
 gi|298599138|gb|EFI55299.1| Lysozyme [Acidobacterium sp. MP5ACTX8]
          Length = 146

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 84/138 (60%), Gaps = 8/138 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + + K+FEGLRLTAY+D+ G  WTIGYGHTG DV  G TIT ++A+  LL D + ++  +
Sbjct: 10  LSLTKQFEGLRLTAYQDVAG-VWTIGYGHTG-DVHPGQTITNEQADSLLLSDMAIAIACV 67

Query: 93  --LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
             L   P     ++ +  A+ DF FN G+GN+  ST  + ++  D+  AA++   W  AG
Sbjct: 68  NRLVKVP----LTQGQFDALCDFTFNEGVGNFTTSTLLRVLNTGDYTAAAKQFSVWVYAG 123

Query: 151 GKVLPGLVKRRDAEVKLL 168
           GKV  GL +RR AE  + 
Sbjct: 124 GKVQAGLERRRAAEQAMF 141


>gi|207725395|ref|YP_002255791.1| phage-related lysozyme (muraminidase) protein [Ralstonia
           solanacearum MolK2]
 gi|206590631|emb|CAQ37593.1| phage-related lysozyme (muraminidase) protein [Ralstonia
           solanacearum MolK2]
          Length = 132

 Score =  107 bits (268), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 68/117 (58%), Gaps = 3/117 (2%)

Query: 52  GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVA 111
            G WTIGYGH          IT+ +AE +L  D   +LN  L   P L +    RL A+ 
Sbjct: 16  AGYWTIGYGHLCDQAHP--PITQAQAEVYLAADLVTALNATLRCCPVL-AIEPMRLAAIV 72

Query: 112 DFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           DF FNLG G    ST ++R++ +DW  AA E ++W   GGKVLPGL+ RR+AEV LL
Sbjct: 73  DFTFNLGAGRLQTSTLRRRINQRDWIAAAAELRRWVYGGGKVLPGLLARREAEVALL 129


>gi|240850440|ref|YP_002971834.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240267563|gb|ACS51151.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 220

 Score =  107 bits (267), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 86/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT S     + EGMTITEK+AE+ L +D  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNSAGKPFIYEGMTITEKQAEELLRQDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + ++     S ++ +  A+  F +N+G G +  ST  ++++  ++E    E +KWTK
Sbjct: 68  ENAVEQAVQV--SLTDEQFAALVSFCYNVGTGAFCNSTLLKKLNQGEYEAVPAELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GL  RR AE  L
Sbjct: 126 AGGKRLEGLAHRRAAETGL 144


>gi|49476121|ref|YP_034162.1| phage related lysozyme [Bartonella henselae str. Houston-1]
 gi|49238929|emb|CAF28224.1| phage related lysozyme [Bartonella henselae str. Houston-1]
          Length = 220

 Score =  107 bits (266), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL+AY+D   G WTIGYGHT S     V +GMTITEK+AE+ L +D  + 
Sbjct: 9   LALIKQWEGLRLSAYQD-SIGVWTIGYGHTKSAGKPFVRKGMTITEKQAEELLCRDLQQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + ++     S ++ +  A+  F +N+G   +  ST  ++++  D+E    E +KWTK
Sbjct: 68  ENAVEQAVTV--SLTDEQFAALVSFCYNVGTTAFCNSTLLKKLNNGDYEAIPTELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLQGLVNRRAAETGL 144


>gi|240849964|ref|YP_002971353.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240267087|gb|ACS50675.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 220

 Score =  105 bits (263), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 86/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT S     + EGMTITEK+AE+ L +D  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNSAGKPFIYEGMTITEKQAEELLRQDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N++ ++     S ++ +  A+  F +N+G   +  ST  ++++  ++E    E +KWTK
Sbjct: 68  ENVVEQAVQV--SLTDEQFAALVSFCYNVGTDAFCNSTLLKKLNQGEYEAVPAELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GL  RR AE  L
Sbjct: 126 AGGKRLEGLAHRRAAETGL 144


>gi|268526578|gb|ACZ05619.1| unknown [Serratia proteamaculans]
          Length = 144

 Score =  105 bits (262), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 87/139 (62%), Gaps = 5/139 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++KEFEGLRL AYR      WT+GYGHT + VT+G  IT  EA+  L  D +     +
Sbjct: 8   IALIKEFEGLRLHAYR-CAADVWTVGYGHT-AGVTKGDIITVDEAQTMLTNDITVFERAV 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
             S       ++++  A+   VFN+G GN+ +ST  ++++ QD+  A  E  +WT+A GK
Sbjct: 66  --SQAVAVPLNQSQYDALVSLVFNIGQGNFKRSTLLKKLNKQDYVGAGNEFLRWTRANGK 123

Query: 153 VLPGLVKRRDAEVKLLLES 171
           VLPGL++RR+AE ++L E+
Sbjct: 124 VLPGLIRRREAE-RVLFET 141


>gi|261881088|ref|ZP_06007515.1| phage lysozyme [Prevotella bergensis DSM 17361]
 gi|270332207|gb|EFA42993.1| phage lysozyme [Prevotella bergensis DSM 17361]
          Length = 141

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 89/143 (62%), Gaps = 8/143 (5%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
           N LI  +KEFEGLRL AYRD GG   TIGYGHT   V  G  ITE++AE+ L +D    L
Sbjct: 5   NQLIVKIKEFEGLRLRAYRDSGGKP-TIGYGHT-LGVKMGQRITERQAEEMLEQD----L 58

Query: 90  NLLLESSPALKST-SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE-ECKKWT 147
            +       +K+  ++ +  AV  F+FNLG+GN+ +ST  +R+     ++  + E ++W 
Sbjct: 59  WVAGRFPNTMKAIDTQGKYDAVVSFIFNLGVGNFKRSTLYRRILHHAPDRLIQAEFRRWV 118

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            +GGKVLPGLVKRR+ E +  +E
Sbjct: 119 HSGGKVLPGLVKRREWEARRWVE 141


>gi|240850577|ref|YP_002971977.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240267700|gb|ACS51288.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 221

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 62/136 (45%), Positives = 82/136 (60%), Gaps = 7/136 (5%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           LK++EGLRL AY+D  G  WTIGYGHT       V EGM ITEK+AE  LL D  +    
Sbjct: 13  LKKWEGLRLQAYQDTSG-VWTIGYGHTKKAGQPTVVEGMVITEKKAETMLLADLQQ-YER 70

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
            +E +  + + S+ +  A+  F +N+GI  +  ST  +R++  D+E    E +KWTKAGG
Sbjct: 71  AVEKAVCV-NLSDEQFGALVSFCYNVGIAAFQSSTLLKRLNRGDYEAVPTELQKWTKAGG 129

Query: 152 KVLPGLVKRRDAEVKL 167
           K L GLV RR AE  L
Sbjct: 130 KRLQGLVHRRVAEAGL 145


>gi|290474245|ref|YP_003467122.1| putative lysozyme [Xenorhabdus bovienii SS-2004]
 gi|289173555|emb|CBJ80335.1| putative lysozyme (Lysis protein) (Muramidase) (Endolysin) (P13)
           [Xenorhabdus bovienii SS-2004]
          Length = 144

 Score =  105 bits (261), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 89/147 (60%), Gaps = 11/147 (7%)

Query: 28  VPNALIKMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD- 84
           + N  ++ ++++EGL+L AY D   GG  WTIGYGHT  DV  G  ITE++AE FL  D 
Sbjct: 3   ISNKGLEFIQQWEGLKLKAYPDPATGGIPWTIGYGHT-KDVKPGQVITEQQAEAFLHDDL 61

Query: 85  --ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
             A  +L  L++        ++ +  A+  F+FN G GN++ ST  ++++A D+  AA E
Sbjct: 62  IPAYATLERLVKVP-----LTQGQFDALCSFIFNCGTGNFSGSTLLKKINAGDYAGAAAE 116

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLL 169
             +W KA GKV+ GL +RR +E ++ L
Sbjct: 117 FPRWNKAAGKVMNGLTRRRASEQQMFL 143


>gi|49475100|ref|YP_033141.1| Phage related lysozyme [Bartonella henselae str. Houston-1]
 gi|49237905|emb|CAF27106.1| Phage related lysozyme [Bartonella henselae str. Houston-1]
          Length = 220

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 86/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT +     V +GM ITEK+AE+ L +D  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNNAGKPFVYKGMAITEKQAEELLCQDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + ++     S ++ +  A+  F +N+G   +  ST  +++++ D+E    E +KWTK
Sbjct: 68  ENTVEQAVQV--SLTDEQFAALVSFCYNVGTTAFCNSTLLRKLNSGDYEAIPTELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLQGLVHRRAAEAGL 144


>gi|319408102|emb|CBI81755.1| Lysozyme [Bartonella schoenbuchensis R1]
 gi|319408841|emb|CBI82498.1| Lysozyme [Bartonella schoenbuchensis R1]
          Length = 221

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 84/143 (58%), Gaps = 7/143 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           +  LK++EGLRL AY+D   G WTIGYGHTG     DV EGM IT+++AE  LL D  K 
Sbjct: 10  LNYLKKWEGLRLNAYQD-ASGVWTIGYGHTGKAGKPDVVEGMVITKQKAETMLLTDLQK- 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E S  +   S+ +  A+  F +N+G+  + +ST  ++++  D+E    E +KWT 
Sbjct: 68  YEAAVEKSVCV-DLSDEQFGALVSFCYNVGVNAFQRSTLLKKLNKGDYEAVPAELQKWTM 126

Query: 149 AGGKVLPGLVKRRDAEVKLLLES 171
           A GK L GLV RR AE  L   S
Sbjct: 127 ADGKRLKGLVHRRAAEAGLWATS 149


>gi|10956821|ref|NP_065275.1| hypothetical protein pADAP_53 [Serratia entomophila]
 gi|9963683|gb|AAG09647.1| unknown [Serratia entomophila]
          Length = 144

 Score =  104 bits (260), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 86/138 (62%), Gaps = 5/138 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++KEFEGLRL AYR      WT+GYGHT + VT+G  IT  EA+  L  D +     +
Sbjct: 8   IALIKEFEGLRLHAYR-CAADVWTVGYGHT-AGVTKGDIITVDEAQTMLTNDITVFERAV 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
             S       ++++  A+   VFN+G GN+ +ST  ++++ QD+  A  E  +WT+A GK
Sbjct: 66  --SQAVAVPLNQSQYDALVSLVFNIGQGNFKRSTLLKKLNKQDYVGAGNEFLRWTRANGK 123

Query: 153 VLPGLVKRRDAEVKLLLE 170
           VLPGL++RR+AE ++L E
Sbjct: 124 VLPGLIRRREAE-RVLFE 140


>gi|163867574|ref|YP_001608773.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
 gi|161017220|emb|CAK00778.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
          Length = 220

 Score =  104 bits (259), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 85/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT +     V +GM ITEK+AE+ L  D  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNNAGKPFVHKGMAITEKQAEELLCHDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + ++     S ++ +  A+  F +N+G   +  ST  +++++ D+E    E +KWTK
Sbjct: 68  ENAIEQAVQV--SLTDEQFAALVSFCYNVGTTAFCNSTLLKKLNSGDYEAIPTELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLQGLVHRRAAEAGL 144


>gi|325568691|ref|ZP_08144984.1| lysozyme [Enterococcus casseliflavus ATCC 12755]
 gi|325157729|gb|EGC69885.1| lysozyme [Enterococcus casseliflavus ATCC 12755]
          Length = 231

 Score =  103 bits (257), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 80/137 (58%), Gaps = 4/137 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
            +++K FEGL LTAY D+ G  WTIGYGHT   V  GMTIT ++A +FL +D    L  +
Sbjct: 13  FELIKGFEGLSLTAYLDVVG-VWTIGYGHT-QGVYAGMTITLEQANNFLKQDIENHLPGI 70

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +        ++N+  A+A F FNLG+     ST    +++++W+ AA E KK+    G 
Sbjct: 71  YKYVTV--ELNQNQFDALASFHFNLGVNILQGSTLLTYINSKNWQAAANEMKKYVNGNGS 128

Query: 153 VLPGLVKRRDAEVKLLL 169
           V+PGLV RR  E  L L
Sbjct: 129 VIPGLVTRRQLETDLFL 145


>gi|197281719|gb|ACH57083.1| peptidoglycan hydrolase [Bacillus phage Nf]
          Length = 262

 Score =  103 bits (257), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 58/146 (39%), Positives = 85/146 (58%), Gaps = 9/146 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           +  A I ++K FEGLR  AY+ +     +TIGYGH GSDV     I+EKEAE  L  D  
Sbjct: 3   ISQAGINLIKSFEGLRTKAYKAVPTEKYYTIGYGHYGSDVRVDQVISEKEAEKLLYDDVQ 62

Query: 87  K---SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
               ++N LL+        ++N+  A+  F +N+G+G    ST  + ++  +++KAA+E 
Sbjct: 63  SFVDAVNKLLKVD-----VTQNQFDALVSFAYNVGVGALKSSTLLEYLNTGNFQKAADEF 117

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLL 169
            +W K+GGKV  GLVKRR+ E  L L
Sbjct: 118 LRWNKSGGKVYSGLVKRREQERTLFL 143


>gi|322435593|ref|YP_004217805.1| glycoside hydrolase family 24 [Acidobacterium sp. MP5ACTX9]
 gi|321163320|gb|ADW69025.1| glycoside hydrolase family 24 [Acidobacterium sp. MP5ACTX9]
          Length = 150

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 84/139 (60%), Gaps = 8/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           + + + FEG+RLTAY+D  GG WTIGYGHTG+DV  G+TIT  +AE FLL D   AS ++
Sbjct: 11  LALTESFEGVRLTAYQD-QGGVWTIGYGHTGADVHSGLTITLTQAEQFLLADVRHASDTV 69

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N L+ +   L     + LV   DF FN G G +  S   + ++A    +AA + + W   
Sbjct: 70  NRLV-TWAGLDQMVFDSLV---DFAFNAGCGAFAGSMLLKDLNAGKLAEAAHQFEAWDHV 125

Query: 150 GGKVLPGLVKRRDAEVKLL 168
            G+V+ GL++RR AE KL 
Sbjct: 126 SGQVVAGLLRRRLAEEKLF 144


>gi|319406704|emb|CBI80337.1| Lysozyme [Bartonella sp. 1-1C]
          Length = 221

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 61/143 (42%), Positives = 81/143 (56%), Gaps = 7/143 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           +  LK++EGLRL AYRD   G WTIGYGHT       V EGM ITE++AE  LL D  + 
Sbjct: 10  LNYLKKWEGLRLHAYRD-ASGIWTIGYGHTEKAGKPMVVEGMVITERKAETMLLTDLRQY 68

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              +          S+ +  A+  F +N+GI  +  ST  ++++  D+E    E +KWTK
Sbjct: 69  ERAV--EKAVYVDLSDEQFGALVSFCYNIGITAFQNSTLLKKLNKGDYESVPIELQKWTK 126

Query: 149 AGGKVLPGLVKRRDAEVKLLLES 171
           AGGK L GLV RR AE  L  +S
Sbjct: 127 AGGKRLKGLVHRRAAEAGLWAKS 149


>gi|163869034|ref|YP_001610265.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
 gi|161018712|emb|CAK02270.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
          Length = 220

 Score =  103 bits (256), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 85/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT +     V +GM ITEK+AE+ L  D  + 
Sbjct: 9   LALIKQWEGLRLQAYKD-AIGVWTIGYGHTSTAGKPFVHKGMIITEKQAEEVLSHDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + ++     S ++ +  A+  F +N+G   + KST  ++++  ++E    E +KWTK
Sbjct: 68  ENTVEKNVTV--SLTDEQFAALVSFCYNVGTAAFCKSTLLKKLNNSEYEAVPSELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLHGLVHRRAAEAGL 144


>gi|160939947|ref|ZP_02087293.1| hypothetical protein CLOBOL_04837 [Clostridium bolteae ATCC
           BAA-613]
 gi|158437091|gb|EDP14857.1| hypothetical protein CLOBOL_04837 [Clostridium bolteae ATCC
           BAA-613]
          Length = 480

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 87/145 (60%), Gaps = 10/145 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA-- 85
           + +A I ++K+FEG RL AYR    G  TIGYGHT + V  GM IT+ +AE +L +D   
Sbjct: 342 ISDAGICLIKQFEGCRLEAYR-CAAGVPTIGYGHT-AGVAMGMKITQAQAEAYLREDLRA 399

Query: 86  -SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
             K++N +LE S      ++N+  A+  F +NLG G    ST  +R+ A D + AA+E  
Sbjct: 400 FEKAVNKVLECS-----VTQNQFDALVSFAYNLGAGALRNSTLLKRLHAGDVKGAADEFP 454

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLL 169
           KW KA GKVL GL +RR  E +L L
Sbjct: 455 KWNKAAGKVLEGLTRRRMMERQLFL 479


>gi|240851176|ref|YP_002972579.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240268299|gb|ACS51887.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 220

 Score =  102 bits (253), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 59/144 (40%), Positives = 89/144 (61%), Gaps = 7/144 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLK 83
           + +A + ++K++EGLRL AY+D   G WTIGYGHT +     V +GM ITEK+AE+ L +
Sbjct: 4   ISSAGLALIKQWEGLRLNAYKD-AIGVWTIGYGHTSAAGEPFVHKGMIITEKQAEEVLSQ 62

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           D  +  N + E++  +  T E +  A+  F +N+G   +  ST  ++++  ++E    E 
Sbjct: 63  DLRQFENTV-ETNVTVSLTDE-QFAALVSFCYNIGTSAFCNSTLLKKLNNGEYEAVPAEL 120

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
           +KWTKAGGK L GLV RR AE  L
Sbjct: 121 QKWTKAGGKRLHGLVHRRAAEAGL 144


>gi|319405968|emb|CBI79599.1| phage-related lysozyme [Bartonella sp. AR 15-3]
          Length = 220

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 85/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT +     + EGMTITE +AE  L +D  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNTAGKPFIYEGMTITETQAEKLLCQDLRQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N++ E + ++  T E +  A+  F +N+G   +  ST  ++++  ++E    E +KWTK
Sbjct: 68  ENVV-ERTVSVSLTDE-QFAALVSFCYNVGTVAFCNSTLLKKLNQGEYEAVPAELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GL  RR AE  L
Sbjct: 126 AGGKRLQGLAHRRAAEAGL 144


>gi|319405783|emb|CBI79409.1| phage-related lysozyme [Bartonella sp. AR 15-3]
          Length = 221

 Score =  102 bits (253), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 85/143 (59%), Gaps = 7/143 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           +  LK++EGLRL AY+D   G WTIGYGHT       V EGM ITEK+AE  LL D  + 
Sbjct: 10  LNYLKKWEGLRLYAYQD-ASGIWTIGYGHTEKAGKPIVFEGMVITEKKAETMLLSDL-RQ 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E +  + + S+ +  A+  F +N+GI  +  ST  ++++  D+E    E +KWTK
Sbjct: 68  YERAVEKAVYV-NLSDEQFGALVSFCYNIGIRAFQNSTLLRKLNKGDYESVPIELQKWTK 126

Query: 149 AGGKVLPGLVKRRDAEVKLLLES 171
           AGGK L GLV RR AE  L  +S
Sbjct: 127 AGGKRLKGLVHRRAAEAGLWAKS 149


>gi|163867730|ref|YP_001608932.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
 gi|161017379|emb|CAK00937.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
          Length = 220

 Score =  101 bits (252), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 85/139 (61%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT +     V +GMTITEK+AE+ L +D  + 
Sbjct: 9   LALIKQWEGLRLNAYKD-AIGVWTIGYGHTNNAGKPFVHKGMTITEKQAEELLCQDLKQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N +  +     S ++ +  A+  F +N+G   +  ST  ++++  ++E    E +KWTK
Sbjct: 68  ENAVERAVTV--SLTDEQFAALVSFCYNVGTTAFCNSTLLKKLNNGEYEAIPIELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLQGLVHRRAAEAGL 144


>gi|78188678|ref|YP_379016.1| phage-related lysozyme [Chlorobium chlorochromatii CaD3]
 gi|78170877|gb|ABB27973.1| probable phage-related lysozyme [Chlorobium chlorochromatii CaD3]
          Length = 142

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 85/140 (60%), Gaps = 9/140 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK---SL 89
           + +++++EGLRL  Y     G  TIGYGHTG+DVT GM+ITE +A + L +D  +   S+
Sbjct: 8   LNIIRQYEGLRLKTYF-CPAGKLTIGYGHTGTDVTSGMSITEAQANELLQEDVKRFATSV 66

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N ++ +       ++    A+  F +N+G GN  KST  ++++A D + AA+E  KW K+
Sbjct: 67  NKMVTTE-----VTQGMFDALISFSYNIGAGNLQKSTLLKKLNAGDKQGAADEFLKWNKS 121

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
            GK L GL  RR AE +L L
Sbjct: 122 NGKPLAGLTARRTAERELFL 141


>gi|49475681|ref|YP_033722.1| Phage related lysozyme [Bartonella henselae str. Houston-1]
 gi|49238488|emb|CAF27719.1| Phage related lysozyme [Bartonella henselae str. Houston-1]
          Length = 221

 Score =  101 bits (251), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 60/139 (43%), Positives = 79/139 (56%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           +  LK++EGLRL AYRD   G WTIGYGHT       V EGM ITEK AE  LL+D  + 
Sbjct: 10  LNYLKKWEGLRLHAYRD-ASGVWTIGYGHTEKAGKPIVVEGMVITEKRAEILLLEDLRQY 68

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              +          S+ +  A+  F +N+GI  +  ST  ++++  D+E    E +KWT+
Sbjct: 69  ERAV--EKAVYVDLSDEQFGALVSFCYNIGIIAFQNSTLLKKLNKGDYESVPIELQKWTR 126

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 127 AGGKRLKGLVHRRAAEAGL 145


>gi|315122678|ref|YP_004063167.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|315122767|ref|YP_004063256.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496080|gb|ADR52679.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313496169|gb|ADR52768.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 102

 Score =  100 bits (250), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 50/102 (49%), Positives = 66/102 (64%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129
           M ITE++A+D L  D SK L+ +   SP L    ENR+ A+ DFVFN GIG Y  S  ++
Sbjct: 1   MAITEQQADDLLKWDVSKCLSQVFTVSPILIHAGENRISAIGDFVFNFGIGRYRASALRK 60

Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
            VDA+DW  A+ E +KW  AGGK L GLV R + E +LLL++
Sbjct: 61  CVDAEDWVTASHEIRKWVFAGGKKLNGLVLRGEVEAELLLKN 102


>gi|163867566|ref|YP_001608765.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
 gi|161017212|emb|CAK00770.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
          Length = 220

 Score =  100 bits (249), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 84/139 (60%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY D  GG WTIGYGHT +     V + M ITEKEAE  L +D  + 
Sbjct: 9   LALIKQWEGLRLKAYED-SGGIWTIGYGHTSAAGAPSVYKDMQITEKEAEKILCQDL-RE 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E + A+   S+ +  A+  F +N+GI  + KST  ++++  ++E    E +KWT+
Sbjct: 67  CEAAIEKAVAV-PLSDEQFAALVSFSYNVGITAFCKSTLLKKLNNGEYEAVPTELQKWTR 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
            GGK + GLV RR AE  L
Sbjct: 126 VGGKRIQGLVNRRAAEAGL 144


>gi|49474656|ref|YP_032698.1| phage related lysozyme [Bartonella quintana str. Toulouse]
 gi|49240160|emb|CAF26619.1| phage related lysozyme [Bartonella quintana str. Toulouse]
          Length = 220

 Score =  100 bits (249), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 58/139 (41%), Positives = 83/139 (59%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT       V +GM ITEK+A +FL +D  + 
Sbjct: 9   LALIKQWEGLRLNAYQD-AVGLWTIGYGHTSDAGKPSVRKGMKITEKQAAEFLCQDLQQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N + E +  +  T E +  A+  F +N+G   +  S   ++++  D+E    E +KWTK
Sbjct: 68  ENAV-EQAVTVPLTDE-QFAALVSFCYNVGTTAFCNSMLLKKLNKGDYEAVPVELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLQGLVNRRAAEAGL 144


>gi|253990596|ref|YP_003041952.1| phage lysozyme [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253991055|ref|YP_003042411.1| phage lysozyme [Photorhabdus asymbiotica subsp. asymbiotica ATCC
           43949]
 gi|253782046|emb|CAQ85210.1| putative phage lysozyme [Photorhabdus asymbiotica]
 gi|253782505|emb|CAQ85669.1| phage lysozyme [Photorhabdus asymbiotica]
          Length = 141

 Score = 99.8 bits (247), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/134 (41%), Positives = 82/134 (61%), Gaps = 4/134 (2%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           LK +EG  LT+YR    G WTIGYGHT   V  G  ITE++AE FLL D +  + + +E 
Sbjct: 11  LKGYEGCSLTSYR-CPAGVWTIGYGHT-LGVKPGDAITEQQAEQFLLDDLA-PVYITIEH 67

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
           +  +K T + +  A+  F+FN G G + +ST  ++++A D+  AA E  +W  AGG++LP
Sbjct: 68  NVKVKLT-QGQFDALCSFIFNCGAGAFVRSTLLKKLNAGDYNGAANEFMRWNMAGGRILP 126

Query: 156 GLVKRRDAEVKLLL 169
           GL  RR +E  + L
Sbjct: 127 GLDARRASEKTMFL 140


>gi|253990804|ref|YP_003042160.1| Phage related lysozyme [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|211639140|emb|CAR67752.1| Phage related lysozyme [Photorhabdus asymbiotica subsp. asymbiotica
           ATCC 43949]
 gi|253782254|emb|CAQ85418.1| Phage related lysozyme [Photorhabdus asymbiotica]
          Length = 167

 Score = 99.4 bits (246), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 88/142 (61%), Gaps = 11/142 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSL 89
            +++K FEGLRL AY+      WTIGYGHT + V  G  I+ ++A+ FL   + DA +++
Sbjct: 32  FELIKHFEGLRLHAYQ-CSANVWTIGYGHT-AGVRLGDVISAEKADAFLRRDVADAERTV 89

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N     +    S ++++  A+  FVFNLG GN+  S   ++++A D+  AA E  +W  A
Sbjct: 90  N-----NAVSVSINQHQFDALVSFVFNLGAGNFRSSVLLKKLNAGDYAGAAGELLRWVNA 144

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
           GG+ L GLV+RR+AE K+L E+
Sbjct: 145 GGQKLAGLVRRREAE-KMLFET 165


>gi|239502928|ref|ZP_04662238.1| lysozyme [Acinetobacter baumannii AB900]
          Length = 149

 Score = 99.0 bits (245), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 90/151 (59%), Gaps = 13/151 (8%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH----TGSDVTEGMTITEKEAEDFLL 82
              NA + ++K FEG RL AY D G G WTIG+G      G  V +G T TE++AE +L 
Sbjct: 4   TTSNAGLNLIKGFEGKRLNAYDD-GVGVWTIGFGTIKYPNGVRVKKGDTCTEQQAETYLK 62

Query: 83  KDASK---SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
            D +K    +N L++ S      ++N+  A+A F +NLG  N   ST  ++++  D++ A
Sbjct: 63  NDLTKFEVVINKLVKVS-----LTQNQFDALASFTYNLGETNLANSTLLKKLNKGDYQGA 117

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           A++   W KAGGKVL GLV+RR+AE  L L+
Sbjct: 118 ADQFLVWNKAGGKVLKGLVRRREAERALFLK 148


>gi|240849935|ref|YP_002971324.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240267058|gb|ACS50646.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 220

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 55/139 (39%), Positives = 83/139 (59%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKS 88
           + ++K+ EGLRL+AY +  GG WTIGYGHT +     V + M ITEKEAE  L +D  + 
Sbjct: 9   LALIKQLEGLRLSAY-EYSGGVWTIGYGHTNAAGAPSVHKDMQITEKEAEKILCQDL-RE 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             L++E +  +   +E +  A+  F +N+GI  +  ST  ++++   +E    E +KWT+
Sbjct: 67  CELVVEKAVTVPLNNE-QFAALVSFCYNVGITAFCNSTLLKKLNKGAYEVVPTELQKWTR 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
            GGK + GLV RR AE  L
Sbjct: 126 VGGKRIQGLVNRRAAEAGL 144


>gi|328725320|ref|XP_003248428.1| PREDICTED: lysozyme-like [Acyrthosiphon pisum]
          Length = 149

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 59/145 (40%), Positives = 83/145 (57%), Gaps = 11/145 (7%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG--MTITEKEAEDFLLKDASK 87
           N  I ++K++EGLRLT Y+D   G  TIGYGH  + +  G   TIT ++AE  L +D  +
Sbjct: 10  NGGIALIKQYEGLRLTTYKD-AVGIPTIGYGHVENPIPPGGTRTITAEDAEQILREDLQR 68

Query: 88  ---SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
               +N +L         ++N+  A+  F FNLG  N   ST  ++V++ D+  AAEE  
Sbjct: 69  FEHDVNNMLTVE-----VTQNQFDALVSFAFNLGPANLKSSTLLRKVNSGDFNGAAEEFT 123

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLL 169
           KW  AGG+VL GL  RR+AE  L L
Sbjct: 124 KWNHAGGQVLAGLTARRNAEKNLFL 148


>gi|319899314|ref|YP_004159411.1| Phage lysozyme [Bartonella clarridgeiae 73]
 gi|319403282|emb|CBI76841.1| Phage lysozyme [Bartonella clarridgeiae 73]
          Length = 219

 Score = 98.6 bits (244), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 80/139 (57%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D   G WTIGYGHT       V EGM IT  EAE  L KD S+ 
Sbjct: 9   LALIKQWEGLRLKAYQD-AIGVWTIGYGHTAQAGEPIVQEGMEITHLEAEAVLQKDLSQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              +       +S ++ +  A+  F +N+GI  +  ST  ++++  ++E    E +KWTK
Sbjct: 68  EQTV--EHEVKQSLTDEQFAALVSFCYNVGIEAFCNSTLLKKLNKGEYEAVPAELQKWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           A GK L GLV RR AE  L
Sbjct: 126 ANGKRLQGLVHRRAAEAGL 144


>gi|282878303|ref|ZP_06287097.1| phage lysozyme [Prevotella buccalis ATCC 35310]
 gi|281299574|gb|EFA91949.1| phage lysozyme [Prevotella buccalis ATCC 35310]
          Length = 146

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 62/149 (41%), Positives = 85/149 (57%), Gaps = 7/149 (4%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLK 83
           K    N LI+ LKEFEGLRL AY+      W TIGYGH+  DV  GM ITE++AE+ L +
Sbjct: 2   KFRASNLLIQKLKEFEGLRLVAYKPTKAERWYTIGYGHSAGDVRAGMRITEEKAEELLKR 61

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV--DAQDWEKAAE 141
           D    +   +   P +K  ++ +  A+  F +N+GIGN  +ST  +++  DA   E    
Sbjct: 62  DLF-FVEKFINGIPKVK--TQGQFDALVSFTYNVGIGNLKRSTLLKKIMHDAPTSE-IQR 117

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           E  KW  +GGK L GLVKRR  E +  +E
Sbjct: 118 EFMKWVYSGGKKLDGLVKRRRWESQRWVE 146


>gi|194335986|ref|YP_002017780.1| Lysozyme [Pelodictyon phaeoclathratiforme BU-1]
 gi|194308463|gb|ACF43163.1| Lysozyme [Pelodictyon phaeoclathratiforme BU-1]
          Length = 143

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 85/138 (61%), Gaps = 9/138 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK---SLNL 91
           +++++EGLRL  Y    GG  TIGYGHTG DVT G  I E+EA   L+KD  +   ++N 
Sbjct: 11  LIRKYEGLRLATYV-CPGGKLTIGYGHTGPDVTTGKKIDEEEANALLVKDVQRFERAVNG 69

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           L+ ++P     ++    A+  F FNLG+G+   ST  ++++A +   AA+E  KW KAGG
Sbjct: 70  LV-TAP----MTQGMFDALISFSFNLGVGSLKSSTLLKKLNAGNLTGAADEFLKWNKAGG 124

Query: 152 KVLPGLVKRRDAEVKLLL 169
           KVL GL  RR++E +  L
Sbjct: 125 KVLAGLSARRESERERFL 142


>gi|240849955|ref|YP_002971344.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240267078|gb|ACS50666.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 220

 Score = 97.4 bits (241), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 83/139 (59%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           ++++K++EGLRL AYRD     WTIGYGHT +     V +GM I++++AE+ L +D  K 
Sbjct: 9   LELIKQWEGLRLEAYRDTAC-VWTIGYGHTSNASHPLVKKGMCISQEQAEEILCEDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E S  + S ++ +  A+  F +N+G   + KST  ++++  D+E    E +KW K
Sbjct: 67  FEQTVEESVTV-SLTDCQFAALVSFCYNVGTAAFRKSTLLKKLNQGDYEAVPLELQKWNK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
            GGK L GL  RR AE  L
Sbjct: 126 VGGKPLAGLANRRAAEAGL 144


>gi|22855163|ref|NP_690649.1| morphogenesis protein [Bacillus phage B103]
 gi|6016519|sp|Q37896|LYS_BPB03 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Morphogenesis protein
           2; AltName: Full=Muramidase
 gi|1429244|emb|CAA67646.1| morphogenesis protein [Bacillus phage B103]
          Length = 263

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 85/146 (58%), Gaps = 9/146 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           +  A I ++K FEGLR  AY+ +     +TIGYGH GSDV     I+E++AE  L  D  
Sbjct: 3   ISQAGINLIKSFEGLRTKAYKAVPTEKYYTIGYGHYGSDVHPCQVISEEKAEKLLRDDVQ 62

Query: 87  K---SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           +    ++ LL+        ++++  A+  F +N+G+G    ST  Q ++A +++KAA E 
Sbjct: 63  EFVDGVDKLLKVD-----VTQSQFDALVSFAYNVGLGALKSSTLLQYLNAGNFQKAANEF 117

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLL 169
            KW K+GGKV  GLVKRR+ E  L L
Sbjct: 118 LKWNKSGGKVYNGLVKRREQERTLFL 143


>gi|304321647|ref|YP_003855290.1| phage related lysozyme [Parvularcula bermudensis HTCC2503]
 gi|303300549|gb|ADM10148.1| phage related lysozyme [Parvularcula bermudensis HTCC2503]
          Length = 362

 Score = 97.4 bits (241), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 63/154 (40%), Positives = 87/154 (56%), Gaps = 22/154 (14%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG---------------MTITEKEA 77
           I+++K FEGLRL  Y D G G WTIGYGHTG+   +G                +I+E  A
Sbjct: 8   IELIKAFEGLRLDVYDD-GVGIWTIGYGHTGAIEVDGKRYSSVAAAYDDLGPFSISEAYA 66

Query: 78  EDFLLKDASKSLNLLLES-SPALKST-SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD 135
           ED L +D    L + +     ALK T +++   A+    FN+G+  ++KST  +R + +D
Sbjct: 67  EDLLRED----LQVFVAGVDRALKVTPTQSMFDALVSLAFNIGVSAFSKSTAVKRHNKRD 122

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           +E AAE    W KAGG+VL GLV+RR AE  L L
Sbjct: 123 FEGAAEAITWWNKAGGQVLTGLVRRRSAEAALYL 156


>gi|209552446|ref|YP_002284361.1| putative endolysin [Pseudomonas phage PAJU2]
 gi|209528719|dbj|BAG75011.1| putative endolysin [Pseudomonas phage PAJU2]
          Length = 144

 Score = 97.4 bits (241), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 62/141 (43%), Positives = 83/141 (58%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK---SL 89
           I ++K FEGLRL+AY+D   G WTIGYG T   VT  MTIT ++AE  L  D  +    L
Sbjct: 8   IDLIKSFEGLRLSAYQD-SVGVWTIGYGTT-RGVTRYMTITVEQAERMLSNDIQRFEPEL 65

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           + L     A    ++N+  A+  FV+NLG  N   ST  + ++  D++ AA++  +W  A
Sbjct: 66  DRL-----AKVPLNQNQWDALMSFVYNLGAANLASSTLLKLLNKGDYQGAADQFPRWVNA 120

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
           GGK L GLVKRR AE  L LE
Sbjct: 121 GGKRLDGLVKRRAAERALFLE 141


>gi|83313085|ref|YP_423349.1| Phage-related lysozyme [Magnetospirillum magneticum AMB-1]
 gi|82947926|dbj|BAE52790.1| Phage-related lysozyme [Magnetospirillum magneticum AMB-1]
          Length = 151

 Score = 96.3 bits (238), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 84/148 (56%), Gaps = 7/148 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A + + K  EGLRL +Y        T+GYGHTG DV +GMTI E  A++ L  D + 
Sbjct: 5   VNEAGLALTKASEGLRLKSYL-CPAHKLTVGYGHTGPDVMDGMTIDEARADELLAADLAH 63

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           + + + ++       ++N+  A+ DFVFNLG G +  ST  ++++A D+  A++E  KW 
Sbjct: 64  AGDAVTKAVTV--DLNDNQYAALCDFVFNLGAGAFQGSTLLKKLNAGDYAGASDEFPKWD 121

Query: 148 KAG----GKVLPGLVKRRDAEVKLLLES 171
           KA      K LPGL KRR AE  L L +
Sbjct: 122 KATVDGVKKALPGLTKRRAAERTLFLTA 149


>gi|49476058|ref|YP_034099.1| phage related lysozyme [Bartonella henselae str. Houston-1]
 gi|49238866|emb|CAF28159.1| phage related lysozyme [Bartonella henselae str. Houston-1]
          Length = 220

 Score = 95.5 bits (236), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 77/137 (56%), Gaps = 7/137 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKSLN 90
           ++K++EGL L AY+D   G WTIGYGHT       V EGM IT  EAE  L KD +K   
Sbjct: 11  LIKQWEGLHLHAYQD-AVGVWTIGYGHTTQVGEPSVQEGMQITVAEAETLLQKDLAKFEK 69

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            + E     +  ++ +   +  F +N+GI  +  ST  ++++   +E    E +KWT+AG
Sbjct: 70  TVEEMVE--QPLNDEQFATLVSFCYNVGIETFCNSTLLKKLNKGKYEAVPAELQKWTRAG 127

Query: 151 GKVLPGLVKRRDAEVKL 167
           GK L GLV RR AE  L
Sbjct: 128 GKCLQGLVNRRAAEAGL 144


>gi|319406187|emb|CBI79824.1| Lysozyme [Bartonella sp. AR 15-3]
          Length = 219

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 80/139 (57%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           ++++K++EGLRL AY+D+ G  WTIGYGHT       V +GM IT  EAE  L +D  + 
Sbjct: 9   LELVKQWEGLRLKAYQDVAG-VWTIGYGHTAKAGNPVVQDGMEITHVEAEVILRQDLGQF 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              +       ++ ++ +  A+  F +N+G   +  ST  ++++  D+E    E +KW K
Sbjct: 68  EQTV--EQKVTQALTDEQFAALVSFCYNIGTKAFCDSTLLKKLNQGDYEAVPAELQKWVK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK + GLV RR AE  L
Sbjct: 126 AGGKRVQGLVNRRAAEAGL 144


>gi|13936334|gb|AAK40280.1| endolysin [Bacillus amyloliquefaciens phage Morita2001]
          Length = 258

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/143 (39%), Positives = 82/143 (57%), Gaps = 5/143 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           +  A I ++K FEGL+L AY+ +     +TIGYGH GSDV+    IT K+AED L  D  
Sbjct: 3   ISQAGINLIKSFEGLQLKAYKAVPTEKHYTIGYGHYGSDVSPRQVITAKQAEDMLRDDVQ 62

Query: 87  KSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
             ++ +   + ALK S ++N+  A+  F +N+G+G +  S+  + ++      AA E  K
Sbjct: 63  AFVDGV---NKALKVSVTQNQFDALVSFAYNVGLGAFRSSSLLEYLNEGRTALAAAEFPK 119

Query: 146 WTKAGGKVLPGLVKRRDAEVKLL 168
           W K+GGKV  GLV RR  E  L 
Sbjct: 120 WNKSGGKVYQGLVNRRAQEQALF 142


>gi|237745539|ref|ZP_04576019.1| Mur1 protein [Oxalobacter formigenes HOxBLS]
 gi|229376890|gb|EEO26981.1| Mur1 protein [Oxalobacter formigenes HOxBLS]
          Length = 147

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/131 (41%), Positives = 76/131 (58%), Gaps = 3/131 (2%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           K++ ++EG RL AY+    G WTIGYGHT   V EG   T++ A+  L+ +  K    +L
Sbjct: 10  KLIAQYEGCRLKAYK-CPAGKWTIGYGHT-EGVKEGDVWTQERADAELVMEIDKYRAAVL 67

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
              P LK+TS NRL A      N+GIGN++ S+  + +   ++  AA+    W  AGGK 
Sbjct: 68  RVCPTLKATS-NRLGACISLAHNIGIGNFSGSSVAKYIRRGEYRAAADAFGLWVNAGGKK 126

Query: 154 LPGLVKRRDAE 164
           LPGLV RR AE
Sbjct: 127 LPGLVSRRQAE 137


>gi|163869047|ref|YP_001610281.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
 gi|161018728|emb|CAK02286.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
          Length = 220

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 83/139 (59%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           ++++K++EGLRL AYRD     WTIGYGHT +     V +GM IT++ AE+ L +D  K 
Sbjct: 9   LELIKQWEGLRLEAYRDTAC-IWTIGYGHTSNAGNPLVKKGMRITKERAEEILCEDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E S  + S ++ +  A+  F +N+G   + KS+  ++++  D+E    E +KW K
Sbjct: 67  FEKTVEESVTV-SLTDCQFAALVSFCYNVGTTAFCKSSLLKKLNQGDYEAVPAELQKWNK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
            GGK+L GL  RR AE  L
Sbjct: 126 VGGKLLAGLANRRAAEAGL 144


>gi|163868277|ref|YP_001609486.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
 gi|161017933|emb|CAK01491.1| phage-related lysozyme [Bartonella tribocorum CIP 105476]
          Length = 220

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 83/139 (59%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           ++++K++EGLRL AYRD     WTIGYGHT +     V +GM IT++ AE+ L +D  K 
Sbjct: 9   LELIKQWEGLRLEAYRDTAC-IWTIGYGHTSNAGNPLVKKGMRITKERAEEILCEDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E S  + S ++ +  A+  F +N+G   + KS+  ++++  D+E    E +KW K
Sbjct: 67  FEKTVEESVTV-SLTDCQFAALVSFCYNVGTTAFCKSSLLKKLNQGDYESVPAELQKWNK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
            GGK+L GL  RR AE  L
Sbjct: 126 VGGKLLAGLANRRAAEAGL 144


>gi|167034384|ref|YP_001669615.1| lysozyme [Pseudomonas putida GB-1]
 gi|166860872|gb|ABY99279.1| Lysozyme [Pseudomonas putida GB-1]
          Length = 143

 Score = 95.1 bits (235), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 56/138 (40%), Positives = 82/138 (59%), Gaps = 6/138 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++K FEGLRL AY+D   G WTIGYG T   V  GM I++ +AE  LL D  +     
Sbjct: 8   LSLIKSFEGLRLQAYQD-SVGVWTIGYGTT-RGVKAGMKISKDQAERMLLNDVQR---FE 62

Query: 93  LESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
            E    +K   ++++  A+  F +NLG  N   ST ++ ++A ++  AAE+  +W KAGG
Sbjct: 63  PEVERLIKVPLNQDQWDALMSFTYNLGAANLESSTLRRLLNAGNYAAAAEQFPRWNKAGG 122

Query: 152 KVLPGLVKRRDAEVKLLL 169
           +VL GL +RR AE +L L
Sbjct: 123 QVLAGLTRRRAAERELFL 140


>gi|194186889|ref|YP_002004544.1| peptidoglycan hydrolase [Bacillus phage phi29]
 gi|126602|sp|P11187|LYS_BPPH2 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Morphogenesis protein
           2; AltName: Full=Muramidase
 gi|15679|emb|CAA28632.1| gene 15 product (AA 1-258); put. lysozyme [Bacillus phage phi29]
 gi|215333|gb|AAA32288.1| morphogenesis protein [Bacillus phage phi29]
 gi|190888855|gb|ACE96038.1| peptidoglycan hydrolase [Bacillus phage phi29]
 gi|225370|prf||1301270K gene 15
          Length = 258

 Score = 94.7 bits (234), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 82/143 (57%), Gaps = 5/143 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           +  A I ++K FEGL+L AY+ +     +TIGYGH GSDV+    IT K+AED L  D  
Sbjct: 3   ISQAGINLIKSFEGLQLKAYKAVPTEKHYTIGYGHYGSDVSPRQVITAKQAEDMLRDDVQ 62

Query: 87  KSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
             ++ +   + ALK S ++N+  A+  F +N+G+G +  S+  + ++      AA E  K
Sbjct: 63  AFVDGV---NKALKVSVTQNQFDALVSFAYNVGLGAFRSSSLLEYLNEGRTALAAAEFPK 119

Query: 146 WTKAGGKVLPGLVKRRDAEVKLL 168
           W K+GGKV  GL+ RR  E  L 
Sbjct: 120 WNKSGGKVYQGLINRRAQEQALF 142


>gi|240850428|ref|YP_002971822.1| phage related lysozyme [Bartonella grahamii as4aup]
 gi|240267551|gb|ACS51139.1| phage related lysozyme [Bartonella grahamii as4aup]
          Length = 220

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 81/139 (58%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           ++++K++EGLRL AYRD     WTIGYGHT +     V +GM I +++AE  L +D  K 
Sbjct: 9   LELIKQWEGLRLEAYRDTAC-VWTIGYGHTSNAGHPLVKKGMCINKEQAEKILCEDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E S  + S ++ +  A+  F +N+G   + KST  ++++  D+E    E +KW K
Sbjct: 67  FEKTVEESVTV-SLTDCQFAALVSFCYNVGTAAFRKSTLLKKLNQGDYEAVPVELQKWNK 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
            GGK L GL  RR AE  L
Sbjct: 126 VGGKPLAGLANRRAAEAGL 144


>gi|126604|sp|P07540|LYS_BPPZA RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName: Full=Late
           protein gp15; AltName: Full=Lysis protein; AltName:
           Full=Muramidase
 gi|216064|gb|AAA88492.1| morphogenesis protein B [Bacillus phage PZA]
          Length = 258

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 82/143 (57%), Gaps = 5/143 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           +  A I ++K FEGL+L AY+ +     +TIGYGH GSDV+    IT K+AED L  D  
Sbjct: 3   ISQAGINLIKSFEGLQLKAYKAVPTEKHYTIGYGHYGSDVSPRQVITAKQAEDMLRDDVQ 62

Query: 87  KSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
             ++ +   + ALK S ++N+  A+  F +N+G+G +  S+  + ++      AA E  +
Sbjct: 63  AFVDGV---NKALKVSVTQNQFDALVSFAYNVGLGAFRSSSLLEYLNEGRTALAAAEFPR 119

Query: 146 WTKAGGKVLPGLVKRRDAEVKLL 168
           W K+GGKV  GLV RR  E  L 
Sbjct: 120 WNKSGGKVYQGLVNRRAQEQALF 142


>gi|226328508|ref|ZP_03804026.1| hypothetical protein PROPEN_02402 [Proteus penneri ATCC 35198]
 gi|225203241|gb|EEG85595.1| hypothetical protein PROPEN_02402 [Proteus penneri ATCC 35198]
          Length = 156

 Score = 94.7 bits (234), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 82/138 (59%), Gaps = 9/138 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           I ++  FEG+R   YRD+ G   T+ YGHTG+D+ +G T T++E ++ L KD     + +
Sbjct: 20  ITVIGYFEGVRYEPYRDVAG-VLTVCYGHTGNDIIQGKTYTQQECDELLQKDFIRTQQQV 78

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           ++L++     K+ +     ++  F FN+G   + +ST  ++++A D   A EE K+W  A
Sbjct: 79  DVLVKVPVDDKTKA-----SLYSFAFNVGTTAFARSTLLKKLNAGDQYGACEEMKRWVYA 133

Query: 150 GGKVLPGLVKRRDAEVKL 167
           GGKV  GLV RRDAE  L
Sbjct: 134 GGKVWRGLVSRRDAESAL 151


>gi|317969530|ref|ZP_07970920.1| putative lysozyme (Lysis protein) (Muramidase) (Endolysin) (P13)
           [Synechococcus sp. CB0205]
          Length = 410

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 54/138 (39%), Positives = 83/138 (60%), Gaps = 5/138 (3%)

Query: 35  MLKEFEGLRLTAYRDI--GGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +LK +EG RL+AY D   GG  WTIGYGHTG++V  G+TI++++AE +L +DA+ +   +
Sbjct: 10  LLKTWEGCRLSAYPDPASGGAPWTIGYGHTGAEVVPGLTISQEQAEAWLKQDATDAAGAV 69

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA--AEECKKWTKAG 150
           +     +  T+  R  A+  F FN+G+G   +ST ++R+ A +      AEE  +W K  
Sbjct: 70  VRLLSGVGLTARQR-DALISFCFNVGVGALERSTLRKRLMAGESAAVVIAEELPRWDKGP 128

Query: 151 GKVLPGLVKRRDAEVKLL 168
              + GL +RR AEV  L
Sbjct: 129 YGPVEGLKRRRAAEVSHL 146


>gi|121602437|ref|YP_989330.1| lysozyme [Bartonella bacilliformis KC583]
 gi|120614614|gb|ABM45215.1| lysozyme [Bartonella bacilliformis KC583]
          Length = 220

 Score = 94.4 bits (233), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 79/139 (56%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K +EG+RL AY+D   G WTIGYGHT       V EGM ITE EAE  L +D  K 
Sbjct: 9   LALIKRWEGVRLCAYQD-AIGVWTIGYGHTAQAGQPIVQEGMKITESEAEIVLRQDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E +  + S S+ +  A+  F +N+G   +  ST  ++++  D+E    E +KW +
Sbjct: 67  FEKTVEQA-VIISLSDEQFAALVSFCYNVGGEAFCNSTLLKKLNKGDYEAVPSELQKWIR 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GL  RR AE  L
Sbjct: 126 AGGKRLQGLANRRAAEAGL 144


>gi|119490227|ref|ZP_01622740.1| probable phage-related lysozyme [Lyngbya sp. PCC 8106]
 gi|119454113|gb|EAW35266.1| probable phage-related lysozyme [Lyngbya sp. PCC 8106]
          Length = 284

 Score = 94.0 bits (232), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 57/137 (41%), Positives = 85/137 (62%), Gaps = 4/137 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           IK++K FEG+ L AY D   G  TIGYGHT  DV  GMTIT+ EAE+ L +D  +   + 
Sbjct: 74  IKLIKAFEGVELEAYLD-AVGVPTIGYGHT-KDVFLGMTITQAEAEELLRQDIEE-FEIA 130

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           +E +  ++  ++++  A+  F FNLG G+  KST  + ++ +  ++A+ E  +W KAGG+
Sbjct: 131 VEDAVEVE-INDHQFSALVSFCFNLGAGSLFKSTLLKFLNVRKLQEASLEFPRWNKAGGQ 189

Query: 153 VLPGLVKRRDAEVKLLL 169
            L GL +RR AE  L L
Sbjct: 190 PLLGLTRRRMAERALFL 206


>gi|290474301|ref|YP_003467178.1| putative lysozyme [Xenorhabdus bovienii SS-2004]
 gi|289173611|emb|CBJ80391.1| putative lysozyme (Lysis protein) (Muramidase) (Endolysin) (P13)
           [Xenorhabdus bovienii SS-2004]
          Length = 144

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 82/144 (56%), Gaps = 5/144 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           + N  ++ +K++EGL+L  Y D   GG  WTIGYGHT   V +G  ITE++AE FL  D 
Sbjct: 3   ISNKGLECIKQYEGLKLKVYPDPATGGIPWTIGYGHT-KGVKKGDVITEQQAEAFLQDDL 61

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
                 L +        ++ +  A+  F+FN G GN++ ST  ++++  D++ AA E  +
Sbjct: 62  QPVYTTLRQWVNV--PLNQGQFDALCSFIFNCGSGNFSGSTLLKKLNQGDYKGAAAEFSR 119

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLL 169
           W KA GK + GL  RR +E ++ L
Sbjct: 120 WNKAAGKAMRGLDNRRASERQMFL 143


>gi|317970243|ref|ZP_07971633.1| putative lysozyme (Lysis protein) (Muramidase) (Endolysin) (P13)
           [Synechococcus sp. CB0205]
          Length = 330

 Score = 93.6 bits (231), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 19/145 (13%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGA--WTIGYGHTGSDVTEGMTITEKEAEDFL---LKDA 85
           A + +LK  EG RL AY D G GA  WTIGYGHTG++V  G+ I++ +AE +L   L+D 
Sbjct: 6   AGLDLLKRLEGCRLEAYPDPGSGAEPWTIGYGHTGAEVRPGLVISQAQAERWLLDDLQDR 65

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA----E 141
            ++L  LL   P     ++ +  A+  F FN+G G   +ST ++R+ A   E A     E
Sbjct: 66  GRALKTLLAGVP----LNQGQFDALLSFCFNVGAGALGRSTLRRRLLAG--EPAGLVIRE 119

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVK 166
           E  +W       LPGL++RR AE++
Sbjct: 120 ELPRWIHP----LPGLIQRRAAEIR 140


>gi|315122328|ref|YP_004062817.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
 gi|313495730|gb|ADR52329.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
           CLso-ZC1]
          Length = 102

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 63/95 (66%), Gaps = 2/95 (2%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           + + LI ++K FEGLRL+AYR    G WTIGYGHT   + +G+ ITE++A   LL++ SK
Sbjct: 1   MTDLLIDLIKRFEGLRLSAYR-CSAGVWTIGYGHTRC-IAKGLLITEQQANTLLLQNISK 58

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNY 122
           ++N  L  S  L    ENRL A+  F+FN+G+G Y
Sbjct: 59  TINQALVISSILAEAGENRLSAICYFIFNIGVGRY 93


>gi|296101287|ref|YP_003611433.1| Phage-related lysozyme (muraminidase) [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295055746|gb|ADF60484.1| Phage-related lysozyme (muraminidase) [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 149

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 80/145 (55%), Gaps = 11/145 (7%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG--MTITEKEAEDFLLKDASK 87
           N  I ++K++EGLRLT Y+D   G  TIGYGH  + +  G   TIT + AE  L  D  +
Sbjct: 10  NGGIALIKQYEGLRLTTYKD-AVGIPTIGYGHVENPIPPGGTRTITAEAAEQLLRDDLQR 68

Query: 88  ---SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
               +N +L         ++N+  A+  F FNLG  N   ST  ++V++ D   AA+E  
Sbjct: 69  FEHEVNNMLTVE-----VTQNQFDALVSFAFNLGPANLKSSTLLRKVNSGDVNGAADEFL 123

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLL 169
           KW  AGG+VL GL  RR+AE  L L
Sbjct: 124 KWNHAGGQVLAGLTARRNAEKTLFL 148


>gi|282880040|ref|ZP_06288762.1| phage lysozyme [Prevotella timonensis CRIS 5C-B1]
 gi|281306154|gb|EFA98192.1| phage lysozyme [Prevotella timonensis CRIS 5C-B1]
          Length = 148

 Score = 93.2 bits (230), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 81/145 (55%), Gaps = 7/145 (4%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLK 83
           KI   + LI  LKEFEGLRL AY+      W TIGYGH+  DV  GM I E++AE+ L +
Sbjct: 4   KIRASDTLISKLKEFEGLRLVAYKPTKAERWWTIGYGHSAGDVRAGMRINEEKAEELLRR 63

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV--DAQDWEKAAE 141
           D    +   +   P ++  ++ +  A+  F +N+G+GN   ST  +++  DA   E    
Sbjct: 64  DLF-FVEKFINGIPKVR--TQGQFDALVSFAYNVGVGNLKSSTLLKKIMHDAPTVE-IQR 119

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVK 166
           E  KW  +GGK L GLVKRR  E +
Sbjct: 120 EFMKWVNSGGKQLAGLVKRRKWEAE 144


>gi|293392385|ref|ZP_06636708.1| phage lysozyme [Serratia odorifera DSM 4582]
 gi|291425124|gb|EFE98330.1| phage lysozyme [Serratia odorifera DSM 4582]
          Length = 144

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 53/137 (38%), Positives = 81/137 (59%), Gaps = 5/137 (3%)

Query: 35  MLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
            +K FE L L AY D   GG  WTIG+GHT   V  G  IT+++AE FL  D   ++  L
Sbjct: 10  FIKGFESLELRAYPDPGTGGKPWTIGWGHT-KGVNPGDQITQQQAEQFL--DEDLAVFEL 66

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
             ++   ++ ++N+  A+    FN+G  N+ +ST  ++ +A D   AA++  +W  + G+
Sbjct: 67  TVNTAIKRAMTQNQFDAMVSLAFNIGGRNFAQSTLVKKFNAGDAPGAADQFPRWKFSAGE 126

Query: 153 VLPGLVKRRDAEVKLLL 169
           V+PGLV+RR AE KL L
Sbjct: 127 VMPGLVRRRGAERKLFL 143


>gi|49473921|ref|YP_031963.1| Phage related lysozyme [Bartonella quintana str. Toulouse]
 gi|49239424|emb|CAF25766.1| Phage related lysozyme [Bartonella quintana str. Toulouse]
          Length = 220

 Score = 92.4 bits (228), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/139 (38%), Positives = 80/139 (57%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGL L AY +   G WTIGYGHT       V +GM IT+KEAE  L +D  K 
Sbjct: 9   LALIKQWEGLNLNAY-EAAIGVWTIGYGHTSITGAPAVHKGMQITQKEAEKILCQDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              ++E + A+    E +  A+  F +N+G   +  S   ++++  ++E    E +KWT+
Sbjct: 67  FERVVEQTVAVPLNDE-QFAALVSFCYNVGTEAFRSSKLLKKLNKGNYEAVPIELQKWTR 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK L GLV RR AE  L
Sbjct: 126 AGGKRLQGLVNRRAAEAGL 144


>gi|167552960|ref|ZP_02346710.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|168264547|ref|ZP_02686520.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|205322492|gb|EDZ10331.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA29]
 gi|205347032|gb|EDZ33663.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
          Length = 149

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D SK + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSKLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKVLNGLTRRREAERALFL 148


>gi|307825053|ref|ZP_07655274.1| Lysozyme [Methylobacter tundripaludum SV96]
 gi|307733801|gb|EFO04657.1| Lysozyme [Methylobacter tundripaludum SV96]
          Length = 239

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 88/151 (58%), Gaps = 12/151 (7%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           + N  + ++K+FEGLRL AYR    G WTIGYGHT   V    TI+ ++A   L +D ++
Sbjct: 5   INNDGLNLVKQFEGLRLEAYR-CPAGVWTIGYGHTHG-VKPEATISGEQANHLLAEDLAE 62

Query: 88  SLNLLLESSPALKST-SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
           S    ++    +  T ++N+  A++ FVFN GIGN   ST  +R++  D++    E  KW
Sbjct: 63  SG---VQVDQCMNVTLNDNQYAALSSFVFNAGIGNLTASTLLKRLNTGDYDCVPSELSKW 119

Query: 147 TKA-----GGKV-LPGLVKRRDAEVKLLLES 171
            KA     G KV L GLVKRR AE +L L++
Sbjct: 120 VKATDPKTGNKVSLAGLVKRRAAEGELWLKT 150


>gi|260596304|ref|YP_003208875.1| Lysozyme [Cronobacter turicensis z3032]
 gi|260215481|emb|CBA27607.1| Lysozyme [Cronobacter turicensis z3032]
          Length = 168

 Score = 92.0 bits (227), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 81/142 (57%), Gaps = 8/142 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKDASKSL 89
           ++++K FEGLRL  Y+D   G WTIGYGH      + T  +T+  +EAED L  D   + 
Sbjct: 31  VELIKSFEGLRLDKYQD-AVGKWTIGYGHLILPNENFTRALTL--QEAEDLLRADLGMTE 87

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
             + +        ++N+  A+  F FN+G+GN   ST  + ++   + +AA++  +W KA
Sbjct: 88  RGIRQMVKV--DLNQNQFDALVSFAFNVGLGNLQSSTLLRLLNQGSYREAADQLLRWNKA 145

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
           GG VL GL +RR+AE  L L +
Sbjct: 146 GGNVLAGLTRRREAERLLFLTA 167


>gi|197265754|ref|ZP_03165828.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
 gi|197244009|gb|EDY26629.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Saintpaul str. SARA23]
          Length = 149

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 61/150 (40%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLTAYPDSGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D SK + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSKLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKVLNGLTRRREAERALFL 148


>gi|319407665|emb|CBI81313.1| Lysozyme [Bartonella sp. 1-1C]
          Length = 220

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 80/139 (57%), Gaps = 7/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGLRL AY+D+ G  WTIGYGHT       V +GM IT+ EAE  L +D  K 
Sbjct: 9   LALIKQWEGLRLKAYQDVIG-VWTIGYGHTEQAGKPVVQDGMEITQVEAEAILRQDL-KQ 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E     +  ++ +  A+  F +N+G   +  ST  ++++  D+E    E +KW +
Sbjct: 67  FEQTVERE-VTQFLTDEQFAALVSFCYNIGTEAFCNSTLLKKLNKGDYEAVPAELQKWIR 125

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK + GLV RR AE  L
Sbjct: 126 AGGKRVQGLVHRRAAEAGL 144


>gi|319404700|emb|CBI78302.1| Lysozyme [Bartonella rochalimae ATCC BAA-1498]
          Length = 220

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 78/137 (56%), Gaps = 7/137 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKSLN 90
           ++K++EGLRL AY+D+ G  WTIGYGHT       V +GM IT+ EAE  L +D  K   
Sbjct: 11  LIKQWEGLRLKAYQDVIG-VWTIGYGHTEQAGKPVVQDGMEITQVEAETILRQDL-KQFE 68

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
             +E       T E +  A+  F +N+G   +  ST  ++++  D+E    E +KW +AG
Sbjct: 69  QTVEREVTQFLTDE-QFAALVSFCYNIGTEAFCNSTLLKKLNKGDYEAVPAELQKWIRAG 127

Query: 151 GKVLPGLVKRRDAEVKL 167
           GK + GLV RR AE  L
Sbjct: 128 GKRVQGLVHRRAAEAGL 144


>gi|310779818|ref|YP_003968150.1| Lysozyme [Ilyobacter polytropus DSM 2926]
 gi|309749141|gb|ADO83802.1| Lysozyme [Ilyobacter polytropus DSM 2926]
          Length = 148

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 85/140 (60%), Gaps = 9/140 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLN 90
           ++K  EGL+L AY     G WTIGYG T    GS V +G TIT++ A+  L    SK   
Sbjct: 10  LVKNSEGLKLKAYL-CPAGKWTIGYGSTLYEDGSKVKKGDTITKERADKLLNNLISK--- 65

Query: 91  LLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              E+   +K   +EN+  A+ DF++NLGIGN+ KST  +++++ + E A+EE ++W  +
Sbjct: 66  FEEEARRLIKIELNENQFSALVDFIYNLGIGNFRKSTLLKKINSGELEGASEEFERWIYS 125

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
            GK L GL KRR +E +L L
Sbjct: 126 NGKKLEGLRKRRKSEKELFL 145


>gi|213158713|ref|YP_002320011.1| lysozyme [Acinetobacter baumannii AB0057]
 gi|301346926|ref|ZP_07227667.1| lysozyme [Acinetobacter baumannii AB056]
 gi|301512143|ref|ZP_07237380.1| lysozyme [Acinetobacter baumannii AB058]
 gi|301597855|ref|ZP_07242863.1| lysozyme [Acinetobacter baumannii AB059]
 gi|213057873|gb|ACJ42775.1| lysozyme [Acinetobacter baumannii AB0057]
          Length = 184

 Score = 91.7 bits (226), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (57%), Gaps = 7/142 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           I ++  FEG R  AY D G G WTIG G T    G  V +G T T ++A+ +   D +K 
Sbjct: 45  IDLITSFEGTRFNAYDD-GVGVWTIGTGTTVYPNGVKVKKGDTCTAEQAKTYFKHDLAKF 103

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              + ES  A    ++N+  A+    +N+G G +N ST  ++++  D++ AA++   W K
Sbjct: 104 EKTVNESVTA--PLTQNQFDALVSLTYNIGSGAFNNSTLLKKLNKGDYQGAADQFLVWNK 161

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           AGGKV+ GLV+RR+AE  L L+
Sbjct: 162 AGGKVMKGLVRRREAERALFLK 183


>gi|121602073|ref|YP_988573.1| phage lysozyme [Bartonella bacilliformis KC583]
 gi|120614250|gb|ABM44851.1| phage lysozyme [Bartonella bacilliformis KC583]
          Length = 220

 Score = 91.7 bits (226), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 81/137 (59%), Gaps = 7/137 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLN 90
           +L+++EGLRL AY+D   G WTIG+GHT       V +GM IT+ +AE  L +D  +   
Sbjct: 11  LLQQWEGLRLEAYQD-AVGIWTIGHGHTTGAGAPFVRKGMKITKAQAEAILRRDLVQFEK 69

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            + +     +  ++ +  A+  F +N+G+  + +ST  ++++  D+E    E +KWT+AG
Sbjct: 70  AVEQG--VFQPLTDEQFAALVSFCYNVGVEAFCQSTLLKKLNKGDYEAVPAELQKWTRAG 127

Query: 151 GKVLPGLVKRRDAEVKL 167
           GK L GLV RR AE  L
Sbjct: 128 GKRLKGLVHRRAAEAGL 144


>gi|323517259|gb|ADX91640.1| lysozyme [Acinetobacter baumannii TCDC-AB0715]
 gi|323517771|gb|ADX92152.1| lysozyme [Acinetobacter baumannii TCDC-AB0715]
          Length = 187

 Score = 91.3 bits (225), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 82/142 (57%), Gaps = 7/142 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++  FEG R  AY D G G WTIG G T    G  V +G T T ++A+ +   D +K 
Sbjct: 48  VDLISGFEGTRFKAYDD-GVGVWTIGTGTTVYPNGVKVKQGDTCTPEQAKAYFKHDLAKF 106

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              + ES   +   S+N+  A+    +N+G G +N ST  ++++  D++ AA++   W K
Sbjct: 107 EKTVNES--VIVPLSQNQFDALVSLTYNIGSGAFNNSTLLKKLNKGDYQGAADQFLVWNK 164

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           AGGKVL GLV+RR+AE  L L+
Sbjct: 165 AGGKVLKGLVRRREAERALFLK 186


>gi|224582840|ref|YP_002636638.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|224584466|ref|YP_002638264.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|224467367|gb|ACN45197.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|224468993|gb|ACN46823.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|323129295|gb|ADX16725.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|326622984|gb|EGE29329.1| lysozyme [Salmonella enterica subsp. enterica serovar Dublin str.
           3246]
 gi|326627499|gb|EGE33842.1| lysozyme [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
          Length = 154

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 13  ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 72

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 73  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 123

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 124 ADEFLRWNKAGGKVLNGLTRRREAERALFL 153


>gi|295314796|gb|ADF97548.1| PlyM23 [uncultured phage]
          Length = 149

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 85/150 (56%), Gaps = 12/150 (8%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDI--GGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL 81
           V +A I+++K FEG R  AY D   GG  WT+GYG T    G  V +G  +T  +AE +L
Sbjct: 3   VSDAGIELIKSFEGFRANAYPDPKSGGDPWTVGYGTTKFPSGRPVKQGDKVTPGQAELYL 62

Query: 82  LKDASKSLNLL--LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
            +D  K  N +  L ++P LK    + LV+   FV+NLG  N+  ST  ++++A+D+  A
Sbjct: 63  REDVKKFANSVDALVTAP-LKQCQYDALVS---FVYNLGATNFRTSTLLKKLNAKDYNGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W   G  V  GL +RR AE  + L
Sbjct: 119 ADEFLRWVSPGSSVEAGLRRRRTAERAMFL 148


>gi|16764388|ref|NP_460003.1| lysozyme [Phage Gifsy-2]
 gi|62181184|ref|YP_217601.1| Gifsy-2 prophage lysozyme [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|169257296|ref|YP_001700672.1| bacteriophage lysis protein; endolysin; lysozyme [Phage Gifsy-2]
 gi|205352446|ref|YP_002226247.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Gallinarum str. 287/91]
 gi|207856619|ref|YP_002243270.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Enteritidis str. P125109]
 gi|16419542|gb|AAL19962.1| Gifsy-2 prophage lysozyme [Phage Gifsy-2]
 gi|62128817|gb|AAX66520.1| Gifsy-2 prophage lysozyme [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|205272227|emb|CAR37089.1| putative phage lysozyme [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|206708422|emb|CAR32728.1| putative phage lysozyme [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|267992777|gb|ACY87662.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
 gi|301157573|emb|CBW17063.1| putative bacteriophage lysozyme [Salmonella enterica subsp.
           enterica serovar Typhimurium str. SL1344]
 gi|322715673|gb|EFZ07244.1| lysozyme [Salmonella enterica subsp. enterica serovar Choleraesuis
           str. A50]
 gi|332987920|gb|AEF06903.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. UK-1]
          Length = 150

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 9   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 68

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 69  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 119

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 120 ADEFLRWNKAGGKVLNGLTRRREAERALFL 149


>gi|253583121|ref|ZP_04860329.1| lysozyme [Fusobacterium varium ATCC 27725]
 gi|251835013|gb|EES63566.1| lysozyme [Fusobacterium varium ATCC 27725]
          Length = 151

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 81/138 (58%), Gaps = 10/138 (7%)

Query: 33  IKMLKEFEGLR----LTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           ++M+K+FE +R    L AY     G  TIGYGHTG DV +GM IT  +AE  L+KD  + 
Sbjct: 12  LEMIKQFECVRGIPKLEAYV-CPAGVLTIGYGHTGKDVQKGMKITPDKAEQLLIKDVQRF 70

Query: 89  L-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ-DWEKAAEECKKW 146
           + N+  + +  LK    + LV++A   FN+G  N+N ST  ++++A    E+   E  +W
Sbjct: 71  VDNVNKQVNVELKQNQFDSLVSLA---FNIGNANFNSSTLLKKINANAPIEEITYEFSRW 127

Query: 147 TKAGGKVLPGLVKRRDAE 164
            K GGKVL GLV RR  E
Sbjct: 128 NKGGGKVLKGLVARRKKE 145


>gi|167993395|ref|ZP_02574489.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|194444024|ref|YP_002040229.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|198245056|ref|YP_002215238.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|194402687|gb|ACF62909.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|197939572|gb|ACH76905.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|205328527|gb|EDZ15291.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|321223640|gb|EFX48703.1| Gifsy-2 prophage lysozyme [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 149

 Score = 91.3 bits (225), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 67

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKVLNGLTRRREAERALFL 148


>gi|303258477|ref|ZP_07344479.1| phage lysozyme [Burkholderiales bacterium 1_1_47]
 gi|302858760|gb|EFL81849.1| phage lysozyme [Burkholderiales bacterium 1_1_47]
          Length = 143

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (57%), Gaps = 10/142 (7%)

Query: 34  KMLKEFE-----GLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           + + EFE     G  L +Y+    G WTIG+GHT  DV  G  IT  EA D L KD  ++
Sbjct: 4   QFISEFEQGPKGGPALESYK-CPAGVWTIGFGHT-KDVHAGEHITRNEAYDLLTKDLVQT 61

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGN-YNKSTFKQRVDAQDWEKAAEECKKWT 147
              L  ++      +EN+ +A+  ++FNLG+     +ST  ++++A D+E AAEE  KW 
Sbjct: 62  QEEL--AAIVKVPVTENQFIALMSWLFNLGLTPAVRRSTLLRKLNAGDYEGAAEEFPKWR 119

Query: 148 KAGGKVLPGLVKRRDAEVKLLL 169
           K+ G+VLPGLV RR  E K+ L
Sbjct: 120 KSAGQVLPGLVNRRAEEKKIFL 141


>gi|92113518|ref|YP_573446.1| glycoside hydrolase family protein [Chromohalobacter salexigens DSM
           3043]
 gi|91796608|gb|ABE58747.1| glycoside hydrolase, family 24 [Chromohalobacter salexigens DSM
           3043]
          Length = 157

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 80/140 (57%), Gaps = 14/140 (10%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL-- 92
           ++ +FEG R  AYRD  G   TI YGHTG DV  G T+++ E ++ L +D   + + +  
Sbjct: 22  VVSQFEGYRSEAYRDPVG-IPTICYGHTG-DVDMGQTLSQSECKELLAEDLGTAFDAVDQ 79

Query: 93  ---LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              +E  PA       R  A+A FV+N+G G + +ST  +R++A     A +E  +W  A
Sbjct: 80  RVEVELPPA-------RRAALASFVYNVGEGKFARSTLLKRLNAGKVRAACDELNRWVYA 132

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
           GG+ L GLVKRR AE KL L
Sbjct: 133 GGRKLAGLVKRRAAERKLCL 152


>gi|240145531|ref|ZP_04744132.1| phage lysozyme [Roseburia intestinalis L1-82]
 gi|257202348|gb|EEV00633.1| phage lysozyme [Roseburia intestinalis L1-82]
          Length = 226

 Score = 90.5 bits (223), Expect = 7e-17,   Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 78/142 (54%), Gaps = 9/142 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +  A + ++K+FE  RL AY+    G WTIGYGHT   V +GM IT+K+AE +LL+D +K
Sbjct: 6   IGQAGLALIKQFESCRLIAYQ-CSAGVWTIGYGHT-VGVYKGMKITQKKAEAYLLQDVAK 63

Query: 88  SLNLLLESS--PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
               +   S  P     ++N+  A+  F FNLG GN      K+    +   +     ++
Sbjct: 64  FEKYINNPSYVPFTAQLNQNQFDALVSFAFNLGQGN-----VKKLCTGRVMNQIPSAMQR 118

Query: 146 WTKAGGKVLPGLVKRRDAEVKL 167
           + KA GK LPGL +RR AE  L
Sbjct: 119 YCKAAGKTLPGLQRRRKAEAAL 140


>gi|318040100|ref|ZP_07972056.1| putative lysozyme (Lysis protein) (Muramidase) (Endolysin) (P13)
           [Synechococcus sp. CB0101]
          Length = 410

 Score = 90.1 bits (222), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 81/137 (59%), Gaps = 9/137 (6%)

Query: 35  MLKEFEGLRLTAYRDI--GGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +LK +EG RL+AY D   GG  WTIG+GHTG++V  G+TIT+++AE +L KD +++   +
Sbjct: 10  LLKTWEGCRLSAYPDPASGGAPWTIGFGHTGAEVVPGLTITQEQAEAWLNKDVAEAAGAV 69

Query: 93  --LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA--AEECKKWTK 148
             L S   L +     L++   F FN+G G   +ST ++R+ A +      A+E  +W K
Sbjct: 70  DRLLSGVTLTAHQRESLIS---FCFNVGAGALERSTLRKRLLAGESPAVVIAQELPRWNK 126

Query: 149 AGGKVLPGLVKRRDAEV 165
                L GL +RR AEV
Sbjct: 127 GPKGPLEGLKRRRAAEV 143


>gi|261246245|emb|CBG24050.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
          Length = 150

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 80/150 (53%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 9   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 68

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  +++++ D+  A
Sbjct: 69  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNSGDYAGA 119

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 120 ADEFLRWNKAGGKVLNGLTRRREAERALFL 149


>gi|227356926|ref|ZP_03841302.1| lysozyme [Proteus mirabilis ATCC 29906]
 gi|227162903|gb|EEI47855.1| lysozyme [Proteus mirabilis ATCC 29906]
          Length = 144

 Score = 90.1 bits (222), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 76/134 (56%), Gaps = 5/134 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++  FEG+R   YRD+ G   T+ YGHTG D+  G T T++E +  L  D  K+     +
Sbjct: 10  VIAHFEGVRYEPYRDVAG-ILTVCYGHTGKDIIHGKTYTQQECDALLQNDFIKTQQ---Q 65

Query: 95  SSPALKSTSENRL-VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
               +K   ++ +  A+  F FN+G+  + +ST  ++++A D   A EE K+W  AGGKV
Sbjct: 66  VDALIKVPLDDYIKAALYSFAFNVGMTAFARSTLLKKLNAGDRAGACEEIKRWVYAGGKV 125

Query: 154 LPGLVKRRDAEVKL 167
             GLV RR+AE  L
Sbjct: 126 WRGLVSRREAESAL 139


>gi|212710140|ref|ZP_03318268.1| hypothetical protein PROVALCAL_01194 [Providencia alcalifaciens DSM
           30120]
 gi|212687347|gb|EEB46875.1| hypothetical protein PROVALCAL_01194 [Providencia alcalifaciens DSM
           30120]
          Length = 190

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 79/140 (56%), Gaps = 9/140 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           + M+  FEG     YRD+GG   T+ YGHTGSD+    T T+ E ++ L KD    +K++
Sbjct: 22  VAMVINFEGYEPKPYRDVGG-VLTVCYGHTGSDIIPTKTYTKVECDELLEKDLAIVAKAV 80

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N L++ +       +    A+  F +N+GIG +++ST  ++++  D   A  E K+W  A
Sbjct: 81  NPLIKIN-----IPDYTRAALYSFTYNVGIGAFSRSTLLKKLNTGDQAGACHELKRWIYA 135

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
           GGK   GL+ RR+ E K+ L
Sbjct: 136 GGKAWKGLMTRREVEKKVCL 155


>gi|9633560|ref|NP_050974.1| P13 [Acyrthosiphon pisum bacteriophage APSE-1]
 gi|9910772|sp|Q9T1T5|LYS_BPAPS RecName: Full=Probable lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase; AltName:
           Full=P13
 gi|6118008|gb|AAF03956.1|AF157835_13 P13 [Endosymbiont phage APSE-1]
          Length = 146

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 56/141 (39%), Positives = 86/141 (60%), Gaps = 9/141 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++K +EGLRL AY+    G WT+GYGHT  ++  G  IT+++AE FL +D ++   LL  
Sbjct: 10  LIKRYEGLRLKAYQ-CRAGRWTLGYGHT-HNLNIGDVITQEQAEAFLREDIAQVTALL-- 65

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--GGK 152
           ++      ++N+  A+   VFN+G+  +  ST  ++++  D+  A+ E  KW+KA   GK
Sbjct: 66  NTQIKVPLTQNQYDAICSLVFNIGMTAFTTSTLLKKLNVGDYSGASAEFMKWSKAKVNGK 125

Query: 153 --VLPGLVKRRDAEVKLLLES 171
              LPGL+KRR AE K L ES
Sbjct: 126 RTPLPGLIKRRQAE-KALFES 145


>gi|293446702|ref|ZP_06663124.1| lysozyme lambdoid prophage DLP12 [Escherichia coli B088]
 gi|291323532|gb|EFE62960.1| lysozyme lambdoid prophage DLP12 [Escherichia coli B088]
          Length = 167

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 50/132 (37%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 36  LEGVRHNPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 92  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RRD E ++ L
Sbjct: 152 MTRRDIEREVCL 163


>gi|331027958|ref|YP_004421508.1| lysozyme [Synechococcus phage S-CBS2]
 gi|294805571|gb|ADF42410.1| lysozyme [Synechococcus phage S-CBS2]
          Length = 383

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 82/148 (55%), Gaps = 13/148 (8%)

Query: 31  ALIKMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDA 85
           A ++++K FEGLRL AY D   GG  WTIGYGHTG  V  G  IT++ AE  L   L   
Sbjct: 6   AGLELIKSFEGLRLEAYPDPGTGGEPWTIGYGHTGG-VKPGTKITKENAEQLLKLGLDRF 64

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
            ++++ L+         ++N   A+  F FN+G G    ST ++R++  + +     EE 
Sbjct: 65  ERAVDKLITVP-----LTQNEFDALVSFTFNVGEGALEDSTLRKRLNKGEPKATVLKEEL 119

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLLES 171
            +W K G  V+ GLV+RR AEVKL  E 
Sbjct: 120 PRWNKGGSGVMEGLVRRRAAEVKLATEQ 147


>gi|304413945|ref|ZP_07395362.1| putative phage lysozyme [Candidatus Regiella insecticola LSR1]
 gi|304283665|gb|EFL92060.1| putative phage lysozyme [Candidatus Regiella insecticola LSR1]
          Length = 214

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           +M+  FEG+R   Y D GGG  ++ YGHTG+D+    T T+ E   +L +D    L +  
Sbjct: 69  RMINHFEGVRYKPYFD-GGGVLSVCYGHTGNDIALNKTYTQAECNKWLDEDL---LKVKK 124

Query: 94  ESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              P +K   S     A+  FV+N+GIGN+  STF ++++A D + A EE K+W  A GK
Sbjct: 125 HVDPLIKVKISALTQAAIYSFVYNVGIGNFRHSTFLEKLNAGDKKGACEEMKRWVYANGK 184

Query: 153 VLPGLVKRRDAE 164
              GL+ RR+ E
Sbjct: 185 RWKGLIFRREVE 196


>gi|187923183|ref|YP_001894825.1| glycoside hydrolase family 24 [Burkholderia phytofirmans PsJN]
 gi|187714377|gb|ACD15601.1| glycoside hydrolase family 24 [Burkholderia phytofirmans PsJN]
          Length = 175

 Score = 89.7 bits (221), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/116 (43%), Positives = 70/116 (60%), Gaps = 4/116 (3%)

Query: 50  IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL-LESSPALKSTSENRLV 108
           + G  WT G+GHTG DV  GMTIT   A D+L  D   +  ++  +   AL     + LV
Sbjct: 48  LNGAPWTGGWGHTGPDVRPGMTITRDMAVDWLRADVRGAEAVVKRDVKVALNQEEYDALV 107

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
              D VFN+G GN++ ST  ++++A D + A  E  +W +AGGKVL GLVKRR+AE
Sbjct: 108 ---DLVFNIGSGNFDTSTLLRKLNASDTDGAIAEFARWNQAGGKVLVGLVKRREAE 160


>gi|294674551|ref|YP_003575167.1| lysozyme [Prevotella ruminicola 23]
 gi|294473721|gb|ADE83110.1| lysozyme [Prevotella ruminicola 23]
          Length = 154

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 58/143 (40%), Positives = 83/143 (58%), Gaps = 8/143 (5%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           + + + L++ L E EG RL+AYRD  GG  TIGYGHT   V  G  I+ ++A D+LL+DA
Sbjct: 1   MQITDTLLQKLMEMEGCRLSAYRD-EGGVPTIGYGHT-RGVRMGDRISPQQARDWLLQDA 58

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
           ++ +  +     A    +E +L A+  F FN+GIG   +ST  + +  Q   KAA   + 
Sbjct: 59  TEVMRQVRRLHVA---RTEAQLEALTSFAFNVGIGRLKQSTLLKTIR-QGGSKAAIQRQF 114

Query: 144 KKWTKAGGKVLPGLVKRRDAEVK 166
           K+W  AGG  LPGLV RR  E +
Sbjct: 115 KRWVYAGGSKLPGLVARRQWEAE 137


>gi|300918431|ref|ZP_07135029.1| phage lysozyme [Escherichia coli MS 115-1]
 gi|300414406|gb|EFJ97716.1| phage lysozyme [Escherichia coli MS 115-1]
          Length = 149

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/144 (38%), Positives = 80/144 (55%), Gaps = 8/144 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGG--AWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDAS 86
           I ++K+FEG RLTAY D G G   WTIGYG T    G  V  GMTI ++ A+  L     
Sbjct: 8   IALIKKFEGCRLTAYPDPGTGDAPWTIGYGWTHPVDGKPVKRGMTIDQQTADRLLKTGLV 67

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
              N +L+        ++ +  A+  F +N+G    + ST  ++++A D + AA+E  +W
Sbjct: 68  GYENDVLKVVRV--KLTQGQFDALVSFAYNVGSRALSTSTLLKKLNAGDIKGAADEFLRW 125

Query: 147 TKAGGKVLPGLVKRRDAEVKLLLE 170
            K+GGKV+PGL  RR AE  L L 
Sbjct: 126 NKSGGKVMPGLTNRRKAERALFLS 149


>gi|168822028|ref|ZP_02834028.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|205341517|gb|EDZ28281.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
          Length = 149

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGK L GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKALNGLTRRREAERALFL 148


>gi|322714024|gb|EFZ05595.1| lysozyme [Salmonella enterica subsp. enterica serovar Choleraesuis
           str. A50]
          Length = 154

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 13  ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 72

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 73  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 123

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGK L GL +RR+AE  L L
Sbjct: 124 ADEFLRWNKAGGKALNGLTRRREAERALFL 153


>gi|62179556|ref|YP_215973.1| Gifsy-2 prophage lysozyme [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|62127189|gb|AAX64892.1| Gifsy-2 prophage lysozyme [Phage Gifsy-2]
          Length = 149

 Score = 89.4 bits (220), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 67

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGK L GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKALNGLTRRREAERALFL 148


>gi|256023836|ref|ZP_05437701.1| putative lysozyme; DLP12 prophage [Escherichia sp. 4_1_40B]
 gi|300939598|ref|ZP_07154254.1| phage lysozyme [Escherichia coli MS 21-1]
 gi|312971296|ref|ZP_07785474.1| lysozyme [Escherichia coli 1827-70]
 gi|300455524|gb|EFK19017.1| phage lysozyme [Escherichia coli MS 21-1]
 gi|310336498|gb|EFQ01684.1| lysozyme [Escherichia coli 1827-70]
          Length = 165

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVRHNPYKDIVG-VWTVCYGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|226326224|ref|ZP_03801742.1| hypothetical protein PROPEN_00066 [Proteus penneri ATCC 35198]
 gi|225205411|gb|EEG87765.1| hypothetical protein PROPEN_00066 [Proteus penneri ATCC 35198]
          Length = 156

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 74/135 (54%), Gaps = 7/135 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL-- 92
           ++  FEG+R   YRD+ G   T+ YGHTG D+ +G   T++E +  L  D  K+   +  
Sbjct: 22  VIAHFEGVRYEPYRDVAG-VLTVCYGHTGKDIIQGKRYTQQECDALLQNDFIKTRRQVDA 80

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           L   P    T      A+  F FN+G   +++ST  +R++A D   A EE K+W  AGGK
Sbjct: 81  LIKVPLDDYTK----AALYSFAFNVGATAFSRSTLLKRLNAGDRAGACEEMKRWVYAGGK 136

Query: 153 VLPGLVKRRDAEVKL 167
           V  GLV RR+AE  L
Sbjct: 137 VWRGLVSRREAESAL 151


>gi|332989541|gb|AEF08524.1| morphogenesis-like protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 150

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL----- 81
           I ++KEFEG  LTAY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 9   ITLIKEFEGCSLTAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLNTGLV 68

Query: 82  --LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 69  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 119

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAG KVL GL +RR+AE  L L
Sbjct: 120 ADEFLRWNKAGSKVLNGLTRRREAERALFL 149


>gi|262372337|ref|ZP_06065616.1| lysozyme [Acinetobacter junii SH205]
 gi|262312362|gb|EEY93447.1| lysozyme [Acinetobacter junii SH205]
          Length = 188

 Score = 89.0 bits (219), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 56/152 (36%), Positives = 85/152 (55%), Gaps = 13/152 (8%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL 81
           + + +A ++ + EFE LRL +Y D G G WTIGYG T    G  V  G T TE EA+ + 
Sbjct: 43  MQISHAGMRFIMEFEDLRLKSYDD-GAGTWTIGYGTTIYPNGVIVKRGETCTESEAKAYF 101

Query: 82  LKDA---SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
             D     +++N L+  S  LK   +N+  A+    +N+G   +  ST  + ++  ++  
Sbjct: 102 QHDLLRFQRTVNQLVNVS--LK---QNQFDALVSLTYNIGENAFRTSTLLKYLNMGEYSA 156

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           AAE+   W KAGG V+ GLV+RR AE +L L+
Sbjct: 157 AAEQFGVWNKAGGNVMRGLVRRRHAEKELFLK 188


>gi|319409243|emb|CBI82887.1| Lysozyme [Bartonella schoenbuchensis R1]
          Length = 220

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 83/144 (57%), Gaps = 7/144 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTE-GMTITEKEAEDFLLK 83
           + N  ++++K++EGLRL AYRD     W IGYGHT   G+ V + GM IT+ EAE  L K
Sbjct: 4   ISNEGLELIKKWEGLRLEAYRD-AMDVWAIGYGHTTKAGAPVVQKGMKITKDEAEAILRK 62

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           D ++     +E + +   T E +  A+  F +N+G   +  S   ++++  D+E    E 
Sbjct: 63  DLAQ-FEQTVEQAVSQPLTDE-QFAALVSFCYNVGTSAFCNSALLRKLNKGDYEAVPAEL 120

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
           +KWTK+ G+ L GLV RR AE  L
Sbjct: 121 QKWTKSEGQRLQGLVHRRAAEAGL 144


>gi|71065592|ref|YP_264319.1| putative bacteriophage lysozyme [Psychrobacter arcticus 273-4]
 gi|71038577|gb|AAZ18885.1| putative bacteriophage lysozyme [Psychrobacter arcticus 273-4]
          Length = 205

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 83/143 (58%), Gaps = 6/143 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           I +LK +EGL+L AY+D G   WTIGYGHT    G  V +G+ IT ++AE  L  D ++ 
Sbjct: 62  IDLLKFYEGLKLKAYQDTGK-VWTIGYGHTSASGGMKVYQGLVITREQAEQLLKDDLARM 120

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              +++    +  T + +  A+  F++NLG G  +KST  + ++A+D++ A+ +  +W  
Sbjct: 121 TYPVVDDLVKVPLT-QGQFDAMCSFIYNLGEGQVSKSTLLRLLNAKDYKGASTQFGRWVF 179

Query: 149 AGGKVLPGLVKRRDAEVKLLLES 171
             G  L GL+ RR AE KL   S
Sbjct: 180 DNGVELDGLIARRAAERKLFASS 202


>gi|312912017|dbj|BAJ35991.1| morphogenesis-like protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
          Length = 149

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKVLNGLTRRREAERALFL 148


>gi|253689024|ref|YP_003018214.1| Lysozyme [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251755602|gb|ACT13678.1| Lysozyme [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 158

 Score = 88.6 bits (218), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 59/156 (37%), Positives = 82/156 (52%), Gaps = 13/156 (8%)

Query: 22  KHNKIPVPNALIKMLKE-----FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE 76
           K   IPV  A    +       FEG   TAYRDI G  WTI YGHTG DV  G   T+ E
Sbjct: 7   KQRIIPVVTACALAIATVFVGFFEGKENTAYRDIAG-VWTICYGHTG-DVKAGDYKTDAE 64

Query: 77  AEDFLLKDASKSLNLL--LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ 134
            +  L +D   + + +  L + P     SE +  A+A F++N+G G + +ST  ++++  
Sbjct: 65  CDALLQQDLKPAFHAIDRLVTVP----LSELQRAALASFIYNVGTGAFERSTLLKKLNRG 120

Query: 135 DWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           D   A  E ++W KA G+V  GL  RR+AE  L LE
Sbjct: 121 DLIGACNELRRWNKAAGQVWQGLTNRREAERMLCLE 156


>gi|74312894|ref|YP_311313.1| putative lysozyme [Shigella sonnei Ss046]
 gi|73856371|gb|AAZ89078.1| putative lysozyme [Shigella sonnei Ss046]
 gi|323168437|gb|EFZ54117.1| lysozyme [Shigella sonnei 53G]
          Length = 165

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVRHNPYKDIVG-VWTVCYGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGG    GL
Sbjct: 90  IKVDIPETTRCALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGNQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|301159163|emb|CBW18677.1| bacteriophage lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
          Length = 150

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 9   ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 68

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 69  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 119

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 120 ADEFLRWNKAGGKVLNGLTRRREAERALFL 149


>gi|323130947|gb|ADX18377.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
          Length = 154

 Score = 88.6 bits (218), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 79/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 13  ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 72

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 73  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 123

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGKVL GL +RR+AE  L L
Sbjct: 124 ADEFLRWNKAGGKVLNGLTRRREAERALFL 153


>gi|325497831|gb|EGC95690.1| lysozyme; DLP12 prophage [Escherichia fergusonii ECD227]
          Length = 165

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVRHNPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTHGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|218550016|ref|YP_002383807.1| lysozyme; DLP12 prophage [Escherichia fergusonii ATCC 35469]
 gi|218357557|emb|CAQ90196.1| putative lysozyme; DLP12 prophage [Escherichia fergusonii ATCC
           35469]
          Length = 165

 Score = 88.2 bits (217), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVRHNPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|309782455|ref|ZP_07677179.1| phage lysozyme [Ralstonia sp. 5_7_47FAA]
 gi|308918792|gb|EFP64465.1| phage lysozyme [Ralstonia sp. 5_7_47FAA]
          Length = 150

 Score = 87.8 bits (216), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 84/152 (55%), Gaps = 10/152 (6%)

Query: 22  KHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMT----ITEKEA 77
           +HN        + ++KE EGLRL+ Y D  G   TIGYGH    +  G T    I++++A
Sbjct: 4   EHNPRATGERGLALIKESEGLRLSTYLDAVGKP-TIGYGHL---IRPGETFNGPISQQQA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E  L KD + +   + ++     S ++ +  A+A FVFNLG G    ST  ++++A D+ 
Sbjct: 60  EALLRKDLADTEQGIAKAVRV--SITQGQFDALASFVFNLGAGRLRSSTLLRKLNAGDYA 117

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            AA +   W KAGGK L GL KRR AE KL L
Sbjct: 118 GAANQFLLWDKAGGKPLKGLTKRRQAERKLFL 149


>gi|241663330|ref|YP_002981690.1| lysozyme [Ralstonia pickettii 12D]
 gi|240865357|gb|ACS63018.1| Lysozyme [Ralstonia pickettii 12D]
          Length = 150

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 84/152 (55%), Gaps = 10/152 (6%)

Query: 22  KHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMT----ITEKEA 77
           +HN        + ++KE EGLRL+ Y D  G   TIGYGH    +  G T    I++++A
Sbjct: 4   EHNPRTTGERGLALIKESEGLRLSTYLDAVGKP-TIGYGHL---IRPGETFNGPISQQQA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E  L KD + +   + ++     S ++ +  A+A FVFNLG G    ST  ++++A D+ 
Sbjct: 60  EALLRKDLADTEQGIAKAVRV--SITQGQFDALASFVFNLGAGRLRSSTLLRKLNAGDYA 117

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            AA +   W KAGGK L GL KRR AE KL L
Sbjct: 118 GAANQFLLWDKAGGKPLKGLTKRRQAERKLFL 149


>gi|183598713|ref|ZP_02960206.1| hypothetical protein PROSTU_02130 [Providencia stuartii ATCC 25827]
 gi|188020906|gb|EDU58946.1| hypothetical protein PROSTU_02130 [Providencia stuartii ATCC 25827]
          Length = 156

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 51/136 (37%), Positives = 76/136 (55%), Gaps = 5/136 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++  FEG+R   Y D+GG   T+ YGHTG D+      +++E  + L  D  ++    
Sbjct: 20  LTVIAYFEGVRYEPYEDVGG-VLTVCYGHTGKDIVPNKVYSKEECNELLELDFMRTK--- 75

Query: 93  LESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           L+    +K   SE+   A+  F FN+G G + KST  ++++A D   A EE KKW  AGG
Sbjct: 76  LQVDRLVKVPVSEHTKAALYSFAFNVGTGAFAKSTMLKKLNAGDQYGACEELKKWVYAGG 135

Query: 152 KVLPGLVKRRDAEVKL 167
           KV  GLV RR+AE  +
Sbjct: 136 KVWRGLVNRREAEAAI 151


>gi|260554412|ref|ZP_05826633.1| phage lysozyme [Acinetobacter baumannii ATCC 19606]
 gi|260410954|gb|EEX04251.1| phage lysozyme [Acinetobacter baumannii ATCC 19606]
          Length = 184

 Score = 87.8 bits (216), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 81/142 (57%), Gaps = 7/142 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++  FEG R TAY D G G WTIG G T    G  V +G T T ++A+ +   D +K 
Sbjct: 45  VDLISGFEGTRFTAYDD-GVGVWTIGTGTTVYPNGVKVKKGDTCTAEQAKTYFKHDLAKF 103

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              + ES       ++N+  A+    +N+G G +  ST  + ++  D++ AA++   W K
Sbjct: 104 EKTVNESVTV--PINQNQFDALVSLTYNIGSGAFKGSTLLKLLNKGDYQGAADQFLVWNK 161

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           AGGKV+ GLV+RR+AE+ L L+
Sbjct: 162 AGGKVMKGLVRRREAELALFLK 183


>gi|332283208|ref|YP_004418893.1| glycoside hydrolase [Pusillimonas sp. T7-7]
 gi|330430936|gb|AEC22269.1| glycoside hydrolase [Pusillimonas sp. T7-7]
          Length = 190

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 72/116 (62%), Gaps = 1/116 (0%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           K+LK FE  +L AY D  G AWT+G+GHTG DV EG+ IT+ +A+  L +  S+     +
Sbjct: 41  KVLKYFESCKLKAYWDADGKAWTVGWGHTGPDVHEGLVITQAQADQLLRQRLSREFVPGV 100

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
            S+   +S +++ L A+ D  +N+G+G +  ST  ++ +A D + AA+E  +W ++
Sbjct: 101 LSA-ITRSLAQHELDAMVDLAYNIGVGAFQSSTLVRKFNAGDTDGAADEFLRWNRS 155


>gi|211731733|gb|ACJ10082.1| lysozyme [Bacteriophage APSE-5]
          Length = 146

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 85/141 (60%), Gaps = 9/141 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++K +EGLRL AY+    G WT+GYGHT  ++  G  IT+++AE  L +D ++   LL  
Sbjct: 10  LIKRYEGLRLKAYQ-CRAGRWTLGYGHT-HNLNIGDVITQEQAEALLREDIAQVTALL-- 65

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--GGK 152
           ++      ++N+  A+   VFN+G+  +  ST  ++++  D+  A+ E  KW+KA   GK
Sbjct: 66  NTQIKVPLTQNQYDAICSLVFNIGMTAFTTSTLLKKLNVGDYSGASAEFMKWSKATVNGK 125

Query: 153 --VLPGLVKRRDAEVKLLLES 171
              LPGL+KRR AE K L ES
Sbjct: 126 RTPLPGLIKRRQAE-KALFES 145


>gi|332875204|ref|ZP_08443037.1| phage lysozyme [Acinetobacter baumannii 6014059]
 gi|332736648|gb|EGJ67642.1| phage lysozyme [Acinetobacter baumannii 6014059]
          Length = 184

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 81/142 (57%), Gaps = 7/142 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++  FEG R  AY D G G WTIG G T    G  V +G T T ++A+ +   D +K 
Sbjct: 45  VDLISGFEGTRFKAYDD-GVGVWTIGTGTTIYPNGVKVKKGDTCTPEQAKAYFKHDLAKF 103

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              + ES       ++N+  A+    +N+G G +N ST  ++++  D++ AA++   W K
Sbjct: 104 EKTVNESVTV--PLTQNQFDALVSLTYNIGSGAFNNSTLLKKLNKGDYKGAADQFLVWNK 161

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           AGGKV+ GLV+RR+AE  L L+
Sbjct: 162 AGGKVMKGLVRRREAERALFLK 183


>gi|331682228|ref|ZP_08382850.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H299]
 gi|331080652|gb|EGI51828.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H299]
          Length = 165

 Score = 87.4 bits (215), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVRHNPYKDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|327253806|gb|EGE65435.1| lysozyme [Escherichia coli STEC_7v]
          Length = 165

 Score = 87.0 bits (214), Expect = 8e-16,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD S    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLS---TVARQITPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RRD E ++ L
Sbjct: 150 MTRRDIEREVCL 161


>gi|85058917|ref|YP_454619.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779437|dbj|BAE74214.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 158

 Score = 87.0 bits (214), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 48/136 (35%), Positives = 77/136 (56%), Gaps = 3/136 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG+R T YRD  GG  ++ YGHTGSD+  G   T  E +  L  D   ++ ++  
Sbjct: 24  LIQWHEGVRYTPYRD-SGGVLSVCYGHTGSDIVPGKRYTAAECQALLESDLKAAMAVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E++ VA+A FV+N+G G + +ST  + ++A D   A +E ++W    GKV 
Sbjct: 81  DANVTVPLTESQKVALASFVYNVGRGAFERSTLLKTLNAGDRAGACDEMRRWKYVDGKVS 140

Query: 155 PGLVKRRDAEVKLLLE 170
            GLV RR  E +L L+
Sbjct: 141 KGLVSRRAVERELCLK 156


>gi|320085566|emb|CBY95345.1| probable phage-related lysozyme [Salmonella enterica subsp.
           enterica serovar Weltevreden str. 2007-60-3289-1]
          Length = 149

 Score = 86.7 bits (213), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 78/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAGGK L GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGGKALNGLTRRREAERALFL 148


>gi|260549521|ref|ZP_05823739.1| lysozyme [Acinetobacter sp. RUH2624]
 gi|260407314|gb|EEX00789.1| lysozyme [Acinetobacter sp. RUH2624]
          Length = 205

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 81/143 (56%), Gaps = 13/143 (9%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH----TGSDVTEGMTITEKEAEDFLLKDAS--- 86
           K++K FEG    AY+D GG  WTIGYG      G+ V +G   T  EAE++L  D +   
Sbjct: 68  KLIKSFEGFEPKAYQDTGG-VWTIGYGTIKYPNGTRVKKGDMCTMAEAEEWLKNDCAWVD 126

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             L+  L+  P     ++N+  A+A FV+N+G   ++KST  + ++A ++  AA +  KW
Sbjct: 127 ACLDKYLKFQP-----TQNQFDALASFVYNVGETAFSKSTMLKSLNAGNFAGAANQFDKW 181

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
               GK++ GLV RR AE KL L
Sbjct: 182 VYDNGKLIKGLVNRRAAEKKLFL 204


>gi|212712333|ref|ZP_03320461.1| hypothetical protein PROVALCAL_03421 [Providencia alcalifaciens DSM
           30120]
 gi|212685079|gb|EEB44607.1| hypothetical protein PROVALCAL_03421 [Providencia alcalifaciens DSM
           30120]
          Length = 156

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 73/137 (53%), Gaps = 7/137 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++  FEG+R   Y D+GG   T+ YGHTG D+      ++ E  + L  D  ++   +
Sbjct: 20  LTVIAHFEGVRYEPYEDVGG-VLTVCYGHTGKDIIPNKVYSKDECNELLESDFQRTKQQV 78

Query: 93  --LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
             L   P    T +    A+  F FN+G G + KST  ++++A D   A EE KKW  AG
Sbjct: 79  DKLVKVP----TDDYTKAALYSFAFNVGTGAFAKSTMLKKLNAGDQYGACEELKKWVYAG 134

Query: 151 GKVLPGLVKRRDAEVKL 167
           GKV  GLV RR+AE  +
Sbjct: 135 GKVWRGLVNRREAEAAI 151


>gi|211731757|gb|ACJ10096.1| lysozyme [Bacteriophage APSE-4]
          Length = 146

 Score = 86.7 bits (213), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 85/141 (60%), Gaps = 9/141 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++K +EGL+L AY+    G WTIGYGHT  ++  G  IT+++AE FL +D ++   LL  
Sbjct: 10  LIKSYEGLQLEAYQ-CRAGRWTIGYGHT-HNLNRGDVITQEQAEAFLREDIAQVTALL-- 65

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--GGK 152
           ++      ++N+  A+   VFN+G   +  ST  ++++  D+  AA E  KW+KA   GK
Sbjct: 66  NAQIKVPLTQNQYDALCSLVFNVGGRAFTASTLLKKLNFGDYSGAAAEFMKWSKATVNGK 125

Query: 153 --VLPGLVKRRDAEVKLLLES 171
              LPGL+KRR AE K L ES
Sbjct: 126 RTPLPGLIKRRQAE-KALFES 145


>gi|312913605|dbj|BAJ37579.1| morphogenesis-like protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
          Length = 149

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 78/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSSSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAG KVL GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGSKVLNGLTRRREAERALFL 148


>gi|197284805|ref|YP_002150677.1| phage lysozyme [Proteus mirabilis HI4320]
 gi|194682292|emb|CAR42056.1| phage lysozyme [Proteus mirabilis HI4320]
          Length = 156

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 5/134 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++  FEG+R   YRD+ G   T+ YGHTG D+ +G   T++E +  L  D  K+     +
Sbjct: 22  VIAHFEGVRYEPYRDVAG-VLTVCYGHTGKDIIQGKRYTQQECDALLQIDFIKTQQ---Q 77

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
               +K S  +    A+  F FN+G   + +ST  ++++A D   A EE K+W  AGGKV
Sbjct: 78  VDALIKVSLDDYTKAALYSFAFNVGTTAFARSTLLKKLNAGDRAGACEEMKRWIYAGGKV 137

Query: 154 LPGLVKRRDAEVKL 167
             GLV RR+AE  L
Sbjct: 138 WRGLVSRREAESAL 151


>gi|262279464|ref|ZP_06057249.1| lysozyme [Acinetobacter calcoaceticus RUH2202]
 gi|262259815|gb|EEY78548.1| lysozyme [Acinetobacter calcoaceticus RUH2202]
          Length = 187

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 81/143 (56%), Gaps = 7/143 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           +  +  FEGL+L+AY D G G WTIGYG T    G  V+EG   + ++A+ ++  D  K 
Sbjct: 47  VNQICNFEGLKLSAYDD-GTGVWTIGYGTTRYPNGKRVSEGDRCSLEQAKTYMQHDL-KI 104

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               + SS  +    +N+  A+    +N+G+G +  ST  +++++ D+++AA +   W  
Sbjct: 105 FERAVNSSVKV-PLKQNQFDALVSLTYNIGVGAFKHSTLLKKLNSGDYKEAANQFDVWVN 163

Query: 149 AGGKVLPGLVKRRDAEVKLLLES 171
           AGGK L GLV RR  E KL L S
Sbjct: 164 AGGKRLQGLVNRRAMEKKLFLSS 186


>gi|187929122|ref|YP_001899609.1| Lysozyme [Ralstonia pickettii 12J]
 gi|187726012|gb|ACD27177.1| Lysozyme [Ralstonia pickettii 12J]
          Length = 150

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 83/152 (54%), Gaps = 10/152 (6%)

Query: 22  KHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMT----ITEKEA 77
           +HN        + ++KE EGLRL+ Y D   G  TIGYGH    +  G T    I+++ A
Sbjct: 4   EHNPRTTGERGLALIKESEGLRLSTYLD-AVGKPTIGYGHL---IRPGETFNGPISQQHA 59

Query: 78  EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           E  L KD + +   + ++     S ++ +  A+A FVFNLG G    ST  ++++A D+ 
Sbjct: 60  EALLRKDLADTEQGIAKAVRV--SITQGQFDALASFVFNLGAGRLRSSTLLRKLNAGDYV 117

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            AA +   W KAGGK L GL KRR AE KL L
Sbjct: 118 GAANQFLLWDKAGGKPLKGLTKRRQAERKLFL 149


>gi|197284390|ref|YP_002150262.1| phage lysozome [Proteus mirabilis HI4320]
 gi|194681877|emb|CAR41199.1| phage lysozome [Proteus mirabilis HI4320]
          Length = 156

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 50/134 (37%), Positives = 74/134 (55%), Gaps = 5/134 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++  FEG+R   YRD+ G   T+ YGHTG D+ +G   T++E +  L  D  K+     +
Sbjct: 22  VIAHFEGVRYEPYRDVAG-VLTVCYGHTGKDIIQGKRYTQQECDALLQIDFIKTQQ---Q 77

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
               +K S  +    A+  F FN+G   + +ST  ++++A D   A EE K+W  AGGKV
Sbjct: 78  VDALIKVSLDDYTKAALYSFAFNVGTTAFARSTLLKKLNAGDRAGACEEMKRWIYAGGKV 137

Query: 154 LPGLVKRRDAEVKL 167
             GLV RR+AE  L
Sbjct: 138 WRGLVSRREAESAL 151


>gi|16765933|ref|NP_461548.1| morphogenesis-like protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16421162|gb|AAL21507.1| Gifsy-1 prophage protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|261247810|emb|CBG25638.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994740|gb|ACY89625.1| morphogenesis-like protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
          Length = 150

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 78/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 9   ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 68

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 69  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 119

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAG KVL GL +RR+AE  L L
Sbjct: 120 ADEFLRWNKAGSKVLNGLTRRREAERALFL 149


>gi|168467868|ref|ZP_02701705.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168821393|ref|ZP_02833393.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|169257239|ref|YP_001700616.1| bacteriophage lysin protein; endolysin [Phage Gifsy-1]
 gi|194443240|ref|YP_002041876.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|194401903|gb|ACF62125.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
 gi|195629053|gb|EDX48437.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|205341956|gb|EDZ28720.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Weltevreden str. HI_N05-537]
 gi|321225524|gb|EFX50580.1| Gifsy-2 prophage lysozyme [Salmonella enterica subsp. enterica
           serovar Typhimurium str. TN061786]
          Length = 149

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 58/150 (38%), Positives = 78/150 (52%), Gaps = 22/150 (14%)

Query: 33  IKMLKEFEGLRLTAYRD--IGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLL---- 82
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  GM I E  AE  L     
Sbjct: 8   ITLIKEFEGCSLKAYPDPGTGGDPWTIGYGWTHSVDGKPVKPGMMIDEATAERLLKTGLV 67

Query: 83  ---KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
               D S+ + + L         ++ +  A+  F +NLG    + ST  ++++A D+  A
Sbjct: 68  GYENDVSRLVKVKL---------TQGQFDALVSFAYNLGARTLSTSTLLRKLNAGDYAGA 118

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A+E  +W KAG KVL GL +RR+AE  L L
Sbjct: 119 ADEFLRWNKAGSKVLNGLTRRREAERALFL 148


>gi|262369042|ref|ZP_06062371.1| lysozyme [Acinetobacter johnsonii SH046]
 gi|262316720|gb|EEY97758.1| lysozyme [Acinetobacter johnsonii SH046]
          Length = 191

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 57/164 (34%), Positives = 87/164 (53%), Gaps = 17/164 (10%)

Query: 14  MIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEG 69
           M+G+  D+ H    +  + I ++  FEG RLTAY D G G WTIG+G T    G  V +G
Sbjct: 38  MLGIATDEMH----ISPSGIDLICNFEGKRLTAYDD-GVGVWTIGFGTTVYPNGIKVMKG 92

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKST---SENRLVAVADFVFNLGIGNYNKST 126
            T TE +A+ ++  D  K      E++     T   ++N+  A+    +N+G   ++KST
Sbjct: 93  DTCTEAQAKTYMAHDLKK-----FEATVNKAVTVQLNQNQFDALVSLAYNIGTNAFSKST 147

Query: 127 FKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
             ++++A D   AA++   W  AGGK + GLV RR  E  L L 
Sbjct: 148 LVKKLNANDIRGAADQFDVWVNAGGKRMQGLVNRRAKEKALFLS 191


>gi|260174755|ref|ZP_05761167.1| Mur1 [Bacteroides sp. D2]
 gi|315923014|ref|ZP_07919254.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|313696889|gb|EFS33724.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 144

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 75/132 (56%), Gaps = 6/132 (4%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           +K+FEGLRL AY     G  TIGYGHT + V  G  ITE +A+ F   D  +++   + +
Sbjct: 11  IKKFEGLRLKAYV-CAAGVCTIGYGHT-AGVKPGDVITEPQADAFFESDI-RAVENQVNA 67

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA-AEECKKWTKAGGKVL 154
            P      + +  AV  F FN+GIG +  ST  +++ A  ++ +   E KKW   GGK+L
Sbjct: 68  LPL--HLGQYQFDAVVSFCFNVGIGKFKNSTLYKKIRADAYDSSIPAEFKKWIYGGGKIL 125

Query: 155 PGLVKRRDAEVK 166
           PGLV RR+ E K
Sbjct: 126 PGLVTRREWEAK 137


>gi|320199142|gb|EFW73737.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           EC4100B]
          Length = 165

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|324114522|gb|EGC08490.1| phage lysozyme [Escherichia fergusonii B253]
          Length = 165

 Score = 85.9 bits (211), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|320195923|gb|EFW70547.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           WV_060327]
 gi|323190868|gb|EFZ76135.1| lysozyme [Escherichia coli RN587/1]
          Length = 165

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RRD E ++ L
Sbjct: 150 MTRRDIEREVCL 161


>gi|71276723|ref|ZP_00652991.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71899750|ref|ZP_00681901.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71162481|gb|EAO12215.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71730445|gb|EAO32525.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 166

 Score = 85.5 bits (210), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 80/143 (55%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    GGA TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGGALTIGYGETGKHVTPDMCLANEQEADAMLRA-----RLA 62

Query: 93  LESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G+G +++ST  ++++A D   AAE+   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIVRRAAE-RVLFE 144


>gi|85059537|ref|YP_455239.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84780057|dbj|BAE74834.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 161

 Score = 85.5 bits (210), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 46/136 (33%), Positives = 77/136 (56%), Gaps = 3/136 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  E +  T YRD  GG  ++ YGHTGSD+  G   T  E +  L  D   +++++  
Sbjct: 24  LIQWHESVHYTPYRD-SGGVLSVCYGHTGSDIVPGKRYTVAECQALLDSDLKAAMSVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E++  A+A FV+N+G G + +ST  ++++A D   A +E ++W   GGKV 
Sbjct: 81  DANVTVPLTESQRAALASFVYNVGNGAFARSTLLKKLNAGDMAGACDEMRRWKYVGGKVS 140

Query: 155 PGLVKRRDAEVKLLLE 170
            GLV RR  E +LL +
Sbjct: 141 KGLVNRRAIEQELLCK 156


>gi|168239620|ref|ZP_02664678.1| lysozyme (Lysis protein) [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
 gi|197287703|gb|EDY27094.1| lysozyme (Lysis protein) [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. SL480]
          Length = 165

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RRD E ++ L
Sbjct: 150 MTRRDIEREVCL 161


>gi|294489640|gb|ADE88396.1| phage lysozyme [Escherichia coli IHE3034]
          Length = 165

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 76/132 (57%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LKS-TSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K+   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKADIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|237721578|ref|ZP_04552059.1| Mur1 [Bacteroides sp. 2_2_4]
 gi|229449374|gb|EEO55165.1| Mur1 [Bacteroides sp. 2_2_4]
          Length = 144

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/132 (40%), Positives = 75/132 (56%), Gaps = 6/132 (4%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           +K+FEGLRL AY     G  TIGYGHT + V  G  ITE +A+ F   D  +++   + +
Sbjct: 11  IKKFEGLRLKAYV-CAAGVCTIGYGHT-TGVKPGDVITEAQADAFFESDI-RAVENQVNA 67

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA-AEECKKWTKAGGKVL 154
            P      + +  AV  F FN+GIG   KST  +++ A  ++ +   E KKW   GGK+L
Sbjct: 68  LPL--DLGQYQFDAVVSFCFNVGIGKLKKSTLYKKIRADAYDSSIPAEFKKWIYGGGKIL 125

Query: 155 PGLVKRRDAEVK 166
           PGLV RR+ E K
Sbjct: 126 PGLVIRREWEAK 137


>gi|260842982|ref|YP_003220760.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|257758129|dbj|BAI29626.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 165

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +    SE    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  INVDISETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKSACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|170730442|ref|YP_001775875.1| phage-related lysozyme [Xylella fastidiosa M12]
 gi|167965235|gb|ACA12245.1| phage-related lysozyme [Xylella fastidiosa M12]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 80/143 (55%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    GGA TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGGALTIGYGETGKHVTPDMCLANEQEADAILRA-----RLA 62

Query: 93  LESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G+G +++ST  ++++A D   AAE+   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIIRRAAE-RVLFE 144


>gi|211731781|gb|ACJ10111.1| lysozyme [Bacteriophage APSE-7]
          Length = 146

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 80/138 (57%), Gaps = 8/138 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++K +EGLRL AY+    G WTIGYGHT  ++  G  IT+++AE FL +D ++ + LL  
Sbjct: 10  LIKRYEGLRLKAYQ-CSAGRWTIGYGHT-HNIRAGDVITQQQAEAFLREDIAQVMALL-- 65

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--GGK 152
           ++      ++N+  A+   VFN+G   +  ST  ++++  D+  AA E  KW KA    K
Sbjct: 66  NTQIKVPLTQNQCDALCSLVFNIGATAFAASTLLKKLNFGDYSGAAAEFIKWNKATVNDK 125

Query: 153 VLP--GLVKRRDAEVKLL 168
            +P  GL+KRR  E  L 
Sbjct: 126 KIPLLGLIKRRQVEKALF 143


>gi|89885987|ref|YP_516184.1| hypothetical protein SGPHI_0006 [Sodalis phage phiSG1]
 gi|89191722|dbj|BAE80469.1| conserved hypothetical protein [Sodalis phage phiSG1]
 gi|125470065|gb|ABN42257.1| gp53 [Sodalis phage phiSG1]
          Length = 143

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 81/141 (57%), Gaps = 10/141 (7%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLN 90
           +++++FE  RL AY       WTIGYGHTGS V  G  IT  +AE +L +D   A K++N
Sbjct: 9   RLIQDFEACRLEAY-PCSARVWTIGYGHTGS-VKPGDQITVAQAEAWLAEDIAAAEKAVN 66

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            L+ + P     S+ +  A+  FVFN+G   +  ST  ++++A +   AA+E  +W  AG
Sbjct: 67  TLV-TVP----LSQGQFDALCSFVFNVGRPAFASSTLLKKLNAGEVAGAADEFLRWVHAG 121

Query: 151 GKVLPGLVKRRDAEVKLLLES 171
            K L GL +RR  E  L L+S
Sbjct: 122 PKALKGLKRRRTEERALFLQS 142


>gi|71275465|ref|ZP_00651751.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71276739|ref|ZP_00653006.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71900971|ref|ZP_00683084.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71902379|ref|ZP_00684346.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71162466|gb|EAO12201.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71163765|gb|EAO13481.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71727883|gb|EAO30119.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71729276|gb|EAO31394.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 166

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 80/143 (55%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    G A TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGSALTIGYGETGKHVTPDMCLANEQEADAMLRA-----RLA 62

Query: 93  LESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        +++  A+    FN+G+G +++ST  +R++A D   AAE+   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQHQFDALVSLSFNIGVGAFHRSTLLKRLNAGDVAGAAEQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIIRRAAE-RVLFE 144


>gi|331657724|ref|ZP_08358686.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           TA206]
 gi|315299773|gb|EFU59013.1| phage lysozyme [Escherichia coli MS 16-3]
 gi|323190807|gb|EFZ76076.1| lysozyme [Escherichia coli RN587/1]
 gi|331055972|gb|EGI27981.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           TA206]
          Length = 165

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|218703850|ref|YP_002411369.1| putative lysozyme; DLP12 prophage [Escherichia coli UMN026]
 gi|293403685|ref|ZP_06647776.1| lysozyme [Escherichia coli FVEC1412]
 gi|298379297|ref|ZP_06989178.1| hypothetical protein ECFG_04710 [Escherichia coli FVEC1302]
 gi|300929069|ref|ZP_07144563.1| phage lysozyme [Escherichia coli MS 187-1]
 gi|218430947|emb|CAR11821.1| putative lysozyme; DLP12 prophage [Escherichia coli UMN026]
 gi|291429538|gb|EFF02558.1| lysozyme [Escherichia coli FVEC1412]
 gi|298280410|gb|EFI21914.1| hypothetical protein ECFG_04710 [Escherichia coli FVEC1302]
 gi|300462942|gb|EFK26435.1| phage lysozyme [Escherichia coli MS 187-1]
          Length = 165

 Score = 85.1 bits (209), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 9/134 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+R   Y+DI G  WT+ YGHTG D+  G T TE E +  L KD    ++ +N  ++ 
Sbjct: 34  LEGVRHNPYKDIVG-VWTVCYGHTGKDIIPGKTYTEAECKALLNKDLATVARQINRYIKV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGG    
Sbjct: 93  D-----IPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGNQWK 147

Query: 156 GLVKRRDAEVKLLL 169
           GL+ RR+ E ++ L
Sbjct: 148 GLMTRREIEREVCL 161


>gi|320177869|gb|EFW52854.1| phage lysozyme [Shigella boydii ATCC 9905]
          Length = 159

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 28  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 83

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 84  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 143

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 144 MTRREIEREVCL 155


>gi|28198894|ref|NP_779208.1| phage-related lysozyme [Xylella fastidiosa Temecula1]
 gi|28056985|gb|AAO28857.1| phage-related lysozyme [Xylella fastidiosa Temecula1]
          Length = 203

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 80/142 (56%), Gaps = 13/142 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNL 91
           I ++K FEG +L+ Y    GG  TIGYG TG  V  G+ +T E+EA      DA     L
Sbjct: 47  IALIKFFEGCKLSPY-TCPGGVLTIGYGETGKHVVPGLRLTNEQEA------DARLRARL 99

Query: 92  LLESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             E  PA++     + ++++  A+    FN+G+G +++ST  ++++A D   AAE+   W
Sbjct: 100 AKEFEPAVRRHVKVTLAQHQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVW 159

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AGG+V  GLV+RR AE  L 
Sbjct: 160 KWAGGRVQSGLVRRRKAERWLF 181


>gi|291281120|ref|YP_003497938.1| Phage-related lysozyme (muraminidase) [Escherichia coli O55:H7 str.
           CB9615]
 gi|290760993|gb|ADD54954.1| Phage-related lysozyme (muraminidase) [Escherichia coli O55:H7 str.
           CB9615]
          Length = 165

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|215486147|ref|YP_002328578.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|215264219|emb|CAS08563.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
          Length = 165

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 74/131 (56%), Gaps = 5/131 (3%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P +
Sbjct: 35  EGVSYIPYEDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLAM---VARQINPYI 90

Query: 100 K-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
           K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+
Sbjct: 91  KVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLM 150

Query: 159 KRRDAEVKLLL 169
            RRD E ++ L
Sbjct: 151 TRRDIEREVCL 161


>gi|331645954|ref|ZP_08347057.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M605]
 gi|331044706|gb|EGI16833.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M605]
          Length = 165

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPEITRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|194450185|ref|YP_002044335.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|205358888|ref|ZP_03224162.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
 gi|194408489|gb|ACF68708.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL476]
 gi|205340070|gb|EDZ26834.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Heidelberg str. SL486]
          Length = 167

 Score = 84.7 bits (208), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G   T+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 36  LEGVRYKPYKDVVG-VLTVCYGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 92  IKVDIPETTRGAIYSFVYNVGAGNFRTSTLLRKINQVDIKGACDQLRRWTYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 152 MTRREIEREVCL 163


>gi|326403183|ref|YP_004283264.1| putative lysozyme [Acidiphilium multivorum AIU301]
 gi|325050044|dbj|BAJ80382.1| putative lysozyme [Acidiphilium multivorum AIU301]
          Length = 178

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 72/139 (51%), Gaps = 8/139 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMT-ITEKEAEDFLLKDASKSL 89
            +  FEG   T YRD   G WTIGYG T    G  VT+    IT   AE    +D + + 
Sbjct: 34  FIIPFEGFSPTPYRD-AAGTWTIGYGSTRDDTGCPVTQATPPITRATAEALARRDLASAR 92

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
             +  +     +T  N+  A+ DFV+NLG GN+ +ST  + ++  D++ AA +  +W  A
Sbjct: 93  QTVTHAVTVPLTT--NQQAALIDFVYNLGAGNFLRSTLLRLLNNGDYKAAAAQFPRWDLA 150

Query: 150 GGKVLPGLVKRRDAEVKLL 168
            G  LPGL +RR+AE    
Sbjct: 151 NGIPLPGLRRRREAEAAFF 169


>gi|331651523|ref|ZP_08352543.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M718]
 gi|331050796|gb|EGI22853.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M718]
          Length = 165

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRISTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|170729630|ref|YP_001775063.1| phage-related lysozyme [Xylella fastidiosa M12]
 gi|170730600|ref|YP_001776033.1| phage-related lysozyme [Xylella fastidiosa M12]
 gi|167964423|gb|ACA11433.1| phage-related lysozyme [Xylella fastidiosa M12]
 gi|167965393|gb|ACA12403.1| phage-related lysozyme [Xylella fastidiosa M12]
          Length = 166

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 54/143 (37%), Positives = 79/143 (55%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    G A TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGSALTIGYGETGKHVTPDMCLANEQEADAMLRA-----RLA 62

Query: 93  LESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G+G +++ST  +R++A D   AAE+   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGVGAFHRSTLLKRLNAGDVAGAAEQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIIRRAAE-RVLFE 144


>gi|188494624|ref|ZP_03001894.1| phage lysozyme [Escherichia coli 53638]
 gi|188495172|ref|ZP_03002442.1| phage lysozyme [Escherichia coli 53638]
 gi|194434536|ref|ZP_03066795.1| phage lysozyme [Shigella dysenteriae 1012]
 gi|194434984|ref|ZP_03067226.1| phage lysozyme [Shigella dysenteriae 1012]
 gi|188489823|gb|EDU64926.1| phage lysozyme [Escherichia coli 53638]
 gi|188490371|gb|EDU65474.1| phage lysozyme [Escherichia coli 53638]
 gi|194416766|gb|EDX32893.1| phage lysozyme [Shigella dysenteriae 1012]
 gi|194417248|gb|EDX33358.1| phage lysozyme [Shigella dysenteriae 1012]
 gi|320178666|gb|EFW53629.1| lysozyme-like protein [Shigella boydii ATCC 9905]
 gi|323183916|gb|EFZ69304.1| lysozyme [Escherichia coli 1357]
 gi|332091149|gb|EGI96239.1| lysozyme [Shigella dysenteriae 155-74]
 gi|332093149|gb|EGI98210.1| lysozyme [Shigella dysenteriae 155-74]
          Length = 165

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|293609601|ref|ZP_06691903.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828053|gb|EFF86416.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 187

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 52/142 (36%), Positives = 80/142 (56%), Gaps = 7/142 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++  FEG + TAY D G G WTIG G T    G  V +G T T ++A+ +   D +K 
Sbjct: 48  VDLISSFEGTQFTAYDD-GVGIWTIGTGTTVYPNGVKVKKGDTCTPEQAKVYFKHDLAKF 106

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              + ES       S+N+  A+    +N+G G +  ST  + ++  D++ AA++   W K
Sbjct: 107 EKTVNESVSV--PLSQNQFDALVSLAYNIGSGAFKGSTLLKLLNKGDYKGAADQFLVWNK 164

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           AGGKV+ GLV+RR+AE  L L+
Sbjct: 165 AGGKVMKGLVRRREAERALFLK 186


>gi|224535300|ref|ZP_03675839.1| hypothetical protein BACCELL_00161 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224523077|gb|EEF92182.1| hypothetical protein BACCELL_00161 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 141

 Score = 84.3 bits (207), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 56/135 (41%), Positives = 73/135 (54%), Gaps = 12/135 (8%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLLLES 95
           FEGL+L AYR    G  TIGYGHT   V EGM IT+++A  FL   L D  ++LN     
Sbjct: 14  FEGLKLKAYR-CPSGVLTIGYGHT-KGVYEGMQITKEQALTFLALDLADVERNLN----- 66

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE-ECKKWTKAGGKVL 154
                S S+N+  A+    FN+GI  +N ST  ++  A   + +   E  KW  + GKVL
Sbjct: 67  -TRFPSISQNKFDAMISLSFNIGIQAFNTSTLYRKAKANLNDPSIRIEFMKWVHSKGKVL 125

Query: 155 PGLVKRRDAEVKLLL 169
           PGLV+RR  E  L  
Sbjct: 126 PGLVERRTWEANLYF 140


>gi|284008228|emb|CBA74526.1| phage lysin protein; endolysin [Arsenophonus nasoniae]
          Length = 139

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 48/132 (36%), Positives = 74/132 (56%), Gaps = 7/132 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEGLR   Y D GGG +++ YGHTG+D+    T T+ E + +L  D    L  +  
Sbjct: 1   MITHFEGLRFKPYFD-GGGVFSVCYGHTGNDIERNRTYTKAECDKWLDDD----LKAVKR 55

Query: 95  SSPALKSTSENRLV--AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               L   + N L   A+  F +N+G+GN+ KST  ++++A D + A +E K+W    G+
Sbjct: 56  YVDPLVKVNINTLTQAALYSFAYNVGVGNFAKSTLLKKLNANDRKGACDEMKRWIYVKGE 115

Query: 153 VLPGLVKRRDAE 164
           V  GL+ RR+ E
Sbjct: 116 VWKGLMTRREIE 127


>gi|200389725|ref|ZP_03216336.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|199602170|gb|EDZ00716.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
          Length = 167

 Score = 84.3 bits (207), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 36  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 92  IKVDIPETTRGALYSFVYNVGTGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 152 MTRREIEREVCL 163


>gi|312967393|ref|ZP_07781608.1| lysozyme [Escherichia coli 2362-75]
 gi|312287590|gb|EFR15495.1| lysozyme [Escherichia coli 2362-75]
          Length = 165

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCYGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  INVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|167841452|ref|ZP_02468136.1| hypothetical protein Bpse38_32560 [Burkholderia thailandensis
           MSMB43]
          Length = 151

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 74/138 (53%), Gaps = 3/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + +   +EG R T Y D  G   T   GHTG+DV  G   +  +    L  D+++++  +
Sbjct: 17  VPLTLTYEGTRTTVYLDPVG-IPTACTGHTGADVRVGRVYSPAQCTQLLNADSAEAMGAV 75

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           L+ +      + N L A  DFVFN+G GN+ +ST +++ +A D   A EE KKW  A G 
Sbjct: 76  LDLTTG--PINANELAAYTDFVFNVGRGNFARSTLRKKFNAGDHRGACEELKKWVYAKGV 133

Query: 153 VLPGLVKRRDAEVKLLLE 170
            L GLV RR AE ++  +
Sbjct: 134 KLRGLVLRRQAEYEVCTQ 151


>gi|261245587|emb|CBG23382.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
          Length = 167

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G   T+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 36  LEGVRYKPYKDVVG-VLTVCYGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 92  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 152 MTRREIEREVCL 163


>gi|219681236|ref|YP_002455881.1| Gp19 [Salmonella enterica bacteriophage SE1]
 gi|9910763|sp|O80292|LYS_BPPS1 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase; AltName:
           Full=Protein gp19
 gi|3676086|emb|CAA09710.1| gp19 [Phage PS119]
 gi|66473851|gb|AAY46497.1| Gp19 [Salmonella phage SE1]
          Length = 167

 Score = 84.0 bits (206), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G   T+ YGHTG D+  G T TE E +  L KD    + +  + +P 
Sbjct: 36  LEGVRYKPYKDVVG-VLTVCYGHTGKDIMPGKTYTEAECKALLNKDL---ITVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 92  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RR+ E  + L
Sbjct: 152 MTRREVERDVCL 163


>gi|218549384|ref|YP_002383175.1| lysozyme; DLP12 prophage [Escherichia fergusonii ATCC 35469]
 gi|218695974|ref|YP_002403641.1| putative lysozyme; DLP12 prophage [Escherichia coli 55989]
 gi|218352706|emb|CAU98488.1| putative lysozyme; DLP12 prophage [Escherichia coli 55989]
 gi|218356925|emb|CAQ89557.1| putative lysozyme; DLP12 prophage [Escherichia fergusonii ATCC
           35469]
          Length = 165

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|206580504|ref|YP_002239952.1| phage lysozyme [Klebsiella pneumoniae 342]
 gi|206569562|gb|ACI11338.1| phage lysozyme [Klebsiella pneumoniae 342]
          Length = 167

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 73/136 (53%), Gaps = 9/136 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+R   Y+D+ G  WT+ YGHTG D+  G   TE E    L KD    ++ +N  ++ 
Sbjct: 36  LEGVRYDPYQDVVG-VWTVCYGHTGKDIMLGKKYTEAECRALLSKDLNTVARQINPYIQ- 93

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
               K   E    A+  F +N+G GN+  ST  ++++  D + A ++ ++WT A GK   
Sbjct: 94  ----KPIPETMRGALYSFAYNVGAGNFQTSTLLRKINQGDQKGACDQLRRWTYAKGKQWK 149

Query: 156 GLVKRRDAEVKLLLES 171
           GLV RR+ E ++ L S
Sbjct: 150 GLVTRREIEREVCLWS 165


>gi|110804750|ref|YP_688270.1| bacteriophage lambda lysozyme [Shigella flexneri 5 str. 8401]
 gi|110614298|gb|ABF02965.1| bacteriophage lambda lysozyme [Shigella flexneri 5 str. 8401]
          Length = 171

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD    + +  + +P 
Sbjct: 34  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDL---VTVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGAYDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|85059191|ref|YP_454893.1| putative phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779711|dbj|BAE74488.1| putative phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 146

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 82/142 (57%), Gaps = 12/142 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ +K FEGL+LTAY+      WTIGYGHT     E + I  ++A+ FL  D    ++ +
Sbjct: 9   LERIKAFEGLQLTAYQ-CSADRWTIGYGHTNGVKAEDV-IPLEQADAFLRDD----IDAV 62

Query: 93  LESSPALKST--SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA- 149
           +E   AL +   ++N+  A+   VFN+GIG + KST  ++++  D+  AA E  KW  A 
Sbjct: 63  VERLNALITVPVAQNQFDALCSLVFNIGIGAFAKSTLLKKLNESDYPGAAVEFSKWCHAT 122

Query: 150 --GGKV-LPGLVKRRDAEVKLL 168
             G KV LPGL+KRR  E  L 
Sbjct: 123 VDGKKVSLPGLIKRRQEEKALF 144


>gi|306846065|ref|ZP_07478628.1| phage lysozyme [Brucella sp. BO1]
 gi|306273508|gb|EFM55366.1| phage lysozyme [Brucella sp. BO1]
          Length = 227

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 56/139 (40%), Positives = 79/139 (56%), Gaps = 9/139 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKS 88
           + ++K++EGL+ TAYRD+ G   TIGYGHT +     VT GM+I +KEAE  L  D +K 
Sbjct: 10  LSLVKQWEGLKNTAYRDVAG-VLTIGYGHTSAAGAPKVTPGMSIGDKEAERILKADLAK- 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
               +E    +  T +N+  A+  F FN   G  +KST  ++++  D+     E  KW  
Sbjct: 68  FEARVERLVKVPLT-DNQFAALVSFDFN--TGALDKSTLLKKLNKGDYAAVPVELMKWVN 124

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           AGGK + GLV RR AE  L
Sbjct: 125 AGGKKINGLVNRRAAEAGL 143


>gi|156974260|ref|YP_001445167.1| hypothetical protein VIBHAR_01975 [Vibrio harveyi ATCC BAA-1116]
 gi|156525854|gb|ABU70940.1| hypothetical protein VIBHAR_01975 [Vibrio harveyi ATCC BAA-1116]
          Length = 159

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 74/136 (54%), Gaps = 5/136 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+K  EG++ T Y D+ G   T+ YGHTG+D+      ++ E ++ L  D +    ++  
Sbjct: 25  MIKPMEGVQYTPYTDVAG-VQTVCYGHTGTDIISDKVYSQAECDELLESDLAAVKRMV-- 81

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
             P +     E    A+  F FN+GIG++++ST  + ++  +W  A ++ K+W  A GK 
Sbjct: 82  -DPMIHVDIPETTRAALYSFTFNVGIGSFSRSTLLKLLNKGEWYAACDQLKRWVYAAGKP 140

Query: 154 LPGLVKRRDAEVKLLL 169
             GL+ RRD E ++ L
Sbjct: 141 WKGLMNRRDIERQVCL 156


>gi|85059365|ref|YP_455067.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779885|dbj|BAE74662.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 161

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 76/137 (55%), Gaps = 3/137 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  E +  T YRD  GG  ++ YGHTGSD+  G   T  E +  L  D   +++++  
Sbjct: 24  LIQWHESVHYTPYRD-SGGVLSVCYGHTGSDIVPGKRYTVAECQALLDSDLKAAMSVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E++  A+A FV+N+G G + +ST  ++++A D   A +E ++W   GGKV 
Sbjct: 81  DANVTVPLTESQRAALASFVYNVGNGAFARSTLLKKLNAGDMAGACDEMRRWKYVGGKVS 140

Query: 155 PGLVKRRDAEVKLLLES 171
            GLV RR  E +   E+
Sbjct: 141 KGLVSRRAVEREFCTEA 157


>gi|293413819|ref|ZP_06656468.1| lysozyme [Escherichia coli B185]
 gi|291433877|gb|EFF06850.1| lysozyme [Escherichia coli B185]
          Length = 165

 Score = 84.0 bits (206), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 9/134 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD    ++ +N  +E 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIEV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D E A ++ ++WT AGGK   
Sbjct: 93  D-----IPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIEGACDQLRRWTYAGGKQWK 147

Query: 156 GLVKRRDAEVKLLL 169
           GL+ RR+ E ++ L
Sbjct: 148 GLMTRREIEREICL 161


>gi|304415235|ref|ZP_07395939.1| phage lysozome [Candidatus Regiella insecticola LSR1]
 gi|304282911|gb|EFL91370.1| phage lysozome [Candidatus Regiella insecticola LSR1]
          Length = 214

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 71/131 (54%), Gaps = 5/131 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEG+R   Y D GGG  ++ YGHTG+D+      T+ E   +L KD  K   +   
Sbjct: 70  MINHFEGVRYKPYFD-GGGVLSVCYGHTGNDIALNKIYTQTECNKWLDKDLPK---VKKH 125

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
             P +K   S     A+  FV+N+GIGN+  ST  ++++A D + A EE K W  A GK 
Sbjct: 126 VDPLIKVKISALTQAAIYSFVYNVGIGNFRHSTLLEKLNAGDKKGACEEMKWWVYADGKR 185

Query: 154 LPGLVKRRDAE 164
             GL+ RR+ E
Sbjct: 186 WKGLILRREVE 196


>gi|218703093|ref|YP_002410722.1| putative lysozyme; DLP12 prophage [Escherichia coli IAI39]
 gi|218373079|emb|CAR20971.1| putative lysozyme; DLP12 prophage [Escherichia coli IAI39]
          Length = 165

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|182681595|ref|YP_001829755.1| lysozyme [Xylella fastidiosa M23]
 gi|182631705|gb|ACB92481.1| Lysozyme [Xylella fastidiosa M23]
          Length = 165

 Score = 84.0 bits (206), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 79/138 (57%), Gaps = 13/138 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNL 91
           I ++K FEG +L+ Y    GG  TIGYG TG  V  G+ +T E+EA      DA     L
Sbjct: 9   IALIKFFEGCKLSPY-TCPGGVLTIGYGETGKHVVPGLRLTNEQEA------DARLRARL 61

Query: 92  LLESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             E  PA++     + ++++  A+    FN+G+G +++ST  ++++A D   AAE+   W
Sbjct: 62  AKEFEPAVRRHVKVTLAQHQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVW 121

Query: 147 TKAGGKVLPGLVKRRDAE 164
             AGG+V  GLV+RR AE
Sbjct: 122 KWAGGRVQSGLVRRRKAE 139


>gi|281178275|dbj|BAI54605.1| putative phage lysozyme [Escherichia coli SE15]
          Length = 165

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|148609440|ref|YP_001272571.1| lysin [Phage cdtI]
 gi|148524769|dbj|BAF63391.1| lysin [Phage cdtI]
 gi|320195903|gb|EFW70528.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           WV_060327]
          Length = 165

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|85059139|ref|YP_454841.1| hypothetical protein SG1161 [Sodalis glossinidius str. 'morsitans']
 gi|84779659|dbj|BAE74436.1| hypothetical phage protein [Sodalis glossinidius str. 'morsitans']
          Length = 145

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 82/142 (57%), Gaps = 12/142 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ +K FEGL+LTAY+      WTIGYGHT     E + I  ++A+ FL  D    ++ +
Sbjct: 8   LERIKAFEGLQLTAYQ-CSADRWTIGYGHTNGVKAEDV-IPLEQADAFLRDD----IDAV 61

Query: 93  LESSPALKST--SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA- 149
           +E   AL +   ++N+  A+   VFN+GIG + KST  ++++  D+  AA E  KW  A 
Sbjct: 62  VERLNALITVPVAQNQFDALCSLVFNIGIGAFAKSTLLKKLNESDYPGAAVEFSKWCHAT 121

Query: 150 --GGKV-LPGLVKRRDAEVKLL 168
             G KV LPGL+KRR  E  L 
Sbjct: 122 VDGKKVSLPGLIKRRQEEKALF 143


>gi|194734222|ref|YP_002113596.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|194709724|gb|ACF88945.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
          Length = 165

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQIRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|320659881|gb|EFX27429.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O55:H7 str. USDA 5905]
          Length = 165

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|260868944|ref|YP_003235346.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|291281740|ref|YP_003498558.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O55:H7 str. CB9615]
 gi|257765300|dbj|BAI36795.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|290761613|gb|ADD55574.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O55:H7 str. CB9615]
 gi|320643283|gb|EFX12474.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H- str. 493-89]
 gi|320648625|gb|EFX17269.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H- str. H 2687]
 gi|320654201|gb|EFX22264.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O55:H7 str. 3256-97 TW 07815]
 gi|320664701|gb|EFX31844.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 str. LSU-61]
 gi|323176855|gb|EFZ62445.1| lysozyme [Escherichia coli 1180]
          Length = 165

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|15800496|ref|NP_286508.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 EDL933]
 gi|15830073|ref|NP_308846.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168750287|ref|ZP_02775309.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168757083|ref|ZP_02782090.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168763384|ref|ZP_02788391.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168767240|ref|ZP_02792247.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168776460|ref|ZP_02801467.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|168779283|ref|ZP_02804290.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168786954|ref|ZP_02811961.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168800773|ref|ZP_02825780.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|195936781|ref|ZP_03082163.1| endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208806420|ref|ZP_03248757.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208815327|ref|ZP_03256506.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208822775|ref|ZP_03263094.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209399665|ref|YP_002269416.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217326266|ref|ZP_03442350.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254791939|ref|YP_003076776.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 str. TW14359]
 gi|261225391|ref|ZP_05939672.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 str. FRIK2000]
 gi|12513725|gb|AAG55116.1|AE005256_7 putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 str. EDL933]
 gi|13360278|dbj|BAB34242.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|187768134|gb|EDU31978.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|188015521|gb|EDU53643.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|189002696|gb|EDU71682.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189355863|gb|EDU74282.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189363430|gb|EDU81849.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189366426|gb|EDU84842.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|189373147|gb|EDU91563.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189376977|gb|EDU95393.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|208726221|gb|EDZ75822.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208731975|gb|EDZ80663.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208738260|gb|EDZ85943.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209161065|gb|ACI38498.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217322487|gb|EEC30911.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254591339|gb|ACT70700.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 str. TW14359]
 gi|320193188|gb|EFW67828.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           O157:H7 str. EC1212]
 gi|320637893|gb|EFX07677.1| putative lysozyme protein R of prophage CP-933K [Escherichia coli
           O157:H7 str. G5101]
 gi|326345687|gb|EGD69426.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           O157:H7 str. 1125]
 gi|326347953|gb|EGD71666.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           O157:H7 str. 1044]
          Length = 165

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|237745752|ref|ZP_04576232.1| glycoside hydrolase [Oxalobacter formigenes HOxBLS]
 gi|229377103|gb|EEO27194.1| glycoside hydrolase [Oxalobacter formigenes HOxBLS]
          Length = 171

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 49/132 (37%), Positives = 75/132 (56%), Gaps = 6/132 (4%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY+D   G  T+GYG T   V  G   T + A   LL  A++  + +    P 
Sbjct: 42  HEGYREDAYQD-AVGVPTVGYGET-VGVKMGDRTTPERALVTLLSSANRHADAI---RPC 96

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     ++   A     +N+G GN+ +ST  ++++A+D+  A EE ++W KAGGKVLPGL
Sbjct: 97  IHVPLHQHEFDAYVSLAYNIGAGNFCRSTLVKKLNAKDYAGACEEIRRWNKAGGKVLPGL 156

Query: 158 VKRRDAEVKLLL 169
           VKRR+AE ++ +
Sbjct: 157 VKRREAEYRMCM 168


>gi|46358689|ref|YP_006397.1| gp19 [Enterobacteria phage ST104]
 gi|46357925|dbj|BAD15204.1| 19 [Enterobacteria phage ST104]
 gi|312911334|dbj|BAJ35308.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
          Length = 156

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G   T+ YGHTG D+  G T TE E +  L KD    + +  + +P 
Sbjct: 25  LEGVRYKPYKDVVG-VLTVCYGHTGKDIMPGKTYTEAECKALLNKDL---ITVARQINPY 80

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 81  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 140

Query: 158 VKRRDAEVKLLL 169
           + RR+ E  + L
Sbjct: 141 MTRREVERDVCL 152


>gi|262039732|ref|ZP_06013012.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042899|gb|EEW43890.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 163

 Score = 83.6 bits (205), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 73/136 (53%), Gaps = 9/136 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+R   Y+D+ G  WT+ YGHTG D+  G   TE E    L KD    ++ +N  ++ 
Sbjct: 32  LEGVRYDPYQDVVG-VWTVCYGHTGKDIMLGKKYTEAECRALLSKDLNTVARQINPYIQ- 89

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
               K   E    A+  F +N+G GN+  ST  ++++  D + A ++ ++WT A GK   
Sbjct: 90  ----KPIPETMRGALYSFAYNVGAGNFQTSTLLRKINQGDQKGACDQLRRWTYAKGKQWK 145

Query: 156 GLVKRRDAEVKLLLES 171
           GLV RR+ E ++ L S
Sbjct: 146 GLVTRREIEREVCLWS 161


>gi|288934665|ref|YP_003438724.1| Lysozyme [Klebsiella variicola At-22]
 gi|288889374|gb|ADC57692.1| Lysozyme [Klebsiella variicola At-22]
          Length = 167

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G  WT+ YGHTG D+  G   TE E    L KD +    +  +  P 
Sbjct: 36  LEGVRYAPYQDVVG-VWTVCYGHTGKDIMLGKKYTEAECRALLSKDLN---TVARQIDPY 91

Query: 99  L-KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           + K   E    A+  F +N+G GN+  ST  ++++  D + A E+ ++WT A GK   GL
Sbjct: 92  IQKPIPETMRGALYSFAYNVGAGNFQTSTLLRKINQGDQKGACEQLRRWTYAKGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           V RR+ E ++ L
Sbjct: 152 VTRREIEREVCL 163


>gi|311992763|ref|YP_004009630.1| putative ysozyme [Acinetobacter phage Acj61]
 gi|295815052|gb|ADG35978.1| putative ysozyme [Acinetobacter phage Acj61]
          Length = 190

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 54/155 (34%), Positives = 82/155 (52%), Gaps = 11/155 (7%)

Query: 18  NGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTIT 73
           N       + + +A + ++K+FEGLRL AY D   G WTIGYG T    G  V +G T T
Sbjct: 33  NMTPSQKALQISDAGVALIKQFEGLRLAAYLD-SVGIWTIGYGTTVYPNGKKVAKGDTCT 91

Query: 74  EKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA 133
           E +A +F   D  K +  +  SS      ++N+  A+    +N+G+G    ST  ++++A
Sbjct: 92  EAQANEFKANDLKKFVPAV--SSLIQVPVTQNQFDALVSLTYNIGVGAIGGSTLIKKLNA 149

Query: 134 QDWEKAAEECKKWTKAGGK----VLPGLVKRRDAE 164
           +D++ AAE+   W K   K    V+PGL  RR  E
Sbjct: 150 KDYKGAAEQFLVWNKGRVKGVLQVIPGLTNRRIKE 184


>gi|15838165|ref|NP_298853.1| phage-related lysozyme [Xylella fastidiosa 9a5c]
 gi|15838270|ref|NP_298958.1| phage-related lysozyme [Xylella fastidiosa 9a5c]
 gi|9106609|gb|AAF84373.1|AE003986_3 phage-related lysozyme [Xylella fastidiosa 9a5c]
 gi|9106729|gb|AAF84478.1|AE003992_14 phage-related lysozyme [Xylella fastidiosa 9a5c]
          Length = 203

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 74/141 (52%), Gaps = 11/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L  Y    GG  TIGYG TG  V   M +  ++  D +L+       L 
Sbjct: 47  IALIKFFEGCKLNPY-TCPGGVLTIGYGETGKHVVPDMCLANEQEADAMLRA-----RLA 100

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST  +R++A D   AAE+   W 
Sbjct: 101 KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGTGAFHRSTLLKRLNAGDVAGAAEQFGAWK 160

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
            + G+VLPGLV+RR AE  L 
Sbjct: 161 FSSGRVLPGLVRRRKAERWLF 181


>gi|193065585|ref|ZP_03046652.1| phage lysozyme [Escherichia coli E22]
 gi|194430195|ref|ZP_03062695.1| phage lysozyme [Escherichia coli B171]
 gi|192926770|gb|EDV81397.1| phage lysozyme [Escherichia coli E22]
 gi|194411776|gb|EDX28098.1| phage lysozyme [Escherichia coli B171]
          Length = 165

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  INVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKSACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|74313216|ref|YP_311635.1| lysozyme-like protein [Shigella sonnei Ss046]
 gi|73856693|gb|AAZ89400.1| lysozyme-like protein [Shigella sonnei Ss046]
          Length = 165

 Score = 83.6 bits (205), Expect = 9e-15,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|218694215|ref|YP_002401882.1| putative lysozyme; DLP12 prophage [Escherichia coli 55989]
 gi|218350947|emb|CAU96650.1| putative lysozyme; DLP12 prophage [Escherichia coli 55989]
          Length = 165

 Score = 83.6 bits (205), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/134 (35%), Positives = 74/134 (55%), Gaps = 9/134 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD    ++ +N  +E 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLATVARQINPYIEV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   
Sbjct: 93  D-----IPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWK 147

Query: 156 GLVKRRDAEVKLLL 169
           GL+ RR+ E ++ L
Sbjct: 148 GLMTRREIEREVCL 161


>gi|323973891|gb|EGB69063.1| phage lysozyme [Escherichia coli TA007]
          Length = 165

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++W  AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWAYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|293609357|ref|ZP_06691659.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292827809|gb|EFF86172.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 186

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 55/146 (37%), Positives = 85/146 (58%), Gaps = 13/146 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL---LKDA 85
           +  +  FEGLRL+AY D G G W+IGYG T    G  V +G T T ++A+ ++   LK  
Sbjct: 47  VNSICNFEGLRLSAYDD-GVGVWSIGYGTTRYPNGLSVQKGDTCTFEQAKAYMQHDLKIF 105

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            +++N  ++    LK   +N+  A+    +N+G G + KST  +++++ D++ AA +   
Sbjct: 106 ERAVNGAVK--VPLK---QNQFDALVSLSYNIGAGAFKKSTLLKKLNSGDYKGAANQFDV 160

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLES 171
           W  AGGK L GLV+RR  E KL L S
Sbjct: 161 WVNAGGKRLAGLVRRRAIEKKLFLGS 186


>gi|194436577|ref|ZP_03068678.1| phage lysozyme [Escherichia coli 101-1]
 gi|209918620|ref|YP_002292704.1| putative phage lysozyme [Escherichia coli SE11]
 gi|194424609|gb|EDX40595.1| phage lysozyme [Escherichia coli 101-1]
 gi|209911879|dbj|BAG76953.1| putative phage lysozyme [Escherichia coli SE11]
 gi|323973582|gb|EGB68766.1| phage lysozyme [Escherichia coli TA007]
          Length = 165

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKTLLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|9910762|sp|O80288|LYS_BPPS3 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase; AltName:
           Full=Protein gp19
 gi|3676081|emb|CAA09706.1| gp19 [Phage PS34]
          Length = 167

 Score = 83.2 bits (204), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G   T+ YGHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 36  LEGVRYKPYKDVVG-VLTVCYGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E     +  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 92  IKVDIPETTRGGIYSFVYNVGAGNFETSTLLRKINQVDIKGACDQLRRWTYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 152 MTRREIEREVCL 163


>gi|300825029|ref|ZP_07105126.1| phage lysozyme [Escherichia coli MS 119-7]
 gi|300522493|gb|EFK43562.1| phage lysozyme [Escherichia coli MS 119-7]
          Length = 165

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKTLLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|168752291|ref|ZP_02777313.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168759116|ref|ZP_02784123.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168772016|ref|ZP_02797023.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168777983|ref|ZP_02802990.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|168784098|ref|ZP_02809105.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168790413|ref|ZP_02815420.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168802481|ref|ZP_02827488.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|170769087|ref|ZP_02903540.1| phage lysozyme [Escherichia albertii TW07627]
 gi|195940156|ref|ZP_03085538.1| lysozyme-like protein [Escherichia coli O157:H7 str. EC4024]
 gi|208807287|ref|ZP_03249624.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208817177|ref|ZP_03258269.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208820686|ref|ZP_03261006.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209398069|ref|YP_002271215.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209447172|ref|YP_002274257.1| phage-related lysozyme [Stx2-converting phage 1717]
 gi|215485828|ref|YP_002328259.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|254793753|ref|YP_003078590.1| phage-related lysozyme [Escherichia coli O157:H7 str. TW14359]
 gi|260854033|ref|YP_003227924.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|260855075|ref|YP_003228966.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|260855731|ref|YP_003229622.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|260856738|ref|YP_003230629.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|260870778|ref|YP_003237180.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|261226528|ref|ZP_05940809.1| phage-related lysozyme (muraminidase) [Escherichia coli O157:H7
           str. FRIK2000]
 gi|291282307|ref|YP_003499125.1| lysozyme-like protein [Escherichia coli O55:H7 str. CB9615]
 gi|312965244|ref|ZP_07779480.1| lysozyme [Escherichia coli 2362-75]
 gi|170122159|gb|EDS91090.1| phage lysozyme [Escherichia albertii TW07627]
 gi|187766903|gb|EDU30747.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|188013837|gb|EDU51959.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|188998672|gb|EDU67658.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189354253|gb|EDU72672.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189359412|gb|EDU77831.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189370109|gb|EDU88525.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189375519|gb|EDU93935.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|208727088|gb|EDZ76689.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208730796|gb|EDZ79486.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208740809|gb|EDZ88491.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209159469|gb|ACI36902.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209361151|gb|ACI43144.1| phage-related lysozyme [Escherichia coli O157:H7]
 gi|209407416|emb|CAQ82032.1| lysozyme-like protein [Enterobacteria phage 2851]
 gi|215263900|emb|CAS08238.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|254593153|gb|ACT72514.1| phage-related lysozyme (muraminidase) [Escherichia coli O157:H7
           str. TW14359]
 gi|257752682|dbj|BAI24184.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257753724|dbj|BAI25226.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257754380|dbj|BAI25882.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257755387|dbj|BAI26889.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257767134|dbj|BAI38629.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|290762180|gb|ADD56141.1| lysozyme-like protein [Escherichia coli O55:H7 str. CB9615]
 gi|312290128|gb|EFR18012.1| lysozyme [Escherichia coli 2362-75]
 gi|320191864|gb|EFW66512.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           O157:H7 str. EC1212]
 gi|320201064|gb|EFW75648.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           EC4100B]
 gi|320637297|gb|EFX07111.1| lysozyme-like protein [Escherichia coli O157:H7 str. G5101]
 gi|320642674|gb|EFX11901.1| lysozyme-like protein [Escherichia coli O157:H- str. 493-89]
 gi|320653621|gb|EFX21708.1| lysozyme-like protein [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
 gi|320659284|gb|EFX26860.1| lysozyme-like protein [Escherichia coli O55:H7 str. USDA 5905]
 gi|320664118|gb|EFX31282.1| lysozyme-like protein [Escherichia coli O157:H7 str. LSU-61]
 gi|323155091|gb|EFZ41280.1| lysozyme [Escherichia coli EPECa14]
 gi|323177641|gb|EFZ63226.1| lysozyme [Escherichia coli 1180]
 gi|323179991|gb|EFZ65547.1| lysozyme [Escherichia coli 1180]
          Length = 165

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  INVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|206576574|ref|YP_002239196.1| phage lysozyme [Klebsiella pneumoniae 342]
 gi|206565632|gb|ACI07408.1| phage lysozyme [Klebsiella pneumoniae 342]
          Length = 167

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 47/132 (35%), Positives = 71/132 (53%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+R   Y+D+ G  WT+ YGHTG D+  G   TE E    L KD +    +  +  P 
Sbjct: 36  LEGVRYDPYQDVVG-VWTVCYGHTGKDIMLGKRYTEAECRALLSKDLN---TVARQIDPY 91

Query: 99  L-KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           + K   E    A+  F +N+G GN+  ST  +R++  D + A ++ ++WT A GK   GL
Sbjct: 92  IQKPIPETMRGALYSFAYNVGAGNFRTSTLLRRINQGDQKGACDQLRRWTYAKGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           V RR+ E ++ L
Sbjct: 152 VTRREIEREVCL 163


>gi|309701020|emb|CBJ00318.1| probable lysozyme from lambdoid prophage dlp12 [Escherichia coli
           ETEC H10407]
          Length = 165

 Score = 82.8 bits (203), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 9/134 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD    ++ +N  +E 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDILLGKTYTKAECKALLNKDLATVARQINPYIEV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   
Sbjct: 93  D-----IPETTCGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWK 147

Query: 156 GLVKRRDAEVKLLL 169
           GL+ RR+ E ++ L
Sbjct: 148 GLMTRREIEREICL 161


>gi|323937697|gb|EGB33965.1| phage lysozyme [Escherichia coli E1520]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|300819466|ref|ZP_07099662.1| phage lysozyme [Escherichia coli MS 107-1]
 gi|300527965|gb|EFK49027.1| phage lysozyme [Escherichia coli MS 107-1]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMFGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETMRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|300824956|ref|ZP_07105056.1| phage lysozyme [Escherichia coli MS 119-7]
 gi|300522585|gb|EFK43654.1| phage lysozyme [Escherichia coli MS 119-7]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKTLLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|26247431|ref|NP_753471.1| lysozyme from lambdoid prophage DLP12 [Escherichia coli CFT073]
 gi|91210330|ref|YP_540316.1| lysozyme from lambdoid prophage DLP12 [Escherichia coli UTI89]
 gi|117623345|ref|YP_852258.1| bacteriophage lambda lysozyme-like protein [Escherichia coli APEC
           O1]
 gi|218558050|ref|YP_002390963.1| lysozyme; DLP12 prophage [Escherichia coli S88]
 gi|227886469|ref|ZP_04004274.1| lysozyme from lambdoid prophage DLP12 [Escherichia coli 83972]
 gi|237706842|ref|ZP_04537323.1| lysozyme from lambdoid prophage DLP12 [Escherichia sp. 3_2_53FAA]
 gi|291281478|ref|YP_003498296.1| Lysozyme [Escherichia coli O55:H7 str. CB9615]
 gi|293418630|ref|ZP_06661065.1| lysozyme [Escherichia coli B088]
 gi|300903162|ref|ZP_07121094.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|300975678|ref|ZP_07173122.1| phage lysozyme [Escherichia coli MS 45-1]
 gi|300991518|ref|ZP_07179575.1| phage lysozyme [Escherichia coli MS 200-1]
 gi|301046442|ref|ZP_07193597.1| phage lysozyme [Escherichia coli MS 185-1]
 gi|301301723|ref|ZP_07207858.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|331676478|ref|ZP_08377175.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H591]
 gi|262367957|pdb|3HDE|A Chain A, Crystal Structure Of Full-Length Endolysin R21 From Phage
           21
 gi|262367958|pdb|3HDE|B Chain B, Crystal Structure Of Full-Length Endolysin R21 From Phage
           21
 gi|262367959|pdb|3HDE|C Chain C, Crystal Structure Of Full-Length Endolysin R21 From Phage
           21
 gi|262367960|pdb|3HDE|D Chain D, Crystal Structure Of Full-Length Endolysin R21 From Phage
           21
 gi|26107832|gb|AAN80031.1|AE016759_305 Probable lysozyme from lambdoid prophage DLP12 [Escherichia coli
           CFT073]
 gi|91071904|gb|ABE06785.1| probable lysozyme from lambdoid prophage DLP12 [Escherichia coli
           UTI89]
 gi|115512469|gb|ABJ00544.1| bacteriophage lambda lysozyme-like protein [Escherichia coli APEC
           O1]
 gi|218364819|emb|CAR02511.1| putative lysozyme; DLP12 prophage [Escherichia coli S88]
 gi|226898052|gb|EEH84311.1| lysozyme from lambdoid prophage DLP12 [Escherichia sp. 3_2_53FAA]
 gi|227836673|gb|EEJ47139.1| lysozyme from lambdoid prophage DLP12 [Escherichia coli 83972]
 gi|290761351|gb|ADD55312.1| Lysozyme [Escherichia coli O55:H7 str. CB9615]
 gi|291325158|gb|EFE64573.1| lysozyme [Escherichia coli B088]
 gi|294493048|gb|ADE91804.1| phage lysozyme [Escherichia coli IHE3034]
 gi|300301556|gb|EFJ57941.1| phage lysozyme [Escherichia coli MS 185-1]
 gi|300305562|gb|EFJ60082.1| phage lysozyme [Escherichia coli MS 200-1]
 gi|300404777|gb|EFJ88315.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|300410242|gb|EFJ93780.1| phage lysozyme [Escherichia coli MS 45-1]
 gi|300843220|gb|EFK70980.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|307553171|gb|ADN45946.1| phage lysozyme [Escherichia coli ABU 83972]
 gi|307627357|gb|ADN71661.1| Lysozyme [Escherichia coli UM146]
 gi|315252896|gb|EFU32864.1| phage lysozyme [Escherichia coli MS 85-1]
 gi|315287493|gb|EFU46904.1| phage lysozyme [Escherichia coli MS 110-3]
 gi|315295450|gb|EFU54778.1| phage lysozyme [Escherichia coli MS 153-1]
 gi|323953145|gb|EGB49011.1| phage lysozyme [Escherichia coli H252]
 gi|323957995|gb|EGB53707.1| phage lysozyme [Escherichia coli H263]
 gi|323965022|gb|EGB60484.1| phage lysozyme [Escherichia coli M863]
 gi|327254910|gb|EGE66526.1| lysozyme [Escherichia coli STEC_7v]
 gi|331075971|gb|EGI47268.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H591]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETMRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|157158856|ref|YP_001461952.1| phage lysozyme [Escherichia coli E24377A]
 gi|157080886|gb|ABV20594.1| phage lysozyme [Escherichia coli E24377A]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETMRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MARREIEREICL 161


>gi|290454907|emb|CBJ57165.1| putative phage-related lysozyme [Pectobacterium carotovorum]
          Length = 153

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 84/151 (55%), Gaps = 10/151 (6%)

Query: 26  IP--VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDF 80
           IP  +  A + ++K FEGL+LT YRD  G  WTIGYGH      +   G+T+ E    D 
Sbjct: 4   IPDTINEAGLSLIKSFEGLKLTKYRDTAG-KWTIGYGHLILPNENFDNGITLQEA---DS 59

Query: 81  LLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
           LL+   K+    ++    +   + N+  A+  F +NLG+ +   ST  + ++  D+  AA
Sbjct: 60  LLRQDLKTAEAGVQHYVTV-DLNGNQFGALTSFTYNLGVNSLKTSTLLRLLNQGDYAAAA 118

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           ++  +W K G +V+ GL++RR+AE  L L++
Sbjct: 119 DQFPRWDKDGQQVVEGLLRRREAEKALFLQA 149


>gi|117623614|ref|YP_852527.1| phage-related lysozyme (muraminidase) [Escherichia coli APEC O1]
 gi|193062549|ref|ZP_03043643.1| phage lysozyme [Escherichia coli E22]
 gi|194437502|ref|ZP_03069599.1| phage lysozyme [Escherichia coli 101-1]
 gi|209917780|ref|YP_002291864.1| putative phage lysozyme [Escherichia coli SE11]
 gi|253774457|ref|YP_003037288.1| Lysozyme [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254160623|ref|YP_003043731.1| putative lysozyme [Escherichia coli B str. REL606]
 gi|297520584|ref|ZP_06938970.1| predicted lysozyme [Escherichia coli OP50]
 gi|301018412|ref|ZP_07182876.1| phage lysozyme [Escherichia coli MS 196-1]
 gi|115512738|gb|ABJ00813.1| phage-related lysozyme (muraminidase) [Escherichia coli APEC O1]
 gi|192931671|gb|EDV84271.1| phage lysozyme [Escherichia coli E22]
 gi|194423671|gb|EDX39661.1| phage lysozyme [Escherichia coli 101-1]
 gi|209911039|dbj|BAG76113.1| putative phage lysozyme [Escherichia coli SE11]
 gi|253325501|gb|ACT30103.1| Lysozyme [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972524|gb|ACT38195.1| predicted lysozyme [Escherichia coli B str. REL606]
 gi|253976734|gb|ACT42404.1| predicted lysozyme [Escherichia coli BL21(DE3)]
 gi|284921245|emb|CBG34311.1| phage lysozome [Escherichia coli 042]
 gi|299882500|gb|EFI90711.1| phage lysozyme [Escherichia coli MS 196-1]
 gi|313848561|emb|CAQ31030.2| DLP12 prophage; lysozyme [Escherichia coli BL21(DE3)]
 gi|323963271|gb|EGB58836.1| phage lysozyme [Escherichia coli H489]
          Length = 165

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|71900872|ref|ZP_00682988.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71901913|ref|ZP_00683969.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71902261|ref|ZP_00684261.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71727989|gb|EAO30206.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71728315|gb|EAO30490.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71729343|gb|EAO31458.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 166

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 79/143 (55%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    GGA TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGGALTIGYGETGKHVTPDMCLANEQEADAMLRA-----RLA 62

Query: 93  LESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST  ++++A D   AA++   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAQQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIIRRAAE-RVLFE 144


>gi|227327822|ref|ZP_03831846.1| lysozyme [Pectobacterium carotovorum subsp. carotovorum WPP14]
          Length = 153

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 84/151 (55%), Gaps = 10/151 (6%)

Query: 26  IP--VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDF 80
           IP  +  A + ++K FEGL+LT YRD  G  WTIGYGH      +   G+T+ E    D 
Sbjct: 4   IPDTINEAGLSLIKSFEGLKLTKYRDTAG-KWTIGYGHLILPNENFDNGITLQEA---DS 59

Query: 81  LLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
           LL+   K+    ++    +   + N+  A+  F +NLG+ +   ST  + ++  D+  AA
Sbjct: 60  LLRQDLKTAEAGVQHYVTV-DLNGNQFGALTSFTYNLGVNSLKTSTLLRLLNQGDYATAA 118

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           ++  +W K G +V+ GL++RR+AE  L L++
Sbjct: 119 DQFPRWDKDGQQVVEGLLRRREAEKALFLQA 149


>gi|71276705|ref|ZP_00652974.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71901937|ref|ZP_00683991.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71162497|gb|EAO12230.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71728297|gb|EAO30474.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 164

 Score = 82.8 bits (203), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 76/141 (53%), Gaps = 11/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    GGA TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGGALTIGYGETGKHVTPDMCLANEQEADAMLR-----ARLA 62

Query: 93  LESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST  ++++A D   AA++   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAQQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
            AGG+V  GL+ RR AE  L 
Sbjct: 123 WAGGRVQSGLIIRRAAERALF 143


>gi|333010109|gb|EGK29544.1| lysozyme [Shigella flexneri K-272]
 gi|333021061|gb|EGK40318.1| lysozyme [Shigella flexneri K-227]
          Length = 165

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  W + +GHTG D+  G T TE E +  L KD    + +  + +P 
Sbjct: 34  LEGVSYIPYKDIIG-VWAVCHGHTGKDIMPGKTYTEAECKALLNKDL---VTVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|262372904|ref|ZP_06066183.1| lysozyme [Acinetobacter junii SH205]
 gi|262312929|gb|EEY94014.1| lysozyme [Acinetobacter junii SH205]
          Length = 187

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 84/145 (57%), Gaps = 13/145 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASK- 87
           I ++  FE  +L AY D G G WTIG G T    G  V +G   T  +A+++   D  + 
Sbjct: 48  IDLISSFEDTKLQAYDD-GVGVWTIGIGTTVYPNGVKVKKGDKCTLDQAKEYFAHDLKRF 106

Query: 88  --SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
             S+N L++        ++N+  A+   V+N+G   ++ ST  ++++A+D++ AA++  +
Sbjct: 107 ESSVNNLVKVP-----LTQNQFDALVSLVYNIGQTAFSNSTLLKKLNAKDYQGAADQFLR 161

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLE 170
           W K GGKV+ GLV+RR+AE  L L+
Sbjct: 162 WNKGGGKVMKGLVRRREAERVLFLK 186


>gi|166368768|ref|YP_001661041.1| lysozyme [Microcystis aeruginosa NIES-843]
 gi|166091141|dbj|BAG05849.1| probable lysozyme [Microcystis aeruginosa NIES-843]
          Length = 504

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/152 (35%), Positives = 85/152 (55%), Gaps = 17/152 (11%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLK 83
           V    I ++K++EG +LTAY+    G WTIG G T    G  V EG  IT+++AE FL+ 
Sbjct: 3   VSQNCIDLIKKWEGCKLTAYK-CPAGVWTIGIGTTCYPDGRRVREGDKITDQQAEGFLVN 61

Query: 84  DA---SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
           +    +K+++ L+          +N+  A+  F +N+GIG + +ST +++++ +D+E AA
Sbjct: 62  ECEEKAKAVDELVNVD-----LHQNQFDALVSFAYNVGIGAFKESTLRRKLNEKDYEGAA 116

Query: 141 EECKKWTKAGGK----VLPGLVKRRDAEVKLL 168
            E K+W KA       VL GL  RR  E  L 
Sbjct: 117 NEFKRWNKATVNGVQVVLEGLTNRRKDEEALF 148


>gi|300742359|ref|ZP_07072380.1| phage lysozyme [Rothia dentocariosa M567]
 gi|300381544|gb|EFJ78106.1| phage lysozyme [Rothia dentocariosa M567]
          Length = 155

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 76/146 (52%), Gaps = 10/146 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT-------GSDVTEGMTITEKEAEDFLLKDA 85
           I  LKE EG R  AY D+ G   TIGYGH+          + EG  ITE+E E  L  D 
Sbjct: 9   IAFLKEKEGFRSDAYYDVAG-VLTIGYGHSIYAPSIEEYPIHEGQHITEEEGEKILRADL 67

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
             +  ++  +S   +  ++ +  A+  F FNLG G +  S   +  +  +++ AA+   +
Sbjct: 68  KPTEAVV--NSAVTREITQKQYDALVSFTFNLGAGTFKSSDVLELTNQGNYQAAADALLQ 125

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLES 171
           ++ AGG+ +PGL KRR+ E  + L S
Sbjct: 126 YSHAGGEFIPGLYKRREEEKAMYLSS 151


>gi|227112570|ref|ZP_03826226.1| lysozyme [Pectobacterium carotovorum subsp. brasiliensis PBR1692]
          Length = 153

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 84/151 (55%), Gaps = 10/151 (6%)

Query: 26  IP--VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDF 80
           IP  +  A + ++K FEGL+LT YRD  G  WTIGYGH      +   G+T+ E    D 
Sbjct: 4   IPGTINEAGLSLIKSFEGLKLTKYRDTAG-KWTIGYGHLILPNENFDNGITLQEA---DL 59

Query: 81  LLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
           LL+   K+    ++    +   + N+  A+  F +NLG+ +   ST  + ++  D+  AA
Sbjct: 60  LLRQDLKTAEAGVQHYVNV-DLNGNQFGALTSFTYNLGVNSLKTSTLLRLLNQGDYAGAA 118

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           ++  +W K G +V+ GL++RR+AE  L L++
Sbjct: 119 DQFPRWDKDGEQVVEGLLRRREAEKALFLQA 149


>gi|320659108|gb|EFX26707.1| lysozyme-like protein [Escherichia coli O55:H7 str. USDA 5905]
          Length = 131

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/131 (35%), Positives = 74/131 (56%), Gaps = 5/131 (3%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P +
Sbjct: 1   EGVSYIPYKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPYI 56

Query: 100 K-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
                E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+
Sbjct: 57  NVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLM 116

Query: 159 KRRDAEVKLLL 169
            RR+ E ++ L
Sbjct: 117 TRREIEREVCL 127


>gi|309797033|ref|ZP_07691432.1| phage lysozyme [Escherichia coli MS 145-7]
 gi|308119316|gb|EFO56578.1| phage lysozyme [Escherichia coli MS 145-7]
          Length = 165

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIIPGKTYTEAECKALLNKDLAM---VARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++W  AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWAYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|332343001|gb|AEE56335.1| conserved hypothetical protein [Escherichia coli UMNK88]
          Length = 163

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 48/131 (36%), Positives = 69/131 (52%), Gaps = 5/131 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+K  EG+    YRD+ G  WT+ YGHTG D+  G T T+ E +  L KD  K+   +  
Sbjct: 25  MVKPLEGVEYDPYRDVIG-VWTVCYGHTGKDIMLGKTYTQSECDALLNKDLHKTAKAI-- 81

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
             P +K   S+    A+  F +N+G  N+  ST  + ++     +A  + K+W  AGGK 
Sbjct: 82  -DPYIKVEISDFTRAALYSFAYNVGATNFKTSTLLKLLNDGKKSEACAQLKRWVYAGGKK 140

Query: 154 LPGLVKRRDAE 164
             GLV RRD E
Sbjct: 141 WQGLVNRRDVE 151


>gi|325122621|gb|ADY82144.1| putative lysozyme from bacteriophage [Acinetobacter calcoaceticus
           PHEA-2]
          Length = 190

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 54/147 (36%), Positives = 84/147 (57%), Gaps = 15/147 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL---LKDA 85
           +  +  FEGLRL+AY D G G W+IGYG T    G  V +G T T ++A+ ++   LK  
Sbjct: 51  VNSICNFEGLRLSAYDD-GVGVWSIGYGTTRYPNGLSVQKGDTCTLEQAKAYMQHDLKIF 109

Query: 86  SKSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            +++N       A+K   ++N+   +    +N+G G + KST  +++++ D++ AA +  
Sbjct: 110 ERAVN------GAVKVPLTQNQFDTLVSLSYNIGAGAFKKSTLLKKLNSGDYKGAANQFD 163

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLES 171
            W  AGGK L GLV+RR  E KL L S
Sbjct: 164 VWVNAGGKRLAGLVRRRAIEKKLFLGS 190


>gi|218704641|ref|YP_002412160.1| putative lysozyme; DLP12 prophage [Escherichia coli UMN026]
 gi|293404523|ref|ZP_06648517.1| lysozyme lambdoid prophage DLP12 [Escherichia coli FVEC1412]
 gi|298380299|ref|ZP_06989904.1| lysozyme [Escherichia coli FVEC1302]
 gi|300895778|ref|ZP_07114368.1| phage lysozyme [Escherichia coli MS 198-1]
 gi|218431738|emb|CAR12620.1| putative lysozyme; DLP12 prophage [Escherichia coli UMN026]
 gi|291429109|gb|EFF02134.1| lysozyme lambdoid prophage DLP12 [Escherichia coli FVEC1412]
 gi|298279997|gb|EFI21505.1| lysozyme [Escherichia coli FVEC1302]
 gi|300360302|gb|EFJ76172.1| phage lysozyme [Escherichia coli MS 198-1]
          Length = 165

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|307138013|ref|ZP_07497369.1| predicted lysozyme [Escherichia coli H736]
 gi|331641936|ref|ZP_08343071.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H736]
 gi|331038734|gb|EGI10954.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H736]
          Length = 165

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E    L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECNALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|16128538|ref|NP_415087.1| DLP12 prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. MG1655]
 gi|89107420|ref|AP_001200.1| predicted lysozyme [Escherichia coli str. K-12 substr. W3110]
 gi|170080136|ref|YP_001729456.1| DLP12 prophage; lysozyme [Escherichia coli str. K-12 substr. DH10B]
 gi|170080237|ref|YP_001729557.1| DLP12 prophage; lysozyme [Escherichia coli str. K-12 substr. DH10B]
 gi|193063347|ref|ZP_03044437.1| phage lysozyme [Escherichia coli E22]
 gi|194428007|ref|ZP_03060552.1| phage lysozyme [Escherichia coli B171]
 gi|238899833|ref|YP_002925629.1| DLP12 prophage; putative lysozyme [Escherichia coli BW2952]
 gi|260842753|ref|YP_003220531.1| putative endolysin protein [Escherichia coli O103:H2 str. 12009]
 gi|301325809|ref|ZP_07219251.1| phage lysozyme [Escherichia coli MS 78-1]
 gi|332288002|ref|YP_004169188.1| lysozyme [Bacillus thuringiensis CT43]
 gi|2493335|sp|P78285|LYSD_ECOLI RecName: Full=Probable lysozyme from lambdoid prophage DLP12;
           AltName: Full=Endolysin; AltName: Full=Lysis protein;
           AltName: Full=Muramidase
 gi|1778468|gb|AAB40751.1| hypothetical protein [Escherichia coli]
 gi|1786768|gb|AAC73656.1| DLP12 prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. MG1655]
 gi|85674690|dbj|BAE76330.1| predicted lysozyme [Escherichia coli str. K12 substr. W3110]
 gi|169887971|gb|ACB01678.1| DLP12 prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. DH10B]
 gi|169888072|gb|ACB01779.1| DLP12 prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. DH10B]
 gi|192930931|gb|EDV83535.1| phage lysozyme [Escherichia coli E22]
 gi|194413982|gb|EDX30259.1| phage lysozyme [Escherichia coli B171]
 gi|238860799|gb|ACR62797.1| DLP12 prophage; predicted lysozyme [Escherichia coli BW2952]
 gi|257757900|dbj|BAI29397.1| putative endolysin protein [Escherichia coli O103:H2 str. 12009]
 gi|260450279|gb|ACX40701.1| Lysozyme [Escherichia coli DH1]
 gi|300847407|gb|EFK75167.1| phage lysozyme [Escherichia coli MS 78-1]
 gi|315135220|dbj|BAJ42379.1| DLP12 prophage; putative lysozyme [Escherichia coli DH1]
 gi|315273074|gb|ADU03143.1| lysozyme [Bacillus thuringiensis serovar chinensis CT-43]
 gi|320172934|gb|EFW48163.1| putative lysozyme from lambdoid prophage DLP12 [Shigella
           dysenteriae CDC 74-1112]
 gi|320201445|gb|EFW76025.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           EC4100B]
 gi|323160837|gb|EFZ46764.1| lysozyme [Escherichia coli E128010]
 gi|332083725|gb|EGI88943.1| lysozyme [Shigella dysenteriae 155-74]
          Length = 165

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|332710934|ref|ZP_08430870.1| phage-related lysozyme/muraminidase [Lyngbya majuscula 3L]
 gi|332350248|gb|EGJ29852.1| phage-related lysozyme/muraminidase [Lyngbya majuscula 3L]
          Length = 264

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 84/149 (56%), Gaps = 11/149 (7%)

Query: 28  VPNALIKMLKEFEGL-------RLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDF 80
           +  A + ++KEFEGL       R+ AY D   G  TIG+GHT   V  G  IT ++ E  
Sbjct: 119 INQAGLDLVKEFEGLHKRCPDGRVEAYID-PVGIPTIGWGHTAG-VRIGDIITVEQGEKL 176

Query: 81  LLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
           L +D   S + +  S+    S ++N+  A+  FVFN+G   + +ST  ++++  D + AA
Sbjct: 177 LRQDLESSESTV--SNLVKVSLTDNQFSALVSFVFNIGPTAFRRSTLLRKLNHGDDQGAA 234

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            E  +W K GG+VL GL KRR+AE KL L
Sbjct: 235 NEFLRWNKGGGRVLLGLSKRREAERKLFL 263


>gi|262367961|pdb|3HDF|A Chain A, Crystal Structure Of Truncated Endolysin R21 From Phage 21
 gi|262367962|pdb|3HDF|B Chain B, Crystal Structure Of Truncated Endolysin R21 From Phage 21
          Length = 140

 Score = 82.4 bits (202), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 9   LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 64

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 65  IKVDIPETMRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 124

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 125 MTRREIEREICL 136


>gi|191166535|ref|ZP_03028364.1| phage lysozyme [Escherichia coli B7A]
 gi|260853778|ref|YP_003227669.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|190903340|gb|EDV63060.1| phage lysozyme [Escherichia coli B7A]
 gi|257752427|dbj|BAI23929.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|320196967|gb|EFW71586.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           WV_060327]
 gi|323153363|gb|EFZ39619.1| lysozyme [Escherichia coli EPECa14]
 gi|324116799|gb|EGC10713.1| phage lysozyme [Escherichia coli E1167]
          Length = 165

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 74/134 (55%), Gaps = 9/134 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD    ++ +N  +E 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLATVARQINPYIEV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   
Sbjct: 93  D-----IPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWK 147

Query: 156 GLVKRRDAEVKLLL 169
           GL+ RR+ E ++ L
Sbjct: 148 GLMTRREIEREICL 161


>gi|323175054|gb|EFZ60668.1| lysozyme [Escherichia coli LT-68]
          Length = 165

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+    T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPSKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|295314798|gb|ADF97549.1| PlyM24 [uncultured phage]
          Length = 181

 Score = 82.0 bits (201), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/149 (32%), Positives = 85/149 (57%), Gaps = 7/149 (4%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL 81
           + V  A I ++ +FEGLRL +Y D G G WTIG+G T    G  V +G  IT ++A+ + 
Sbjct: 36  MKVDAAGIDLIGQFEGLRLNSYDD-GVGVWTIGWGTTVYPNGQKVKKGDKITLEQAKQYK 94

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE 141
             D +K    + ++       ++N+  A+    +N+G+  ++ ST  +R++  +++ AA+
Sbjct: 95  AHDLAKFEKAVNDAVKV--PLNQNQFNALVSLAYNIGVSAFSNSTLVKRLNEGNYKAAAD 152

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +   W  AGGK + GLV RR+ E +L L+
Sbjct: 153 QFLVWVNAGGKRMQGLVNRRNKERELFLK 181


>gi|193066513|ref|ZP_03047556.1| phage lysozyme [Escherichia coli E22]
 gi|215486366|ref|YP_002328797.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|312966343|ref|ZP_07780568.1| lysozyme [Escherichia coli 2362-75]
 gi|192925835|gb|EDV80486.1| phage lysozyme [Escherichia coli E22]
 gi|215264438|emb|CAS08798.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|312289008|gb|EFR16903.1| lysozyme [Escherichia coli 2362-75]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  INVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|260856241|ref|YP_003230132.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257754890|dbj|BAI26392.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 73/134 (54%), Gaps = 9/134 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+    Y DI G  WT+ +GHTG D+  G T T+ E +  L KD    ++ +N  +E 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIIPGKTYTKAECKALLNKDLATVARQINPYIEV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   
Sbjct: 93  D-----IPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWK 147

Query: 156 GLVKRRDAEVKLLL 169
           GL+ RR+ E ++ L
Sbjct: 148 GLMTRREIEREICL 161


>gi|194430541|ref|ZP_03063009.1| phage lysozyme [Escherichia coli B171]
 gi|194411410|gb|EDX27764.1| phage lysozyme [Escherichia coli B171]
          Length = 165

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  INVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|284009212|emb|CBA76291.1| phage lysin protein; endolysin [Arsenophonus nasoniae]
          Length = 155

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 71/132 (53%), Gaps = 7/132 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEGL+L  Y D GGG  ++ +GHTG D+      ++ E E +L  D    L  + +
Sbjct: 21  MIMHFEGLKLAPYFD-GGGVLSVCFGHTGKDIKPNSIYSKAECEQWLNSD----LQTVKK 75

Query: 95  SSPALKSTSENRLV--AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               L     N L   A+  FV+N+GIGN+ +ST  ++++A D + A E  K+W   G +
Sbjct: 76  QVDPLIQVKVNTLTQAAIYSFVYNVGIGNFQRSTLLKKLNANDLDGACEAMKQWVYVGKE 135

Query: 153 VLPGLVKRRDAE 164
              GL+ RR+ E
Sbjct: 136 KWQGLMTRREIE 147


>gi|288957185|ref|YP_003447526.1| lysozyme [Azospirillum sp. B510]
 gi|288909493|dbj|BAI70982.1| lysozyme [Azospirillum sp. B510]
          Length = 164

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 83/151 (54%), Gaps = 14/151 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD-- 84
           PV  A + ++K FEGL L AY     G  TIGYGHT + V  G TIT ++A+ FL  D  
Sbjct: 5   PVCQAAVDLVKHFEGLYLDAYL-CPAGVPTIGYGHT-AGVEMGQTITVEQADAFLASDLT 62

Query: 85  -ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
            A+  ++ L+       + +E++  A+A FVFNLG G+   ST  + +++ D+  AA + 
Sbjct: 63  AAAGHVDALVT-----VALNEDQRGALASFVFNLGAGSLESSTLLRLLNSGDYAGAAGQF 117

Query: 144 KKWTKA---GGKV-LPGLVKRRDAEVKLLLE 170
            +W  A   G    LPGLV RR AE  L + 
Sbjct: 118 GRWVYATVNGTPTRLPGLVARRAAEEALFVS 148


>gi|324114275|gb|EGC08246.1| phage lysozyme [Escherichia fergusonii B253]
          Length = 167

 Score = 82.0 bits (201), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 36  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 91

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++W  AGGK   GL
Sbjct: 92  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWAYAGGKQWKGL 151

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 152 MTRREIEREVCL 163


>gi|309704855|emb|CBJ04207.1| phage lysozome [Escherichia coli ETEC H10407]
          Length = 165

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++W  AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWIYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|324117945|gb|EGC11844.1| phage lysozyme [Escherichia coli E1167]
          Length = 165

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++W  AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWIYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|91214057|ref|YP_544043.1| bacteriophage lambda lysozyme-like protein [Escherichia coli UTI89]
 gi|91075631|gb|ABE10512.1| bacteriophage lambda lysozyme-like protein [Escherichia coli UTI89]
 gi|315614570|gb|EFU95213.1| lysozyme [Escherichia coli 3431]
          Length = 165

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++W  AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWIYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|85059622|ref|YP_455324.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84780142|dbj|BAE74919.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 149

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 73/129 (56%), Gaps = 3/129 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  E +  T YRD  GG  ++ YGHTGSD+  G   T  E +  L  D   +++++  
Sbjct: 24  LIQWHESVHYTPYRD-SGGVLSVCYGHTGSDIVPGKRYTVAECQALLDSDLKAAMSVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E++  A+A FV+N+G G + +ST  ++++A D   A +E ++W   GGKV 
Sbjct: 81  DANVTVPLTESQRAALASFVYNVGNGAFARSTLLKKLNAGDMAGACDEMRRWKYVGGKVS 140

Query: 155 PGLVKRRDA 163
            GLV RR A
Sbjct: 141 KGLVNRRYA 149


>gi|332089990|gb|EGI95090.1| lysozyme [Shigella boydii 5216-82]
          Length = 165

 Score = 81.6 bits (200), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  S   ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSMLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|264679687|ref|YP_003279594.1| glycoside hydrolase, family 24 [Comamonas testosteroni CNB-2]
 gi|262210200|gb|ACY34298.1| glycoside hydrolase, family 24 [Comamonas testosteroni CNB-2]
          Length = 156

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/135 (35%), Positives = 74/135 (54%), Gaps = 4/135 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + +++++EG  L +YRD  G   T   GHTG ++  G T T ++ E+ L KD +K  + L
Sbjct: 20  VPLVQKYEGTVLRSYRDPVG-IITACTGHTGPELKMGQTYTREQCEEMLYKDLAKHADAL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              S      ++ +  A   F FN+G   + +ST  ++ +A D+  A  E  +W  A GK
Sbjct: 79  ---SCVRAPLTDGQRAAFLSFAFNVGDDAFCRSTLVRKANAGDFGGACAELSRWIYASGK 135

Query: 153 VLPGLVKRRDAEVKL 167
            LPGLVKRR AE +L
Sbjct: 136 ELPGLVKRRAAERQL 150


>gi|273810445|ref|YP_003344916.1| SAR endolysin [Xylella phage Xfas53]
 gi|257097820|gb|ACV41126.1| SAR endolysin [Xylella phage Xfas53]
          Length = 163

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 71/138 (51%), Gaps = 13/138 (9%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+ ++EG++   Y+DI G  WT+ YGHTG+DV  G T T+ E E  L +D       +LE
Sbjct: 26  MIAKWEGVKHRPYKDIVG-VWTVCYGHTGADVVHGKTYTQAECEALLQRD-------MLE 77

Query: 95  SSPALKSTSENRL-----VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           +S  ++      +      A+    FN+G      ST +++  A DW  A  E  +W  A
Sbjct: 78  ASGYVRRCITVPMFPHVEAALVSATFNIGPKVVCGSTLQRKALANDWPGACAELARWKHA 137

Query: 150 GGKVLPGLVKRRDAEVKL 167
           GG+ + GL  RRD E  L
Sbjct: 138 GGRGIRGLTLRRDDEQAL 155


>gi|91224316|ref|ZP_01259578.1| putative lysozyme [Vibrio alginolyticus 12G01]
 gi|91190658|gb|EAS76925.1| putative lysozyme [Vibrio alginolyticus 12G01]
          Length = 159

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 74/138 (53%), Gaps = 9/138 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNL 91
           M+K  EG+R T Y D+ G   T+ YGHTG+ +      ++ E ++ L   L D  + ++ 
Sbjct: 25  MVKPMEGVRYTPYIDVAG-VQTVCYGHTGAGIISDKVYSQAECDELLESDLADVKRMVDP 83

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           ++          E    A+  F FN+GIG++++ST  + ++  +W  A ++ K+W  A G
Sbjct: 84  MIHVD-----IPETTRAALYSFTFNVGIGSFSRSTLLKLLNKGEWYAACDQLKRWVYAAG 138

Query: 152 KVLPGLVKRRDAEVKLLL 169
           K   GL+ RRD E ++ L
Sbjct: 139 KPWKGLMNRRDIEREVCL 156


>gi|218553327|ref|YP_002386240.1| putative lysozyme; DLP12 prophage [Escherichia coli IAI1]
 gi|218360095|emb|CAQ97642.1| putative lysozyme; DLP12 prophage [Escherichia coli IAI1]
 gi|323938512|gb|EGB34763.1| phage lysozyme [Escherichia coli E1520]
          Length = 165

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 75/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYLFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|323169696|gb|EFZ55362.1| lysozyme [Shigella sonnei 53G]
          Length = 165

 Score = 81.3 bits (199), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++    + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGYIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|299534293|ref|ZP_07047642.1| glycoside hydrolase, family 24 [Comamonas testosteroni S44]
 gi|298717751|gb|EFI58759.1| glycoside hydrolase, family 24 [Comamonas testosteroni S44]
          Length = 156

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/134 (35%), Positives = 71/134 (52%), Gaps = 4/134 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++ +EG   + YRD  G   T   GHTG ++  G T T ++ ED L KD +K  + L  
Sbjct: 22  LVQHYEGTVFSTYRDPVG-IITACTGHTGPELKMGQTYTREQCEDMLYKDLAKHADALNC 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
               L   ++ +  A   F FN+G   + +ST  ++ +A D   A  E  +WT A GK L
Sbjct: 81  VRAPL---TDGQRAAFLSFAFNVGDDAFCRSTLVRKANAGDINGACAELSRWTYASGKQL 137

Query: 155 PGLVKRRDAEVKLL 168
           PGLV+RR AE +L 
Sbjct: 138 PGLVRRRAAERQLC 151


>gi|239815475|ref|YP_002944385.1| glycoside hydrolase family 24 [Variovorax paradoxus S110]
 gi|239802052|gb|ACS19119.1| glycoside hydrolase family 24 [Variovorax paradoxus S110]
          Length = 166

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 50/141 (35%), Positives = 76/141 (53%), Gaps = 11/141 (7%)

Query: 35  MLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAE----DFLLKDASKS 88
           ++  FE  RL AY D   GG  WTIG+G TG DV  G+ IT++EA+    + L ++    
Sbjct: 15  IMHYFEQCRLEAYPDPGTGGAPWTIGWGDTGPDVVPGLVITQEEADQRYANRLHREFEPG 74

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
           +  LL+  P     ++ +  A+    +N+G+ N+  ST  ++ +  D   AA+    W K
Sbjct: 75  VVDLLQREP-----TQAQFDALVSLAYNIGLANFRGSTVLRKFNQGDDIGAADAILMWNK 129

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           AGGKV+ GL +RR AE    L
Sbjct: 130 AGGKVMLGLKRRRTAERARFL 150


>gi|253686981|ref|YP_003016171.1| Lysozyme [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|251753559|gb|ACT11635.1| Lysozyme [Pectobacterium carotovorum subsp. carotovorum PC1]
          Length = 153

 Score = 81.3 bits (199), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 79/144 (54%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKDASK 87
           A + ++K FEGL+LT YRD  G  WTIGYGH      +   G  IT +EA+  L +D   
Sbjct: 11  AGLSLIKSFEGLKLTKYRDTAG-KWTIGYGHLILPNENFDNG--ITPQEADLLLRQDLKT 67

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           + N +          + N+  A+  F +NLG+ +   ST  + ++  D+  AA +  +W 
Sbjct: 68  AENGVQHYVNV--DLNGNQFGALTSFTYNLGVNSLKTSTLLRLLNQGDYVGAAAQFPRWD 125

Query: 148 KAGGKVLPGLVKRRDAEVKLLLES 171
           K G +V+ GL++RR+AE  L L+S
Sbjct: 126 KDGEQVVEGLLRRREAEKALFLQS 149


>gi|284008326|emb|CBA74698.1| phage lysin protein; endolysin [Arsenophonus nasoniae]
          Length = 151

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 71/133 (53%), Gaps = 3/133 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EGLR   Y+D GGG  T+ YGHTG DV  G   TE+E +  L  D   +++ +  
Sbjct: 16  LIQWHEGLRYRPYKD-GGGVLTVCYGHTGKDVIAGKRYTEEECQKLLDADLRNAIDTVES 74

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           S     ST +    A+A FV+N+G   +  ST  ++++A D +    E  +W    GKV 
Sbjct: 75  SVKVPLSTIQK--AALASFVYNVGNTAFANSTLLKKLNAGDIQGVCNEMHRWKYTDGKVS 132

Query: 155 PGLVKRRDAEVKL 167
            GL+ RR  E +L
Sbjct: 133 KGLINRRKVEQEL 145


>gi|288961413|ref|YP_003451752.1| lysozyme [Azospirillum sp. B510]
 gi|288913721|dbj|BAI75208.1| lysozyme [Azospirillum sp. B510]
          Length = 174

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 81/146 (55%), Gaps = 8/146 (5%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           P+  A I+++K FEGL L AY     G  TIGYGHT + V+ G  IT ++AE  L  D +
Sbjct: 9   PICKAAIELVKHFEGLSLDAYL-CPAGIPTIGYGHT-AGVSLGQRITAEKAEALLADDLA 66

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            +   +      +  T   R  A+A FVFNLG GN+  ST  +R++  D E AA E  +W
Sbjct: 67  AAAAAVDALV-TVPLTGGQR-GALASFVFNLGRGNFQSSTLLKRLNGGDPEGAAGEFGRW 124

Query: 147 TKA---GGKV-LPGLVKRRDAEVKLL 168
             A   G K  LPGLVKRR+AE  L 
Sbjct: 125 VNATVQGRKTKLPGLVKRREAETLLF 150


>gi|156934899|ref|YP_001438815.1| hypothetical protein ESA_02747 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533153|gb|ABU77979.1| hypothetical protein ESA_02747 [Cronobacter sakazakii ATCC BAA-894]
          Length = 167

 Score = 80.9 bits (198), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 48/133 (36%), Positives = 74/133 (55%), Gaps = 9/133 (6%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLESS 96
           EG +  AY+D+ G  WT+  GHTG+D+  G T T+KE +  L KD   A  +++ L++  
Sbjct: 34  EGRKYQAYKDVAG-VWTVCDGHTGNDIIRGKTYTDKECDRLLWKDLQPAKATVDKLVKVP 92

Query: 97  PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPG 156
                 SE +  ++  FVFN+G   + KST  ++++  D E A EE ++W  AGG    G
Sbjct: 93  -----LSEYQRASLYSFVFNVGSDAFAKSTLLRKLNKGDQEGACEEMRRWVYAGGMKWKG 147

Query: 157 LVKRRDAEVKLLL 169
           L  RR+ E  + L
Sbjct: 148 LQNRREMERSMCL 160


>gi|237746184|ref|ZP_04576664.1| glycoside hydrolase [Oxalobacter formigenes HOxBLS]
 gi|229377535|gb|EEO27626.1| glycoside hydrolase [Oxalobacter formigenes HOxBLS]
          Length = 177

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 48/129 (37%), Positives = 73/129 (56%), Gaps = 4/129 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY+D   G  T+GYG T + V  G   T + A   LLK   K  + + +    
Sbjct: 47  HEGYRDKAYKD-AVGVPTVGYGET-AGVRIGDRTTPERALVQLLKSTEKHADAIRQCIHV 104

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
                ++   A     +N+G GN+ +ST  ++++A+D+  A +E K+W +AGGKVLPGLV
Sbjct: 105 --PLYQHEFDAYVSLAYNIGAGNFCRSTLVKKLNAKDYAGACQEIKRWGRAGGKVLPGLV 162

Query: 159 KRRDAEVKL 167
           KRR+AE ++
Sbjct: 163 KRREAEYRM 171


>gi|332305884|ref|YP_004433735.1| glycoside hydrolase family 24 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|332173213|gb|AEE22467.1| glycoside hydrolase family 24 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 182

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 54/140 (38%), Positives = 76/140 (54%), Gaps = 6/140 (4%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
            A I ++KE EG+RL AYR    G W IGYGH  + V +GM I   +AE FL  D    L
Sbjct: 46  QACIDIIKESEGVRLKAYRG-PAGHWLIGYGHK-AGVKQGMEINAPQAEVFLKNDL---L 100

Query: 90  NLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            +  + S  +K   + N+  A+    +N+G+GN  KST  + ++  D+  A+++   W K
Sbjct: 101 KIEEQMSKLVKVPVNNNQFSALVCLGYNIGMGNLYKSTLLRLLNKGDYTGASDQFSVWRK 160

Query: 149 AGGKVLPGLVKRRDAEVKLL 168
           A GKV   LVKRR  E  L 
Sbjct: 161 AAGKVNAHLVKRRAKEKSLF 180


>gi|300935515|ref|ZP_07150509.1| phage lysozyme [Escherichia coli MS 21-1]
 gi|300459314|gb|EFK22807.1| phage lysozyme [Escherichia coli MS 21-1]
          Length = 163

 Score = 80.9 bits (198), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 47/131 (35%), Positives = 68/131 (51%), Gaps = 5/131 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+K  EG+    YRD   G WT+ YGHTG D+  G T T+ E +  L KD  K+   +  
Sbjct: 25  MVKPLEGVEYDPYRD-AIGVWTVCYGHTGKDIMLGKTYTQSECDALLNKDLHKTAKAI-- 81

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
             P +K   S+    A+  F +N+G  N+  ST  + ++     +A  + K+W  AGGK 
Sbjct: 82  -DPYIKVEISDFTRAALYSFAYNVGATNFKTSTLLKLLNDGKKSEACAQLKRWIYAGGKQ 140

Query: 154 LPGLVKRRDAE 164
             GL+ RRD E
Sbjct: 141 WQGLINRRDVE 151


>gi|170730307|ref|YP_001775740.1| phage-related lysozyme [Xylella fastidiosa M12]
 gi|167965100|gb|ACA12110.1| phage-related lysozyme [Xylella fastidiosa M12]
          Length = 166

 Score = 80.9 bits (198), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 78/143 (54%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L+ Y    GG  TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGCKLSPY-TCSGGVLTIGYGETGKHVTPDMCLANEQEADAILRA-----RLA 62

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G+G +++ST  ++++A D   AAE+   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIIRRAAE-RVLFE 144


>gi|126601|sp|P10439|LYS_BPPA2 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|67435|pir||WMBPP2 lysozyme (EC 3.2.1.17) - phage PA2
 gi|215368|gb|AAA32300.1| ORF2 [Enterobacteria phage PA-2]
          Length = 165

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E     +  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETTRGPLYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|288549804|ref|ZP_05968220.2| lysozyme [Enterobacter cancerogenus ATCC 35316]
 gi|288317454|gb|EFC56392.1| lysozyme [Enterobacter cancerogenus ATCC 35316]
          Length = 164

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 69/127 (54%), Gaps = 5/127 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY+D+ G  WT+  GHTG+D+  G   T+KE ++ L  D  K  N +    P 
Sbjct: 33  LEGRRYYAYQDVVG-VWTVCDGHTGADIRRGHRYTDKECDNLLKADLRKVANAI---DPL 88

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  F +N+G G +  ST  ++++  D   A +E ++WT AGGK   GL
Sbjct: 89  IKVRIPEPTRAALYSFTYNVGSGAFASSTLLKKLNGGDLPGACKELQRWTYAGGKQWKGL 148

Query: 158 VKRRDAE 164
           + RR+ E
Sbjct: 149 ITRREIE 155


>gi|323153974|gb|EFZ40187.1| lysozyme [Escherichia coli EPECa14]
          Length = 158

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 70/129 (54%), Gaps = 9/129 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
            EG+    Y DI G  WT+ +GHTG D+  G T T+ E +  L KD    ++ +N  +E 
Sbjct: 34  LEGVSYIPYEDIVG-VWTVCHGHTGKDIIPGKTYTKAECKALLNKDLATVARQINPYIEV 92

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                   E    A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   
Sbjct: 93  D-----IPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWK 147

Query: 156 GLVKRRDAE 164
           GL+ RR+ E
Sbjct: 148 GLMTRREIE 156


>gi|91775174|ref|YP_544930.1| glycoside hydrolase family protein [Methylobacillus flagellatus KT]
 gi|91775318|ref|YP_545074.1| glycoside hydrolase family protein [Methylobacillus flagellatus KT]
 gi|91709161|gb|ABE49089.1| glycoside hydrolase, family 24 [Methylobacillus flagellatus KT]
 gi|91709305|gb|ABE49233.1| glycoside hydrolase, family 24 [Methylobacillus flagellatus KT]
          Length = 225

 Score = 80.5 bits (197), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 81/153 (52%), Gaps = 19/153 (12%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGG----------GAWTIGYGHTGSDVTEGMTITEKEAED 79
           N L K+ +E EGL+L  Y D  G          G  TIGYGH      +  TITE EA  
Sbjct: 78  NGLAKIKQE-EGLKLVRYDDATGQPLARGQKAKGYPTIGYGHKLGTFEDLWTITEAEATR 136

Query: 80  FL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW 136
            L   L DA  ++N L++        ++N+  A+  FVFN+G G +++ST  + ++A D+
Sbjct: 137 LLVSDLVDAESAVNRLVKVP-----LTQNQYDALVSFVFNVGSGAFSRSTLLKLLNAGDY 191

Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           + AA +   W  +GG V+ GLVKRR  E  L L
Sbjct: 192 QGAANQFPAWRMSGGVVMAGLVKRRANERALFL 224


>gi|23016141|ref|ZP_00055900.1| COG3772: Phage-related lysozyme (muraminidase) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 147

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 62/148 (41%), Positives = 84/148 (56%), Gaps = 11/148 (7%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +  A + + K+ EGLRL  Y     G  TIGYGHTG +VT+GM I E +AE  L  D + 
Sbjct: 5   INQAGLDLTKDSEGLRLKTYL-CPAGRLTIGYGHTGPNVTDGMVIDEAKAEALLAADLAH 63

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           +   ++++  A  S ++N+  A+ DFVFNLG G    ST  ++++A     AA+E  KW 
Sbjct: 64  AGEGVIKAVKA--SLNDNQYAALCDFVFNLGAGALAGSTLLKKLNAG----AADEFLKWD 117

Query: 148 KAG----GKVLPGLVKRRDAEVKLLLES 171
           KA      K LPGL KRR AE  L L S
Sbjct: 118 KATVDGVKKALPGLTKRRAAERTLFLTS 145


>gi|167042864|gb|ABZ07580.1| putative Phage lysozyme [uncultured marine microorganism
           HF4000_ANIW137K11]
          Length = 211

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 57/153 (37%), Positives = 81/153 (52%), Gaps = 19/153 (12%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGG----------GAWTIGYGHTGSDVTEGMTITEKEAED 79
           N L K+ +E EGL+L  Y D  G          G  TIGYGH      +  TITE EA  
Sbjct: 64  NGLAKIKQE-EGLKLVRYDDATGQPLARGQKAKGYPTIGYGHKLGTFEDLWTITEAEATR 122

Query: 80  FL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW 136
            L   L DA  ++N L++        ++N+  A+  FVFN+G G +++ST  + ++A D+
Sbjct: 123 LLVSDLVDAESAVNRLVKVP-----LTQNQYDALVSFVFNVGSGAFSRSTLLKLLNAGDY 177

Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           + AA +   W  +GG V+ GLVKRR  E  L L
Sbjct: 178 QGAANQFPAWRMSGGVVMAGLVKRRANERALFL 210


>gi|170730090|ref|YP_001775523.1| lysozyme [Xylella fastidiosa M12]
 gi|167964883|gb|ACA11893.1| Lysozyme [Xylella fastidiosa M12]
          Length = 164

 Score = 80.5 bits (197), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 78/141 (55%), Gaps = 11/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L++Y    GG  TIGYG TG+ V  G+ +T ++  D +L+       L 
Sbjct: 9   IALIKFFEGCKLSSY-TCPGGVLTIGYGETGNHVVPGLRLTNEQEADAMLRA-----RLA 62

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        +++  A+    FN+G G +++ST  ++++A D   AA++   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQHQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAQQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
            AGG+V  GL+ RR AE  L 
Sbjct: 123 WAGGRVQSGLIIRRAAERALF 143


>gi|168495156|ref|YP_001686894.1| Phage-related lysozyme [Azospirillum phage Cd]
 gi|168148915|emb|CAO99379.1| Phage-related lysozyme [Azospirillum phage Cd]
          Length = 148

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 58/149 (38%), Positives = 86/149 (57%), Gaps = 12/149 (8%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           PV  A + ++KE EGL LTAYR    G  ++G+GHT + V  G TI+  +AE +L  D +
Sbjct: 4   PVCPAALAIVKEAEGLYLTAYR-CPAGVPSVGWGHT-AGVKMGQTISRAQAEAYLAADMA 61

Query: 87  KSLNLL--LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
           ++   +  L   P     ++N+  A++ FV NLG GN  +ST  + ++ +D+  AA++  
Sbjct: 62  EAAAAVDRLVKVP----ITDNQRGALSSFVMNLGAGNLQESTLLRLLNQRDYAGAADQFG 117

Query: 145 KWTKA---GGKV-LPGLVKRRDAEVKLLL 169
           +W  A   G K  LPGLVKRR AE  L L
Sbjct: 118 RWVYATVNGVKTELPGLVKRRAAERALFL 146


>gi|311112287|ref|YP_003983509.1| phage lysozyme [Rothia dentocariosa ATCC 17931]
 gi|310943781|gb|ADP40075.1| phage lysozyme [Rothia dentocariosa ATCC 17931]
          Length = 155

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 50/149 (33%), Positives = 76/149 (51%), Gaps = 16/149 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-------DVTEGMTITEKEAEDFL---L 82
           I  L+E EG R  AY D+ G   TIGYGH+          V EG  ITE+E E+ L   L
Sbjct: 9   IAFLEEKEGFRSDAYYDVAG-VLTIGYGHSTRAPSIEQYPVYEGQHITEEEGEEILRADL 67

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           K    ++N     S   +  ++ +  A+  F FNLG G +  S   +  +  +++ A + 
Sbjct: 68  KPTEAAVN-----SAVTREITQKQYDALVSFTFNLGAGTFKSSDVLELTNKGNYQAAGDA 122

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
             +++ AGG+ +PGL KRR+ E  + L S
Sbjct: 123 MLQYSHAGGEFIPGLYKRREEERAMYLSS 151


>gi|262376006|ref|ZP_06069237.1| lysozyme [Acinetobacter lwoffii SH145]
 gi|262309100|gb|EEY90232.1| lysozyme [Acinetobacter lwoffii SH145]
          Length = 191

 Score = 80.1 bits (196), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 89/164 (54%), Gaps = 11/164 (6%)

Query: 11  VKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDV 66
           V  M+G+  D+    + +  + I +++ FE LRL AY D G G WTIGYG T       V
Sbjct: 35  VTSMLGIATDE----MSISPSGIDLIRNFESLRLNAYDD-GVGVWTIGYGTTKYLNAIRV 89

Query: 67  TEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST 126
            +G T T ++A+ ++  D  K    +  +S      ++N+  A+    +N+G   + +ST
Sbjct: 90  KKGDTCTLEQAKSYMQHDLKKFEQTV--NSAVNVPINQNQFDALVSLAYNIGPTAFEEST 147

Query: 127 FKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
             +R++ ++++ AA++   W  A GK L GLV RR  E++L L+
Sbjct: 148 LVKRLNEKNYKAAADQFGLWVNARGKRLQGLVNRRKIEMELFLK 191


>gi|319942274|ref|ZP_08016589.1| lysozyme [Sutterella wadsworthensis 3_1_45B]
 gi|319804147|gb|EFW01047.1| lysozyme [Sutterella wadsworthensis 3_1_45B]
          Length = 149

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 52/141 (36%), Positives = 72/141 (51%), Gaps = 4/141 (2%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           P+  + ++ E+EG R  AY     G WTIGYGHTG  V     I  + A   L  D    
Sbjct: 10  PDLAVPLVIEYEGFRSKAYL-CPAGVWTIGYGHTGG-VHPDDRIDMENARHVLASDLQDV 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            N L+E      S +  + +A+    FN+G+   + S   ++++  D E AA+E   WTK
Sbjct: 68  QNRLIEYLNV--SVTSGQFIALISLAFNVGVRAVSMSKLLRKLNEGDEEGAADEFLDWTK 125

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           AGGK L GLVKRR  E +  L
Sbjct: 126 AGGKELAGLVKRRREEREYFL 146


>gi|109897814|ref|YP_661069.1| glycoside hydrolase family protein [Pseudoalteromonas atlantica
           T6c]
 gi|109700095|gb|ABG40015.1| glycoside hydrolase, family 24 [Pseudoalteromonas atlantica T6c]
          Length = 186

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 76/140 (54%), Gaps = 8/140 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           A I ++K+ EG+RL AY+   GG W IGYGH  + V +GMTI   +AE  L  D  K  +
Sbjct: 51  ACIDIIKDSEGVRLNAYKG-PGGHWLIGYGHK-AGVKQGMTINAPQAEVLLKADLLKIED 108

Query: 91  LL--LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            +  L   P     + N+  A+    +N+G+GN  KST  + ++  D+  A+E+   W K
Sbjct: 109 QMHKLVKVP----VNNNQFSALVCLGYNIGMGNLYKSTLLRLLNKADYTGASEQFSVWRK 164

Query: 149 AGGKVLPGLVKRRDAEVKLL 168
           A GKV   LV+RR  E  L 
Sbjct: 165 AAGKVNAHLVQRRAKEKSLF 184


>gi|270265277|ref|ZP_06193538.1| hypothetical protein SOD_m00090 [Serratia odorifera 4Rx13]
 gi|270040681|gb|EFA13784.1| hypothetical protein SOD_m00090 [Serratia odorifera 4Rx13]
          Length = 158

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/133 (34%), Positives = 77/133 (57%), Gaps = 9/133 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSLNL 91
           ++   EG+    YRD+ G   T+ YGHTG+D+  G T ++ E +  L KD    ++S++ 
Sbjct: 24  LIPSLEGIEYKPYRDVVG-VLTVCYGHTGADIIPGKTYSKAECKVMLDKDLVPFARSVDR 82

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
            ++  PA    SE +  A+  F +N+G+  +  ST  ++++A D   A +E ++W KAGG
Sbjct: 83  SVKV-PA----SEYQKAALISFSYNVGVKAFESSTLLKKLNAGDSSGACDEMRRWNKAGG 137

Query: 152 KVLPGLVKRRDAE 164
           KV  GL+ RR+ E
Sbjct: 138 KVWKGLINRREVE 150


>gi|261344356|ref|ZP_05972000.1| lysozyme [Providencia rustigianii DSM 4541]
 gi|282567959|gb|EFB73494.1| lysozyme [Providencia rustigianii DSM 4541]
          Length = 159

 Score = 80.1 bits (196), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 74/137 (54%), Gaps = 3/137 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ML  FEG++   Y D+ G   T+  G TGSDV +G T T KE +D L K    ++N++
Sbjct: 21  VAMLSFFEGVKYKPYEDVVG-IQTVCAGITGSDVIQGKTYTPKECDDLLTKHMQSAINVV 79

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +SS  +      R  A+    +N+G   + KST  +++++ D   A  E  KWT AGGK
Sbjct: 80  -DSSVKVPINDAQR-AALYSLTYNIGGAAFKKSTLLKKLNSGDQIGACNEFSKWTFAGGK 137

Query: 153 VLPGLVKRRDAEVKLLL 169
              GL+ RR+ E  + L
Sbjct: 138 QWQGLITRREIEKAICL 154


>gi|170699048|ref|ZP_02890104.1| Lysozyme [Burkholderia ambifaria IOP40-10]
 gi|172063803|ref|YP_001811454.1| lysozyme [Burkholderia ambifaria MC40-6]
 gi|170136006|gb|EDT04278.1| Lysozyme [Burkholderia ambifaria IOP40-10]
 gi|171996320|gb|ACB67238.1| Lysozyme [Burkholderia ambifaria MC40-6]
          Length = 148

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 73/143 (51%), Gaps = 14/143 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKD---AS 86
           I ++K+FEGLRL  Y D  G   TIGYGH        T    +T  EAE  L +D   A 
Sbjct: 13  IALIKQFEGLRLARYLDAVGKP-TIGYGHLILPNERFTR--PLTPAEAEALLRRDLRGAE 69

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            +L  LL         ++ +  A+  FVFNLG G    ST  + ++A    +AA++   W
Sbjct: 70  LNLRKLLHVP-----VTQQQFDALMSFVFNLGAGRLRSSTLLRYLNAGARARAADQFLVW 124

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
            KAGGK L GL KRR AE  L L
Sbjct: 125 NKAGGKPLAGLTKRRQAERALFL 147


>gi|115359007|ref|YP_776145.1| lysozyme [Burkholderia ambifaria AMMD]
 gi|115284295|gb|ABI89811.1| Lysozyme [Burkholderia ambifaria AMMD]
          Length = 148

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 73/143 (51%), Gaps = 14/143 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKD---AS 86
           I ++K+FEGLRL  Y D  G   TIGYGH        T    +T  EAE  L +D   A 
Sbjct: 13  IALIKQFEGLRLARYLDAVGKP-TIGYGHLILPNERFTR--PLTPAEAEALLRRDLRGAE 69

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            +L  LL         ++ +  A+  FVFNLG G    ST  + ++A    +AA++   W
Sbjct: 70  LNLRKLLHVP-----VTQQQFDALMSFVFNLGAGRLRSSTLLRYLNAGARTRAADQFLVW 124

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
            KAGGK L GL KRR AE  L L
Sbjct: 125 NKAGGKPLAGLTKRRQAERALFL 147


>gi|71902154|ref|ZP_00684178.1| Lysozyme [Xylella fastidiosa Ann-1]
 gi|71728088|gb|EAO30291.1| Lysozyme [Xylella fastidiosa Ann-1]
          Length = 166

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 53/144 (36%), Positives = 78/144 (54%), Gaps = 14/144 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNL 91
           I ++K FEG +L  Y    GG  TIGYG TG  V  G+ +T E+EA      DA     L
Sbjct: 9   IALIKFFEGCKLIPY-TCPGGVLTIGYGETGKHVVPGLRLTNEQEA------DARLRARL 61

Query: 92  LLESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             E  PA++        + +  A+    FN+G+G +++ST  ++++A D   AAE+   W
Sbjct: 62  AKEFEPAVRRYVRVPLKQQQFDALVSLSFNIGVGAFHRSTLLRKLNAGDIAGAAEQFHVW 121

Query: 147 TKAGGKVLPGLVKRRDAEVKLLLE 170
             AGG+V  GL+ RR AE ++L E
Sbjct: 122 KWAGGRVQSGLIIRRAAE-RVLFE 144


>gi|323166776|gb|EFZ52530.1| lysozyme [Shigella sonnei 53G]
          Length = 143

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 12  LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 67

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++    + A ++  +WT AGGK   GL
Sbjct: 68  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGYIKGACDQLCRWTYAGGKQWKGL 127

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 128 MTRREIEREVCL 139


>gi|238925102|ref|YP_002938619.1| putative phage-related lysozyme [Eubacterium rectale ATCC 33656]
 gi|238876778|gb|ACR76485.1| probable phage-related lysozyme [Eubacterium rectale ATCC 33656]
          Length = 794

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 52/147 (35%), Positives = 78/147 (53%), Gaps = 12/147 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLKDASK---S 88
           + ++K+FEG RLTAY+      + TIGYGH GSDV  GMTIT+ +AE  L  D  +    
Sbjct: 83  VDLIKQFEGCRLTAYKVTSSEKYYTIGYGHYGSDVYAGMTITQAQAESMLKSDLVRFEGY 142

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR------VDAQDWEKAAEE 142
           +N  L       + ++N+  A+  F +N+G    + +TF+ +      V   + ++    
Sbjct: 143 VNTFLNKYNI--TINQNQFDALVSFTYNVGNVWVSYNTFQLKTYLINGVSNYNSDQITTA 200

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLL 169
              W K+GG VL GL +RR AE  L L
Sbjct: 201 FTNWNKSGGVVLDGLTRRRKAEAALFL 227


>gi|110641342|ref|YP_669072.1| lysozyme [Escherichia coli 536]
 gi|191173061|ref|ZP_03034594.1| phage lysozyme [Escherichia coli F11]
 gi|110342934|gb|ABG69171.1| lysozyme [Escherichia coli 536]
 gi|190906606|gb|EDV66212.1| phage lysozyme [Escherichia coli F11]
 gi|324014974|gb|EGB84193.1| phage lysozyme [Escherichia coli MS 60-1]
          Length = 165

 Score = 79.7 bits (195), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     E    A+  FV+N+G GN+  ST  ++++  D + + ++ ++WT AGGK   GL
Sbjct: 90  ITVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGSCDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|299769598|ref|YP_003731624.1| lysozyme [Acinetobacter sp. DR1]
 gi|298699686|gb|ADI90251.1| lysozyme [Acinetobacter sp. DR1]
          Length = 190

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 80/144 (55%), Gaps = 13/144 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL---LKDA 85
           + ++  FEGL+L+AY D G G WTIGYG T    G  V+E    T ++A+ ++   LK  
Sbjct: 50  VNLICNFEGLKLSAYDD-GTGVWTIGYGTTRYPNGQRVSERDRCTLEQAKAYMQHDLKIF 108

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            +++N +++         +N+  A+    +N+G+G +  ST  + ++  D+++A  +   
Sbjct: 109 ERAVNSVVKVP-----LKQNQFDALVSLAYNIGVGAFKNSTLLKNLNLGDYKEAGNQFDV 163

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLL 169
           W  AGGK L GLV RR  E KL L
Sbjct: 164 WVNAGGKRLQGLVNRRAIEKKLFL 187


>gi|294340265|emb|CAZ88637.1| Phage-related lysozyme [Thiomonas sp. 3As]
          Length = 148

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 54/134 (40%), Positives = 78/134 (58%), Gaps = 10/134 (7%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLN 90
           ++ + FEG RL AY D GG  WTIGYGHT   V EGM  T ++A  +L +D   A+ ++N
Sbjct: 13  QLTERFEGCRLQAYADTGG-VWTIGYGHT-HGVMEGMACTREQALAWLEQDTREAAAAVN 70

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            L+ + P      +    A+ DFVFNLG+G + +ST  + ++A +   AA +   W    
Sbjct: 71  RLV-TVP----LEQAEFDALVDFVFNLGVGAFARSTLLRDLNAGNLAAAAAQFPLWDHDA 125

Query: 151 GKVLPGLVKRRDAE 164
           G+VL GL+ RR AE
Sbjct: 126 GRVLAGLLHRRLAE 139


>gi|211731802|gb|ACJ10123.1| lysozyme [Bacteriophage APSE-3]
          Length = 157

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/135 (34%), Positives = 74/135 (54%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG+R   Y+D GG   T+ YGHTG+DV      T++E    L KD   ++ ++  
Sbjct: 24  LVQWHEGIRHKTYKD-GGDVLTVCYGHTGNDVIPAKHYTDEECLALLEKDLKAAMAVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E R  A+A FV+N+G G + +ST  ++++A D   A  E ++W    GKV 
Sbjct: 81  ETQVTVPLTEMRKAALASFVYNVGSGAFARSTLLKKLNAGDMAGACNEMRRWKYDEGKVS 140

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR  E +L L
Sbjct: 141 KGLITRRAVERELCL 155


>gi|167590348|ref|ZP_02382736.1| Lysozyme [Burkholderia ubonensis Bu]
          Length = 148

 Score = 79.3 bits (194), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 75/143 (52%), Gaps = 14/143 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEA---EDFLLKDAS 86
           I+++K+FEGLRL  Y D  G   TIGYGH        T  +T  E +A   +D  L+ A 
Sbjct: 13  IELIKQFEGLRLARYLDAVGKP-TIGYGHLILPHERFTRPLTPAEADALLRQD--LRSAE 69

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            SL  LL         ++ +  A+  FVFNLG G    ST  + ++A    +AA++   W
Sbjct: 70  LSLRKLLRVP-----VTQQQFDALMSFVFNLGSGRLRSSTLLRYLNAGAPARAADQFLVW 124

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
            KAGG+ L GL +RR AE  L L
Sbjct: 125 NKAGGRPLAGLTRRRQAERALFL 147


>gi|126600|sp|P27359|LYS_BPP21 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|67436|pir||LZBP21 lysozyme (EC 3.2.1.17) - phage 21
 gi|215468|gb|AAA32350.1| R [Phage 21]
          Length = 165

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/132 (33%), Positives = 74/132 (56%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+   ++N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL
Sbjct: 90  IKVDIPETMRGALYSLLYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREICL 161


>gi|167042442|gb|ABZ07168.1| putative Phage lysozyme [uncultured marine microorganism
           HF4000_ANIW133B20]
          Length = 173

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 56/153 (36%), Positives = 80/153 (52%), Gaps = 19/153 (12%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGG----------GAWTIGYGHTGSDVTEGMTITEKEAED 79
           N L K+ +E E L+L  Y D  G          G  TIGYGH      +  TITE EA  
Sbjct: 26  NGLAKIKQE-ESLKLVRYDDATGQPLARGQKAKGYPTIGYGHKLGTFEDLWTITEAEATR 84

Query: 80  FL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW 136
            L   L DA  ++N L++        ++N+  A+  FVFN+G G +++ST  + ++A D+
Sbjct: 85  LLVSDLVDAESAVNRLVKVP-----LTQNQYDALVSFVFNVGSGAFSRSTLLKLLNAGDY 139

Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           + AA +   W  +GG V+ GLVKRR  E  L L
Sbjct: 140 QGAANQFPAWRMSGGVVMAGLVKRRANERALFL 172


>gi|74311298|ref|YP_309717.1| lysozyme-like protein [Shigella sonnei Ss046]
 gi|73854775|gb|AAZ87482.1| lysozyme-like protein [Shigella sonnei Ss046]
          Length = 165

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/132 (34%), Positives = 73/132 (55%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYILYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  FV+N+G GN+  ST  ++++    + A ++  +WT AGGK   GL
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGYIKGACDQLCRWTYAGGKQWKGL 149

Query: 158 VKRRDAEVKLLL 169
           + RR+ E ++ L
Sbjct: 150 MTRREIEREVCL 161


>gi|320653584|gb|EFX21681.1| lysozyme-like protein [Escherichia coli O55:H7 str. 3256-97 TW
           07815]
          Length = 129

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 71/124 (57%), Gaps = 5/124 (4%)

Query: 47  YRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALK-STSEN 105
           Y+DI G  WT+ +GHTG D+  G T TE E +  L KD +    +  + +P +     E 
Sbjct: 6   YKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKDLA---TVARQINPYINVDIPET 61

Query: 106 RLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEV 165
              A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ RR+ E 
Sbjct: 62  TRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIER 121

Query: 166 KLLL 169
           ++ L
Sbjct: 122 EVCL 125


>gi|149408192|ref|YP_001294626.1| hypothetical protein ORF033 [Pseudomonas phage PA11]
          Length = 145

 Score = 79.0 bits (193), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 53/141 (37%), Positives = 78/141 (55%), Gaps = 7/141 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I  +KE EGLRL AY D   G WTIGYG TG DV +G+TIT++EAE  L K   +    +
Sbjct: 6   IDAIKEHEGLRLVAYLD-SVGVWTIGYGDTGPDVVKGLTITKEEAEKRLRKRLVEFEGYV 64

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--G 150
             ++       +++  A+   V+N+G  N+  ST  ++++A D+  AA++   W K    
Sbjct: 65  --NTYVKVPLKQHQFDALVSLVYNIGPANFKTSTLLKKLNAGDYIGAADQFLVWNKGRVD 122

Query: 151 GK--VLPGLVKRRDAEVKLLL 169
           GK  V+ GL  RR  E K  +
Sbjct: 123 GKLVVIKGLANRRAKERKQFI 143


>gi|317487281|ref|ZP_07946076.1| phage lysozyme [Bilophila wadsworthia 3_1_6]
 gi|316921471|gb|EFV42762.1| phage lysozyme [Bilophila wadsworthia 3_1_6]
          Length = 198

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 70/136 (51%), Gaps = 7/136 (5%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSP 97
           E+EG   T Y     G WTIGYGH      +   IT ++   +L +D   +L  +   +P
Sbjct: 58  EWEGFSPTPYL-CPAGYWTIGYGHLCDK--DHSPITREQGGRYLAEDLLDALRDVERLAP 114

Query: 98  ALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK--AGGKVLP 155
            LK   ++R +A A ++ NLG GN+  ST  +R+    WE AA+E K+W K   GGK  P
Sbjct: 115 NLKDEPDHRAIACASWIMNLGKGNFASSTMLKRIREGKWEAAAKEMKRWDKVTVGGKKKP 174

Query: 156 --GLVKRRDAEVKLLL 169
              L +RR  E  L L
Sbjct: 175 FRALTRRRLTEAHLFL 190


>gi|296101683|ref|YP_003611829.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|296103546|ref|YP_003613692.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295056142|gb|ADF60880.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295058005|gb|ADF62743.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 164

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 5/127 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY+D+ G  WT+  GHTG+D+  G   T+KE ++ L  D  K  + +    P 
Sbjct: 33  LEGRRYYAYQDVVG-VWTVCDGHTGTDIRRGHRYTDKECDNLLKSDLRKVADSI---DPL 88

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  F +N+G G +  ST  +++++ D   A +E ++WT AGGK   GL
Sbjct: 89  IKVRIPEPTRAALYSFTYNVGSGAFASSTLLKKLNSGDVPGACKELQRWTYAGGKQWKGL 148

Query: 158 VKRRDAE 164
           + RR+ E
Sbjct: 149 ITRREIE 155


>gi|212499717|ref|YP_002308525.1| lysozyme [Bacteriophage APSE-2]
 gi|211731686|gb|ACJ10174.1| lysozyme [Bacteriophage APSE-2]
          Length = 155

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 73/135 (54%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEGLR   Y+D  G   T+ YGHTG  +  G   T++E +  L  D   S+ ++  
Sbjct: 22  MVTYFEGLRHKPYKD-RGDVLTVCYGHTGKAIIPGKHYTDEECQALLDSDLKASMAVV-- 78

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E +  A+A FV+N+G G + +ST  ++++  D + A +E ++W    GKV 
Sbjct: 79  ETHVTVPLTEMQKAALASFVYNVGSGAFVRSTLLKKLNVGDRQGACDEMRRWKYDEGKVS 138

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR  E +L L
Sbjct: 139 KGLINRRAVERELCL 153


>gi|254254370|ref|ZP_04947687.1| Phage-related lysozyme (muraminidase) [Burkholderia dolosa AUO158]
 gi|124899015|gb|EAY70858.1| Phage-related lysozyme (muraminidase) [Burkholderia dolosa AUO158]
          Length = 148

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 75/142 (52%), Gaps = 12/142 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKD-ASKS 88
           I ++K+FEGLRL  Y D   G  TIGYGH        T    +T+ EA+  L +D  S  
Sbjct: 13  IALIKQFEGLRLARYLD-AVGKPTIGYGHLILPHERFTR--PLTQAEADALLRRDLRSAE 69

Query: 89  LNLL-LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           LNL  L   P     ++ +  A+  FVFNLG G    ST  + ++A    +AA++   W 
Sbjct: 70  LNLRKLLRVP----VTQQQFDALMSFVFNLGAGRLRSSTLLRYLNAGATARAADQFLVWN 125

Query: 148 KAGGKVLPGLVKRRDAEVKLLL 169
           KAGG+ L GL KRR AE  L L
Sbjct: 126 KAGGRPLAGLTKRRRAERALFL 147


>gi|170080903|ref|YP_001730223.1| lysozyme-like protein [Escherichia coli str. K-12 substr. DH10B]
 gi|169888738|gb|ACB02445.1| lysozyme-like protein [Escherichia coli str. K-12 substr. DH10B]
          Length = 164

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 70/127 (55%), Gaps = 5/127 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY+D+ G  WT+  GHTG+D+  G   T+KE ++ L  D  K  + +    P 
Sbjct: 33  LEGRRYYAYQDVVG-VWTVCDGHTGTDIRRGHRYTDKECDNLLKADLRKVASAI---DPL 88

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K    E    A+  F +N+G G +  ST  +++++ D   A +E ++WT AGGK   GL
Sbjct: 89  IKVRIPEPTRAALYSFTYNVGSGAFASSTLLKKLNSGDVPGACKELQRWTYAGGKQWKGL 148

Query: 158 VKRRDAE 164
           + RR+ E
Sbjct: 149 ITRREIE 155


>gi|87124613|ref|ZP_01080462.1| morphogenesis-like protein [Synechococcus sp. RS9917]
 gi|86168185|gb|EAQ69443.1| morphogenesis-like protein [Synechococcus sp. RS9917]
          Length = 256

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 76/139 (54%), Gaps = 9/139 (6%)

Query: 34  KMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           ++++ FEGL L +Y D   GG  WT  +GHTG DV  G T ++++ E  L +D ++    
Sbjct: 11  QLIQSFEGLELRSYPDPGTGGAPWTCCWGHTGPDVQPGQTYSQQQCERLLDQDLARFERG 70

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV---DAQDWEKAAEECKKWTK 148
           +    P L   ++ +  A+  + FN+G+G    S+ ++R+   +A D     EE  +W K
Sbjct: 71  VERLIPGL---NDQQFGALVSWAFNVGLGAVETSSLRRRILQGEAID-RVIREELPRWNK 126

Query: 149 AGGKVLPGLVKRRDAEVKL 167
           +   VL GL +RR AEV L
Sbjct: 127 SVNGVLAGLSRRRAAEVAL 145


>gi|238898750|ref|YP_002924432.1| APSE-2 prophage; lysozyme [Bacteriophage APSE-2]
 gi|229466510|gb|ACQ68284.1| APSE-2 prophage; lysozyme [Bacteriophage APSE-2]
          Length = 154

 Score = 78.6 bits (192), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 47/135 (34%), Positives = 75/135 (55%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEGLR   Y+D  G   T+ YGHTG  +  G   T++E +  L  D   S+ ++ E
Sbjct: 21  MVTYFEGLRHKPYKD-RGDVLTVCYGHTGKAIIPGKHYTDEECQALLDSDLKASMAVV-E 78

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           +   +  T E +  A+A FV+N+G G + +ST  ++++  D + A +E ++W    GKV 
Sbjct: 79  THVTVPLT-EMQKAALASFVYNVGSGAFVRSTLLKKLNVGDRQGACDEMRRWKYDEGKVS 137

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR  E +L L
Sbjct: 138 KGLINRRAVERELCL 152


>gi|300723273|ref|YP_003712574.1| Gifsy-2 prophage lysozyme [Xenorhabdus nematophila ATCC 19061]
 gi|297629791|emb|CBJ90399.1| Gifsy-2 prophage lysozyme [Xenorhabdus nematophila ATCC 19061]
          Length = 146

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 75/139 (53%), Gaps = 7/139 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLN 90
           +LK+ EG R  AY+D  G  WTIGYG T    G  +  GMTI+  +AE  L +   +   
Sbjct: 10  LLKQSEGCRTQAYQDCVG-VWTIGYGWTQSVEGIPIYAGMTISTTQAEQLLQQGLHRYEA 68

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            +L       S ++ +  A+ +F +N+G      ST  + ++A ++  AA+E  +W  A 
Sbjct: 69  AVLHLVKV--SLTQGQFDALINFTYNVGESALAHSTLLKYLNAGNYAAAADEFLRWNWAK 126

Query: 151 GKVLPGLVKRRDAEVKLLL 169
           G+ LPGL +RR AE +L L
Sbjct: 127 GQQLPGLTRRRQAEKELFL 145


>gi|71897553|ref|ZP_00679798.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71732456|gb|EAO34509.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 166

 Score = 78.2 bits (191), Expect = 3e-13,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 78/143 (54%), Gaps = 12/143 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L++Y    GG  TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGCKLSSY-TCPGGVLTIGYGETGKHVTPDMCLANEQEADAMLR-----ARLA 62

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST  ++++A D   AA++   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAQQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+V  GL+ RR AE ++L E
Sbjct: 123 WAGGRVQSGLIIRRAAE-RVLFE 144


>gi|302404527|ref|XP_003000101.1| lysozyme [Verticillium albo-atrum VaMs.102]
 gi|261361283|gb|EEY23711.1| lysozyme [Verticillium albo-atrum VaMs.102]
          Length = 187

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 72/144 (50%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++ EFEG     Y D  G   T+GYGH     + SDV   + ++    E  L  D 
Sbjct: 31  ATISLITEFEGWYPNIYIDPVGLP-TVGYGHLCADSSCSDVRYPIPLSRANGEQLLRDDI 89

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAEEC 143
           +   N +   + +    + N+  A+  + FN+G G    ST  QR++A       AAEE 
Sbjct: 90  AGFQNCITLQTASSVVLNANQYGALVSWAFNVGCGATKTSTLIQRLNAGGNPNTVAAEEL 149

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            KW + GG+VLPGL +RR AEV L
Sbjct: 150 PKWNRGGGQVLPGLTRRRAAEVAL 173


>gi|291563339|emb|CBL42155.1| Phage-related lysozyme (muraminidase) [butyrate-producing bacterium
           SS3/4]
          Length = 252

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/145 (33%), Positives = 77/145 (53%), Gaps = 15/145 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD-------VTEGMTITEKEAEDFLLKDA 85
           + ++K FEG RLTAY+D   G WTIGYG T +D       + +G+ I+++ A+++L +  
Sbjct: 8   LNLIKSFEGCRLTAYKD-SVGIWTIGYGTTNADKAITGATICQGLQISQETADEWLRQSV 66

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLG-IGNYNKSTFKQRVDAQDWEKAAEECK 144
            K     +E   A    ++N   A+  F +N+G I     +  + R         AE+  
Sbjct: 67  DKKYGPKVEKYNAAYGWNQNEFDALVSFAYNIGSIDQLTANGTRSR------SMIAEKIL 120

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLL 169
           ++ KAGGKV  GL +RR+AE  L L
Sbjct: 121 QYNKAGGKVFAGLTRRREAERALFL 145


>gi|71902204|ref|ZP_00684217.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71728044|gb|EAO30254.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 164

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 73/141 (51%), Gaps = 11/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L  Y    GG  TIGYG TG  VT  M +T ++  D +L+       L 
Sbjct: 9   IALIKFFEGCKLNPY-TCPGGVLTIGYGETGKHVTPDMCLTNEQEADAMLR-----ARLA 62

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST   +++A D   AA++   W 
Sbjct: 63  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGAGAFHRSTLLCKLNAGDVAGAAQQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
            AGG+V  GL+ RR AE  L 
Sbjct: 123 WAGGRVQSGLIIRRAAERALF 143


>gi|261345406|ref|ZP_05973050.1| lysozyme [Providencia rustigianii DSM 4541]
 gi|282566450|gb|EFB71985.1| lysozyme [Providencia rustigianii DSM 4541]
          Length = 190

 Score = 78.2 bits (191), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 48/140 (34%), Positives = 75/140 (53%), Gaps = 9/140 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           + M+ EFEG +   Y D   G  T+ YGHTGSD+    T TE E +  L KD    +K++
Sbjct: 22  VAMVTEFEGYKRKPYLD-PVGILTVCYGHTGSDIIPTKTYTEAECKALLEKDLAIVAKAV 80

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N L++ +       +    A+  F +N+G G +++ST  ++++A D   A  E K+W  A
Sbjct: 81  NPLIKVN-----IPDYTRAALYSFTYNVGTGAFSRSTLLKKLNAGDPIGACNELKRWIYA 135

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
           GG    GL+ RR+ E  + L
Sbjct: 136 GGVKWKGLMTRREVEEAVCL 155


>gi|321454374|gb|EFX65547.1| hypothetical protein DAPPUDRAFT_117155 [Daphnia pulex]
          Length = 175

 Score = 77.8 bits (190), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 76/137 (55%), Gaps = 11/137 (8%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLK--DASKS 88
           ++K FEGL L AY+D+ GG WTIGYG+T    GS V +G TIT++ A+D      D S  
Sbjct: 31  LIKGFEGLSLVAYQDV-GGIWTIGYGNTRYQDGSAVRQGDTITQQGADDLFQYWVDQSVK 89

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA-QDWEKAAEECKKWT 147
           ++ L+ +   ++    + LV++    +N+G G ++ ST   +V    D     +E  +W 
Sbjct: 90  VDRLVGTGVVIRQVQFDALVSIT---YNIGTGAFSTSTLLSKVRVFPDNPTIRDEFLRWV 146

Query: 148 KAGGKVLPGLVKRRDAE 164
              G+V+ GLV RR  E
Sbjct: 147 DVNGQVVQGLVNRRTKE 163


>gi|329298164|ref|ZP_08255500.1| phage lysozyme lysis protein [Plautia stali symbiont]
          Length = 194

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 44/126 (34%), Positives = 67/126 (53%), Gaps = 3/126 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           +EG     Y D  GG  T+ YGHTG D+T   T T  + E  L  D  ++  ++ +    
Sbjct: 31  WEGHATRPYAD-SGGVLTVCYGHTGGDITPETTRTPAQCEALLAADMRQAFAVIDQQ--V 87

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
               S+ + VA+A F+ N+G G + +ST  +R++A D   A +E ++W K  G  L GLV
Sbjct: 88  TVPLSDGQRVALAAFIHNVGAGAFARSTLLKRLNAGDIPAACDELRRWVKVNGVTLNGLV 147

Query: 159 KRRDAE 164
            RR A+
Sbjct: 148 NRRAAD 153


>gi|254426180|ref|ZP_05039897.1| phage lysozyme, putative [Synechococcus sp. PCC 7335]
 gi|196188603|gb|EDX83568.1| phage lysozyme, putative [Synechococcus sp. PCC 7335]
          Length = 839

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 56/158 (35%), Positives = 75/158 (47%), Gaps = 16/158 (10%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAW---TIGYGHT-----GSDVTEGMTITEKEAED 79
           + ++ I ++K  EG R  AY D G G W   TIGYG T     GS V  G TI+ ++AE 
Sbjct: 318 ISDSAISLIKTSEGFRSKAYADPGHG-WSLTTIGYGTTKYPPDGSPVKRGDTISVEKAEK 376

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ---RVDAQDW 136
            L           LE  P     + N+  A+  F +NLG G Y    F       D  DW
Sbjct: 377 CLKYQLEHDFKPALEKIPTWPRMNSNQQGALYSFAYNLGKGFYQGHNFDSITDLCDHPDW 436

Query: 137 EKAAEECKK----WTKAGGKVLPGLVKRRDAEVKLLLE 170
            + A + K+    + K+ GKV+PGLV RR AE  L  +
Sbjct: 437 WEDAAKVKQIFVLYNKSNGKVMPGLVTRRQAEADLFCQ 474


>gi|71275567|ref|ZP_00651852.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71900787|ref|ZP_00682907.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71163458|gb|EAO13175.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71729464|gb|EAO31575.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 164

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/139 (35%), Positives = 76/139 (54%), Gaps = 4/139 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNL 91
           I ++K FEG +L+ Y    GG  TIGYG TG  VT  M +  E+EA+  L    +K    
Sbjct: 9   IALIKFFEGCKLSPY-TCSGGVLTIGYGETGKHVTPDMCLANEQEADAILRARLAKEFEA 67

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
            +     +    + +  A+    FN+G+G +++ST  ++++A D   AAE+   W  AGG
Sbjct: 68  AVRRYVRV-PLKQQQFDALVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVWKWAGG 126

Query: 152 KVLPGLVKRRDAEVKLLLE 170
           +V  GL+ RR AE ++L E
Sbjct: 127 RVQSGLIVRRAAE-RVLFE 144


>gi|188581128|ref|YP_001924573.1| glycoside hydrolase family 24 [Methylobacterium populi BJ001]
 gi|179344626|gb|ACB80038.1| glycoside hydrolase family 24 [Methylobacterium populi BJ001]
          Length = 179

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 66/125 (52%), Gaps = 2/125 (1%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG+RL AYRDI G   T+  G T   V  G   T  E +  LLK  ++    +L+  P L
Sbjct: 49  EGVRLVAYRDIVG-VPTVCMGET-RGVKMGDRHTRAECDAMLLKGLAEFEEGILKCVPGL 106

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
               + RLVA     +N+G+G Y KST  +R +A D + + +    W KAGG+ + GL  
Sbjct: 107 AGAPDERLVAHVSLAYNIGVGAYCKSTVARRYNAGDLKGSCDAFDMWDKAGGRRVQGLAI 166

Query: 160 RRDAE 164
           RRD E
Sbjct: 167 RRDDE 171


>gi|169632570|ref|YP_001706306.1| putative lysozyme from bacteriophage [Acinetobacter baumannii SDF]
 gi|169633451|ref|YP_001707187.1| putative lysozyme from bacteriophage [Acinetobacter baumannii SDF]
 gi|169151362|emb|CAP00082.1| putative lysozyme from bacteriophage [Acinetobacter baumannii]
 gi|169152243|emb|CAP01148.1| putative lysozyme from bacteriophage [Acinetobacter baumannii]
          Length = 187

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 49/142 (34%), Positives = 76/142 (53%), Gaps = 7/142 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++  FE  R  AY D G G WTIG G T    G  V +G   T ++A+ +   D +K 
Sbjct: 48  VDLISGFEDTRFKAYDD-GVGVWTIGTGTTVYPNGVKVKQGDICTPEQAKTYFKHDLTKF 106

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              + ES       ++N+  A+    +N+G G    ST  + ++  D++ AA++   W K
Sbjct: 107 EKTVNESVTV--PLNQNQFDALVSLTYNIGAGALKNSTLLKLLNKGDYKGAADQFLVWNK 164

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           AGGKV+ GLV+RR+AE  L L+
Sbjct: 165 AGGKVMKGLVRRREAERALFLK 186


>gi|321454377|gb|EFX65550.1| hypothetical protein DAPPUDRAFT_229607 [Daphnia pulex]
          Length = 171

 Score = 77.8 bits (190), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 53/152 (34%), Positives = 78/152 (51%), Gaps = 13/152 (8%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLK 83
           V  A   ++K FEGL L AY+DI GG WTIGYG+T    GS V +G TIT++ A+D    
Sbjct: 24  VSQAGYDLIKGFEGLSLVAYQDI-GGVWTIGYGNTRYQDGSAVRQGDTITQQGADDLFQY 82

Query: 84  DASKS----LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA-QDWEK 138
              +S    ++ L+ +   L+    + LV+   F +N+G G ++ ST   +V    D   
Sbjct: 83  WVDQSFAPEVDRLVGNGVVLRQQQFDALVS---FTYNIGTGAFSTSTLLSKVRVWPDDPT 139

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
             +E  +W    G+V  GLV RR+ E      
Sbjct: 140 IRDEFMRWVYVNGQVSQGLVNRREKEADFYFS 171


>gi|28199005|ref|NP_779319.1| phage-related lysozyme [Xylella fastidiosa Temecula1]
 gi|182681720|ref|YP_001829880.1| lysozyme [Xylella fastidiosa M23]
 gi|28057103|gb|AAO28968.1| phage-related lysozyme [Xylella fastidiosa Temecula1]
 gi|182631830|gb|ACB92606.1| Lysozyme [Xylella fastidiosa M23]
 gi|307580156|gb|ADN64125.1| lysozyme [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 164

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 51/142 (35%), Positives = 76/142 (53%), Gaps = 13/142 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNL 91
           I ++K FEG +L++Y    GG  TIGYG TG  VT  M +  E+EA      DA     L
Sbjct: 9   IALIKFFEGCKLSSY-TCPGGVLTIGYGETGKHVTPDMCLANEQEA------DARLRARL 61

Query: 92  LLESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             E  PA++        +++  A+    FN+G G +++ST  ++++A D   AA++   W
Sbjct: 62  AKEFEPAVRRYVRVPLKQHQFDALVSLSFNIGAGAFHRSTLLRKLNAGDIAGAAQQFHVW 121

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AGG+V  GL+ RR AE  L 
Sbjct: 122 KWAGGRVQSGLIIRRAAERALF 143


>gi|171914983|ref|ZP_02930453.1| probable phage-related lysozyme [Verrucomicrobium spinosum DSM
           4136]
          Length = 216

 Score = 77.4 bits (189), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 57/147 (38%), Positives = 76/147 (51%), Gaps = 15/147 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           ++M+K FE L LTAY D GGG  TIGYGHTG       V  G  ITE+EA   L  D   
Sbjct: 58  LEMVKHFESLFLTAYYD-GGGVLTIGYGHTGLQHKDGTVYPGRRITEQEAVQLLAYD--- 113

Query: 88  SLNLLLESSPALKSTSENR--LVAVADFVFNLG---IGNYNKSTFKQRVDAQDWEKAAEE 142
            +N       AL +   N+    ++  F FN G   +     ST  ++++A D   AA+E
Sbjct: 114 -MNQFESRVKALVTVPLNQAQFDSLVSFDFNTGGLTLRGRKPSTLLRKLNAGDTAGAAQE 172

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLL 169
             KW K  GK + GL +RR AE ++ L
Sbjct: 173 FLKWNKDNGKTVDGLTRRRYAEREMFL 199


>gi|89054812|ref|YP_510263.1| glycoside hydrolase family protein [Jannaschia sp. CCS1]
 gi|88864361|gb|ABD55238.1| glycoside hydrolase family 24 [Jannaschia sp. CCS1]
          Length = 341

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 77/140 (55%), Gaps = 7/140 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++K FEG  LT Y D  G A TIGYGHTG     G TITE +A + L +D S  +  +
Sbjct: 8   LSLIKHFEGQYLTTYIDPVGVA-TIGYGHTGDHAIPGNTITEAQALEILEEDLSGHVASV 66

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--- 149
            + +    +  +++  A+  F FN+G   Y  ST ++ ++ +D   AA++  +W K    
Sbjct: 67  RKHTDI--AVEQHQFDALVSFAFNVGNLAYFNSTLRRLLNDRDRNGAADQFLRWDKGTVD 124

Query: 150 GGK-VLPGLVKRRDAEVKLL 168
           G K VLPGL +RR AE  L 
Sbjct: 125 GRKIVLPGLSRRRKAERHLF 144


>gi|237746268|ref|ZP_04576748.1| glycoside hydrolase [Oxalobacter formigenes HOxBLS]
 gi|229377619|gb|EEO27710.1| glycoside hydrolase [Oxalobacter formigenes HOxBLS]
          Length = 172

 Score = 77.4 bits (189), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 72/130 (55%), Gaps = 6/130 (4%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY+D   G  TIGYG T + V  G   T + A   LL  A++  + +    P 
Sbjct: 42  HEGYRDKAYKD-AVGIPTIGYGET-AGVKMGDRTTPERALVTLLSSANRHADAI---RPC 96

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +     ++   A     +N+G GN+ +ST  ++++A+D+  A EE ++W KAGGKVL GL
Sbjct: 97  IHVPLHQHEFDAYVSLAYNIGAGNFCRSTLVKKLNAKDYAGACEEIRRWNKAGGKVLAGL 156

Query: 158 VKRRDAEVKL 167
            KRR+ E +L
Sbjct: 157 TKRREKEYRL 166


>gi|296103909|ref|YP_003614055.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|295058368|gb|ADF63106.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 164

 Score = 77.0 bits (188), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (51%), Gaps = 5/143 (3%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           I +   ++      EG +  AYRD+ G   T+  GHTGSD+      T+KE +    KD 
Sbjct: 20  IAIATTMLSGKDGLEGRKYEAYRDVVG-VLTVCDGHTGSDIIINKRYTDKECDALTRKDL 78

Query: 86  SKSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            +   +  +  P +K  T+E +  A+  F +N+G      ST  ++++A+D+  A  E K
Sbjct: 79  QR---IASQVDPYIKVPTTETQRAAIYSFAYNVGATATINSTLLKKLNAKDYSGACSELK 135

Query: 145 KWTKAGGKVLPGLVKRRDAEVKL 167
           +W  AGG+   GLV RRD E ++
Sbjct: 136 RWVYAGGQKWKGLVNRRDVEYQV 158


>gi|329295799|ref|ZP_08253135.1| phage lysozyme lysis protein [Plautia stali symbiont]
          Length = 164

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG R   YRD GGG  T+ +GHTG DVT G   +E+E  + L+K   +    ++E
Sbjct: 24  LVQWHEGKRYKPYRD-GGGVLTVCHGHTGKDVTPGEIYSEEEC-NALMKQDLQVARAIVE 81

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
               ++ T   +  A+  FV+N+G G +  ST  ++++  D + A ++ ++W    GKV 
Sbjct: 82  RYVTVQLTDLQK-AALTSFVYNIGSGAFANSTLLKKLNTGDIQGACDQMRRWKYDEGKVS 140

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR+ E +L L
Sbjct: 141 NGLINRREVERELCL 155


>gi|85058706|ref|YP_454408.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779226|dbj|BAE74003.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 165

 Score = 77.0 bits (188), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 74/135 (54%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG R   YRD GGG  T+ +GHTG DVT G    E+E    + KD   +    +E
Sbjct: 24  LVQWHEGKRYKPYRD-GGGVLTVCHGHTGKDVTPGEIYNEEECNALMKKDLQVA-RATVE 81

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
               ++ T   +  A+  FV+N+G G +  ST  ++++A D + A ++ ++W    GKV 
Sbjct: 82  RYVTVQLTDLQK-AALTSFVYNIGSGAFANSTLLKKLNAGDIQGACDQMRRWKYDEGKVS 140

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR+ E ++ L
Sbjct: 141 NGLINRREVEREICL 155


>gi|32128440|ref|NP_858975.1| phage-type lysozyme [Xanthomonas phage Xp10]
 gi|31788503|gb|AAP58695.1| 28R [Xanthomonas phage Xp10]
          Length = 223

 Score = 77.0 bits (188), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 73/137 (53%), Gaps = 4/137 (2%)

Query: 36  LKEFEGLRLTAYRDIGGGA--WTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           +   EGLR TAY D    A  WTI YGHTG +V  G+ +T+ + + +L +D SK+   + 
Sbjct: 76  ISSHEGLRYTAYPDPATKAAPWTICYGHTGPEVRPGLVVTQSQCDKWLAQDLSKAEQQV- 134

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
             +      ++  + A   FV+N GIGN+  ST  + ++    ++A ++  +W+ A    
Sbjct: 135 -RAVVKVRITQGEMDAYTSFVYNAGIGNFRGSTMLKLLNQGKRKEACDQFPRWSYANKIR 193

Query: 154 LPGLVKRRDAEVKLLLE 170
           L GL KRR  E  + L+
Sbjct: 194 LEGLAKRRYEERAMCLK 210


>gi|84662620|ref|YP_453585.1| putative lysozyme [Xanthomonas phage OP1]
 gi|84570669|dbj|BAE72732.1| putative lysozyme [Xanthomonas oryzae phage OP1]
          Length = 166

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 4/142 (2%)

Query: 31  ALIKMLKEFEGLRLTAYRDIG--GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           A +  +   EGLR  AY D       WTI YGHTG +V  G+ +T+ + + +L +D SK+
Sbjct: 25  AGVVAISSHEGLRYAAYPDPATHSAPWTICYGHTGPEVKPGLVVTQGQCDKWLAQDLSKA 84

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              +   S      ++  L A   FV+N GIGN+  ST  + ++    ++A ++  +W+ 
Sbjct: 85  EQQV--RSVVKVGITQGELDAYTSFVYNAGIGNFRSSTMLKLLNQGKRKEACDQFPRWSY 142

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           A    L GL KRR  E  L L+
Sbjct: 143 ANKIKLEGLAKRRYEERALCLK 164


>gi|227113410|ref|ZP_03827066.1| endolysin (lysis protein) (lysozyme) [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 159

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 74/137 (54%), Gaps = 5/137 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG   T Y D+ G   T+  G TG DV  G T T  E +  L+K  + +   +  
Sbjct: 24  LIQWHEGRSYTVYYDVAGVP-TVCDGITGQDVKIGKTYTATECDALLVKHIAPAATAV-- 80

Query: 95  SSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
              A+K   ++ R  A+  F +N+GIG  N+ST  ++++A D  +A +E K+W KAGGKV
Sbjct: 81  -DKAVKVPMTDMRKAALISFTYNIGIGALNRSTMLRKLNAGDTSEACDELKRWDKAGGKV 139

Query: 154 LPGLVKRRDAEVKLLLE 170
             GL  RR  E +L L 
Sbjct: 140 WRGLTDRRAVERELCLS 156


>gi|329850254|ref|ZP_08265099.1| phage lysozyme family protein [Asticcacaulis biprosthecum C19]
 gi|328840569|gb|EGF90140.1| phage lysozyme family protein [Asticcacaulis biprosthecum C19]
          Length = 826

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 51/146 (34%), Positives = 82/146 (56%), Gaps = 8/146 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A ++++K FEGLR TA R +  G WT+GYGHT S   +G  +T+++A+  L  D   
Sbjct: 8   VSRAGVELIKSFEGLRSTAAR-LPDGRWTLGYGHTFS-ARDGARVTQEDADALLRFDLLP 65

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            ++ L  ++  L   ++N+  A+  F FN+G+ N+ +ST  +R++     +AA     W 
Sbjct: 66  IVDAL--NNLILVPLNQNQFDALVSFCFNIGVDNFGQSTVLKRINEGRMTEAALAMDAWR 123

Query: 148 KA--GGK--VLPGLVKRRDAEVKLLL 169
            A   G+  VL  L++RR AE  L L
Sbjct: 124 SAEFNGQTYVLAPLIRRRAAEKNLFL 149


>gi|326318296|ref|YP_004235968.1| glycoside hydrolase family 24 [Acidovorax avenae subsp. avenae ATCC
           19860]
 gi|323375132|gb|ADX47401.1| glycoside hydrolase family 24 [Acidovorax avenae subsp. avenae ATCC
           19860]
          Length = 229

 Score = 76.6 bits (187), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 49/137 (35%), Positives = 72/137 (52%), Gaps = 4/137 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I +++EFEG R  AYRD  G  WTIGYG T   V  G T+T ++A+  L ++  +    +
Sbjct: 10  IALIEEFEGFRAQAYRDPVG-IWTIGYGFT-RGVRAGDTMTREQADARLRQELGEYEAGV 67

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
             ++      ++ +  A+  F FN+G+     S+  +  +  D E AA     W KAGGK
Sbjct: 68  ARATGG--RATQAQFDALVSFAFNVGVEGMAASSVLRAHNRGDHEAAARAFALWNKAGGK 125

Query: 153 VLPGLVKRRDAEVKLLL 169
             PGL +RR AE  L L
Sbjct: 126 TWPGLTRRRAAEAALYL 142


>gi|15837309|ref|NP_297997.1| hypothetical protein XF0707 [Xylella fastidiosa 9a5c]
 gi|15839094|ref|NP_299782.1| hypothetical protein XF2504 [Xylella fastidiosa 9a5c]
 gi|9105591|gb|AAF83517.1|AE003913_13 phage-related protein [Xylella fastidiosa 9a5c]
 gi|9107707|gb|AAF85302.1|AE004058_3 phage-related protein [Xylella fastidiosa 9a5c]
          Length = 164

 Score = 76.3 bits (186), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 72/141 (51%), Gaps = 11/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L  Y    GG  TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGCKLNPY-TCPGGVLTIGYGETGKHVTPDMCLANEQEADAMLR-----ARLA 62

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST  +R++A D   A E+   W 
Sbjct: 63  KEFEPAVRRDVRVPLKQQQFDALVSLSFNIGAGAFHRSTLLKRLNAGDVAGALEQFHVWK 122

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
            AGG++  GL+ RR AE  L 
Sbjct: 123 WAGGRMQSGLIIRRAAERALF 143


>gi|294788486|ref|ZP_06753729.1| phage lysozyme [Simonsiella muelleri ATCC 29453]
 gi|294483917|gb|EFG31601.1| phage lysozyme [Simonsiella muelleri ATCC 29453]
          Length = 148

 Score = 76.3 bits (186), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 79/144 (54%), Gaps = 10/144 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVT-EGMTITEKEAEDFLLKDASK 87
           + ++K+FEG RL  Y D GG   TIGYG T    G+ V    + I +  A + L   A +
Sbjct: 8   VAIIKQFEGYRLEPYLDTGG-VPTIGYGCTRYENGAVVQLSDLPINQLRANELL---AHR 63

Query: 88  SLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            +      S +LK S S+N+  A+  F FN+G+GN   ST  Q+++A D   AA E  +W
Sbjct: 64  LVEFESGVSGSLKVSVSQNQFDALVSFAFNVGVGNLKSSTLLQKLNAGDDVGAAAEFSRW 123

Query: 147 TKAGGKVLPGLVKRRDAEVKLLLE 170
                K L GL++RR AE++L L+
Sbjct: 124 YFDNKKPLKGLLRRRAAEMQLFLK 147


>gi|238898552|ref|YP_002924233.1| phage lysozyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229466311|gb|ACQ68085.1| phage lysozyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 165

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 76/135 (56%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG R   YRD GGG  T+ +GHTG DVT G   +E+E    + +D   + + + E
Sbjct: 24  LVQWHEGKRDKPYRD-GGGVLTVCHGHTGKDVTPGEIYSEEECTALMTQDFQVARSAV-E 81

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
               ++ T   +  A+  FV+N+G G +  ST  ++++A D + A ++ ++W    GKV 
Sbjct: 82  RYVTVQLTDLQK-AALTSFVYNIGSGAFANSTLLKKLNAGDIQGACDQMRRWKYDEGKVS 140

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR+ E +L L
Sbjct: 141 NGLINRREVERELCL 155


>gi|326471472|gb|EGD95481.1| glycoside hydrolase family 24 protein [Trichophyton tonsurans CBS
           112818]
 gi|326481773|gb|EGE05783.1| lysozyme [Trichophyton equinum CBS 127.97]
          Length = 192

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++KEFEG   +   D   G  T+GYGH        +V     +TE  A   LL+D 
Sbjct: 36  ATIALIKEFEGFVPSPAPD-PVGLPTVGYGHLCQSKNCGEVGFPFPLTEDTATQLLLQDV 94

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
                 +   +      +EN+  A+  + FN+G GN   S+  QR++A +       EE 
Sbjct: 95  KAPQQTITLKTADGVHLNENQYGALVSWTFNVGPGNVATSSLLQRLNALEDVNTVLREEL 154

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            +W   GGKVLPGLV+RR AEV L
Sbjct: 155 PQWKYGGGKVLPGLVRRRAAEVAL 178


>gi|205357994|ref|ZP_03223899.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205328331|gb|EDZ15095.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
          Length = 162

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 50/139 (35%), Positives = 72/139 (51%), Gaps = 7/139 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +  A+I      EG R   YRD+ G   T+  GHTG D+  G   T+ E +  L KD   
Sbjct: 20  IAAAMIGGNGGLEGRRHEPYRDVAG-VLTVCDGHTGKDIVPGKHYTDAECDALLNKD--- 75

Query: 88  SLNLLLES-SPALKSTSEN-RLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            L L+     P +K++  N    A+  F +N+G G + +ST  ++++A D   A  E K+
Sbjct: 76  -LALVAARIDPLIKASIPNSERAALYSFAYNVGTGAFARSTLLKKLNAGDLAGACNELKR 134

Query: 146 WTKAGGKVLPGLVKRRDAE 164
           WT AGGK   GLV RR+ E
Sbjct: 135 WTYAGGKQWKGLVTRREIE 153


>gi|298292778|ref|YP_003694717.1| Lysozyme [Starkeya novella DSM 506]
 gi|296929289|gb|ADH90098.1| Lysozyme [Starkeya novella DSM 506]
          Length = 508

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 56/149 (37%), Positives = 78/149 (52%), Gaps = 20/149 (13%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYG----HTGSDVTEGMTITEKEAEDFLL---KDA 85
           + +++EFEGLRL AY D  G   TIGYG      G+ V  G +I+E EAE FL    ++ 
Sbjct: 8   LDLIREFEGLRLKAYIDPVGIP-TIGYGTIRYPNGTTVQMGDSISEAEAEAFLCFECEEI 66

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            + L  +L+      + S+N+  A+  F FNLG+G +  ST  Q++   D   AA E  +
Sbjct: 67  GRKLREVLDQV----ALSQNQYDAIVSFCFNLGVGAFAGSTLLQKLRLGDVPAAAAEFPR 122

Query: 146 WTKAGGKV------LPGLVKRRDAEVKLL 168
           W K  G V      LPGL +RR  E  L 
Sbjct: 123 WNK--GTVDGVKQELPGLTRRRARERSLF 149


>gi|148259886|ref|YP_001234013.1| glycoside hydrolase family protein [Acidiphilium cryptum JF-5]
 gi|146401567|gb|ABQ30094.1| glycoside hydrolase, family 24 [Acidiphilium cryptum JF-5]
          Length = 178

 Score = 75.9 bits (185), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 65/128 (50%), Gaps = 8/128 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMT-ITEKEAEDFLLKDASKSL 89
            +  FEG   T YRD   G WTIGYG T    G  VT+    IT   AE    +D + + 
Sbjct: 34  FIIPFEGFSPTPYRD-AAGTWTIGYGSTRDDTGCPVTQATPPITRATAETLARRDLASAR 92

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
             +  +       + N+  A+ DFV+NLG GN+ +ST  + ++  D++ AA +  +W  A
Sbjct: 93  QTVTHA--VTVPLTTNQQAALIDFVYNLGAGNFLRSTLLRLLNNGDYKAAAAQFPRWDLA 150

Query: 150 GGKVLPGL 157
            G  LPGL
Sbjct: 151 NGIPLPGL 158


>gi|317498218|ref|ZP_07956517.1| phage lysozyme [Lachnospiraceae bacterium 5_1_63FAA]
 gi|316894427|gb|EFV16610.1| phage lysozyme [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 246

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 82/153 (53%), Gaps = 15/153 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD-------VTEGMTITEKEAED 79
            +    IK++KEFEG  L AY+D   G WTIGYG T SD       + +G+ IT+ +A+ 
Sbjct: 3   KITENCIKLVKEFEGCYLKAYKD-EVGVWTIGYGITNSDKSITGTTIKQGLVITKAQADT 61

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLG-IGNYNKSTFKQRVDAQDWEK 138
           +L K   K    L+    +    ++N++ A+  F +N+G IG    S    R +A+  +K
Sbjct: 62  WLRKSLEKKYLPLVTRYNSKYDWNQNQIDALVSFCYNIGSIGGLTASG--TRSNAEIAKK 119

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
             E    + KAGGKV  GL +RR AE  L +++
Sbjct: 120 MLE----YNKAGGKVYRGLTRRRKAEHDLFVKA 148


>gi|71898019|ref|ZP_00680224.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71732263|gb|EAO34318.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 193

 Score = 75.5 bits (184), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 70/132 (53%), Gaps = 9/132 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLLLES 95
           +EGL+   Y+DI G  WT+ YGHTG+DV  G T TE E +  L   L++A+  +   + S
Sbjct: 62  WEGLKHRPYKDIVG-VWTVCYGHTGADVVIGKTYTEAECDALLQADLREANGYVRRCI-S 119

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P L    E  LV+     FNLG      ST +++  A DW  A  E  +W  AGG+ + 
Sbjct: 120 VPMLPHI-EASLVSA---TFNLGPKVVCGSTLQRKALANDWPGACAELDRWKHAGGREVR 175

Query: 156 GLVKRRDAEVKL 167
           GLV RR  E  L
Sbjct: 176 GLVLRRADERAL 187


>gi|299750303|ref|XP_002911479.1| lysozyme [Coprinopsis cinerea okayama7#130]
 gi|298408838|gb|EFI27985.1| lysozyme [Coprinopsis cinerea okayama7#130]
          Length = 478

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 50/148 (33%), Positives = 82/148 (55%), Gaps = 11/148 (7%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVT-EGMT--ITEKEAEDFLL 82
           A + +++EFEG   +   D  G   T+G+GH       ++VT +G++  ++  +AE  L 
Sbjct: 319 ATVNLIQEFEGFVASPEPDPIG-LPTVGFGHLCRQPNCAEVTAQGLSFPLSRAQAEQLLQ 377

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA-QDWEK-AA 140
            D     N L          +EN+  A+  + FN+G GN  +ST ++R++A QD    AA
Sbjct: 378 SDVQTFTNCLARFIDDSVVLNENQFGALTSWAFNVGCGNVQRSTLRRRLNAGQDPNTVAA 437

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           +E  ++ +AGG+VL GL +RR+AEV L 
Sbjct: 438 QELPRFNRAGGRVLNGLTRRRNAEVALF 465


>gi|257092228|ref|YP_003165869.1| glycoside hydrolase family 24 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257044752|gb|ACV33940.1| glycoside hydrolase family 24 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 168

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 77/161 (47%), Gaps = 28/161 (17%)

Query: 33  IKMLKEFEGL--------RLTAYRDIGGGAWTIGYGHT---------GSDVTEGMT---- 71
           I ++K FEG+            Y D   G WTIGYGH          G            
Sbjct: 11  IDLIKRFEGIVDGNKTTPNYDPYID-PVGIWTIGYGHAIRFQNAFLRGEAARARAAALYP 69

Query: 72  --ITEKEAEDFLLKDASKSLNLLLESSPALKST-SENRLVAVADFVFNLGIGNYNKSTFK 128
             +T +E ED L  D    LN   + +  +K T S+N+  A+  F FN+G      S+  
Sbjct: 70  SGLTTQEVEDLLRADL---LNTCRDVASLVKVTMSDNQFAALVSFAFNVGSTALKNSSLL 126

Query: 129 QRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           ++++A+D+  AA E  KW K GGKVL GL +RR+AE +L L
Sbjct: 127 KKLNAKDYAGAANEFAKWNKGGGKVLAGLTRRREAERQLFL 167


>gi|296447034|ref|ZP_06888968.1| Lysozyme [Methylosinus trichosporium OB3b]
 gi|296255477|gb|EFH02570.1| Lysozyme [Methylosinus trichosporium OB3b]
          Length = 283

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 76/140 (54%), Gaps = 12/140 (8%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKSLNL 91
           L + EG R  AYRD  GG WTIG GHT +     VT G+ IT+ + ++ L +D  +    
Sbjct: 13  LIQREGFRTKAYRDSVGG-WTIGVGHTSAAGEPKVTSGLVITKAQVDEILSRDLGQYEAA 71

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           +  SS      ++ +  A+  F FN+G+G + KST  +R++A D++ AA+    W+K   
Sbjct: 72  V--SSAVRAPLTQGQFDALVSFCFNIGVGGFTKSTVVKRLNAGDYKGAADALLLWSKP-- 127

Query: 152 KVLPGLVKRRDAEVKLLLES 171
              P ++ RR +E +  L +
Sbjct: 128 ---PEIMGRRRSEREQFLAA 144


>gi|195874381|ref|ZP_03080209.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195628979|gb|EDX48375.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 167

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 68/127 (53%), Gaps = 5/127 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R   YRD+ G   T+  GHTG D+  G   T+ E +  L +D ++   +     P 
Sbjct: 36  LEGRRYEPYRDVVG-VITVCDGHTGKDIVPGKHYTDAECDALLNQDLAQ---VAARIDPL 91

Query: 99  LKSTSEN-RLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K++  N    A+  F +N+G G + +ST  ++++A D   A  E K+WT AGGK   GL
Sbjct: 92  IKASIPNSERAALYSFAYNVGAGAFARSTLLKKLNAGDQAGACNELKRWTYAGGKQWKGL 151

Query: 158 VKRRDAE 164
           V RR+ E
Sbjct: 152 VTRREIE 158


>gi|295690197|ref|YP_003593890.1| family 24 glycoside hydrolase [Caulobacter segnis ATCC 21756]
 gi|295432100|gb|ADG11272.1| glycoside hydrolase family 24 [Caulobacter segnis ATCC 21756]
          Length = 413

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/146 (34%), Positives = 79/146 (54%), Gaps = 8/146 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A + ++K FEG R T+ + +  G WTIGYGHT +    G T++EK+AE  LL D   
Sbjct: 7   VSRAAVDLIKRFEGYRQTSAQ-LPDGRWTIGYGHTLT-ARPGATVSEKDAEALLLYDLIS 64

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
             + + E +      ++N+  A+  F FN+GI N+ +S   +R++     +AA   + W 
Sbjct: 65  VAHSVNEHT--YTPLTQNQFDALVCFAFNIGIENFVRSGVLRRINEGSLLQAACAMEMWR 122

Query: 148 KAGGK----VLPGLVKRRDAEVKLLL 169
           KA  +    V+  LV+RR AE  L L
Sbjct: 123 KADFEGERIVIDALVRRRSAEKTLFL 148


>gi|238898172|ref|YP_002923853.1| phage lysozyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465931|gb|ACQ67705.1| phage lysozyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 165

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 74/136 (54%), Gaps = 3/136 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG R   YRD GGG  T+ +GHTG DVT     +E+E  + + +D   + +++  
Sbjct: 24  LVQWHEGKRYKPYRD-GGGVLTVCHGHTGKDVTPEEIYSEEECSELMRRDLQIARSVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
                   S+ +  A+  FV+N+G G + +ST  ++++  D   A +E ++W    GKV 
Sbjct: 81  EHYVTFPLSDLQKAALTSFVYNIGSGAFERSTLLKKLNVGDLSGACDEMRRWKYDEGKVS 140

Query: 155 PGLVKRRDAEVKLLLE 170
            GL+ RR  E +L L+
Sbjct: 141 KGLINRRAIERELCLK 156


>gi|197104749|ref|YP_002130126.1| lysozyme family protein [Phenylobacterium zucineum HLK1]
 gi|196478169|gb|ACG77697.1| lysozyme family protein [Phenylobacterium zucineum HLK1]
          Length = 445

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 78/141 (55%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I+++K FEG R  A + +  G WTIGYGHT +   EG  ++E++AE  L+ D     + +
Sbjct: 12  IELIKRFEGYRRKAAQ-LPDGRWTIGYGHTLT-AREGAEVSEEDAEALLIYDLIAVAHAV 69

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            E   AL   ++N+  A+  F FNLG+  +  S   +R++A +  +AA   + W KA  +
Sbjct: 70  NEH--ALVPLTQNQFDALCSFAFNLGLDAFRTSQVLKRLNAGETVQAACAMELWRKAEFQ 127

Query: 153 ----VLPGLVKRRDAEVKLLL 169
               VL  LV+RR AE  L L
Sbjct: 128 GQRIVLDALVRRRSAEKALFL 148


>gi|237745741|ref|ZP_04576221.1| predicted protein [Oxalobacter formigenes HOxBLS]
 gi|229377092|gb|EEO27183.1| predicted protein [Oxalobacter formigenes HOxBLS]
          Length = 565

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 86/160 (53%), Gaps = 5/160 (3%)

Query: 4   INRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG 63
           I+ + S ++ +   +G+ K     + + + + L E EG+RL AY+D   G WTIGYGHT 
Sbjct: 350 ISAVPSSIQSVPTSSGNIKMTGGTLRDTIRENLMEREGVRLKAYQD-SKGLWTIGYGHT- 407

Query: 64  SDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYN 123
             V  GMTIT+ +A   L +D    +++ L+      S+ + R++A AD  +N G+    
Sbjct: 408 KGVKPGMTITKDQAAKLLEQDMKDHVDVALKMYAG--SSEKTRMLA-ADLAYNAGLKAIQ 464

Query: 124 KSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDA 163
           K T   ++  Q     ++  K +  +GGK +PGLV RR A
Sbjct: 465 KGTQFAKLAEQGEISRSDYTKLYNYSGGKFIPGLVNRRKA 504


>gi|239502653|ref|ZP_04661963.1| putative bacteriophage lysozyme [Acinetobacter baumannii AB900]
          Length = 212

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 52/140 (37%), Positives = 78/140 (55%), Gaps = 7/140 (5%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH----TGSDVTEGMTITEKEAEDFLLKDASKSL 89
           ++++ FEG R TAY D G    TIG+G      G  V  G T T  +AE++L K+  K +
Sbjct: 75  ELIRGFEGFRNTAYLDTGSVP-TIGFGTIKYPNGKAVRMGDTCTRAQAEEWL-KNDCKWV 132

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           +  L+    +K  S+N+  A+A FV+N+G   + KST    ++  ++  AA +  +W   
Sbjct: 133 DACLDKCVKVK-VSQNQFDALASFVYNVGETAFVKSTMLVLLNQGNFTGAANQFDRWVFD 191

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
            GK +PGLV RR AE KL L
Sbjct: 192 NGKRIPGLVNRRSAEKKLFL 211


>gi|327305839|ref|XP_003237611.1| glycoside hydrolase family 24 protein [Trichophyton rubrum CBS
           118892]
 gi|326460609|gb|EGD86062.1| glycoside hydrolase family 24 protein [Trichophyton rubrum CBS
           118892]
          Length = 192

 Score = 74.7 bits (182), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++KEFEG       D   G  T+GYGH        +V     +TE  A   L++D 
Sbjct: 36  ATIALIKEFEGFVPAPAPD-PVGLPTVGYGHLCQSKNCGEVGFPFPLTEDTATQLLIQDV 94

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
                 +   +      +EN+  A+  + FN+G GN   S+  QR++A +       EE 
Sbjct: 95  KAPQQTITLKTADGVHLNENQYGALVSWTFNVGPGNVATSSLLQRLNALEDVNTVLREEL 154

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            +W   GGKVLPGLV+RR AEV L
Sbjct: 155 PQWKYGGGKVLPGLVRRRAAEVAL 178


>gi|302505216|ref|XP_003014829.1| hypothetical protein ARB_07390 [Arthroderma benhamiae CBS 112371]
 gi|291178135|gb|EFE33926.1| hypothetical protein ARB_07390 [Arthroderma benhamiae CBS 112371]
          Length = 192

 Score = 74.7 bits (182), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++KEFEG       D   G  T+GYGH        +V     +TE  A   L++D 
Sbjct: 36  ATIALIKEFEGFVPAPAPD-PVGLPTVGYGHLCQSKNCGEVGFPFPLTEDTATQLLIQDV 94

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
                 +   +      +EN+  A+  + FN+G GN   S+  QR++A +       EE 
Sbjct: 95  KAPQQTITLKTADGVHLNENQYGALVSWTFNVGPGNVATSSLLQRLNALEDVNTVLREEL 154

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            +W   GGKVLPGLV+RR AEV L
Sbjct: 155 PQWKYGGGKVLPGLVRRRAAEVAL 178


>gi|71276664|ref|ZP_00652935.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71899161|ref|ZP_00681324.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71162536|gb|EAO12267.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Dixon]
 gi|71731019|gb|EAO33087.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 193

 Score = 74.3 bits (181), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 69/132 (52%), Gaps = 9/132 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLLLES 95
           +EGL+   Y+DI G  WT+ YGHTG+DV  G T TE E +  L   L++A+  +   + S
Sbjct: 62  WEGLKYHPYKDIVG-VWTVCYGHTGADVVIGKTYTEAECDALLQADLREANGYVRRCI-S 119

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P L    E  LV+     FNLG      ST +++  A DW  A  E  +W  A G+ + 
Sbjct: 120 VPMLPHI-EASLVSA---TFNLGPQVVCGSTLQRKALANDWPGACAELDRWKHAAGREVR 175

Query: 156 GLVKRRDAEVKL 167
           GLV RR  E  L
Sbjct: 176 GLVLRRADERAL 187


>gi|300817068|ref|ZP_07097287.1| phage lysozyme [Escherichia coli MS 107-1]
 gi|300530420|gb|EFK51482.1| phage lysozyme [Escherichia coli MS 107-1]
          Length = 170

 Score = 73.9 bits (180), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 70/141 (49%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T SDV  G TITE++A + L+ +     +SL
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SDVIPGKTITERQAAEGLISNVLRVERSL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        AV  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|302667988|ref|XP_003025572.1| hypothetical protein TRV_00212 [Trichophyton verrucosum HKI 0517]
 gi|291189687|gb|EFE44961.1| hypothetical protein TRV_00212 [Trichophyton verrucosum HKI 0517]
          Length = 273

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++KEFEG       D   G  T+GYGH        +V     +TE  A   L++D 
Sbjct: 117 ATIALIKEFEGFVPAPAPD-PVGLPTVGYGHLCQSKNCGEVGFPFPLTEDTATQLLIQDV 175

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
                 +   +      +EN+  A+  + FN+G GN   S+  QR++A +       EE 
Sbjct: 176 KAPQQTITLKTADGVHLNENQYGALVSWTFNVGPGNVATSSLLQRLNALEDVNTVLREEL 235

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            +W   GGKVLPGLV+RR AEV L
Sbjct: 236 PQWKYGGGKVLPGLVRRRAAEVAL 259


>gi|148727205|ref|YP_001285697.1| p28 [Xanthomonas phage Xop411]
 gi|89355884|gb|ABD72265.1| lysozyme [Xanthomonas phage Xo411]
 gi|116583505|gb|ABK00175.1| p28 [Xanthomonas phage Xop411]
          Length = 178

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 70/137 (51%), Gaps = 4/137 (2%)

Query: 36  LKEFEGLRLTAYRDIGGGA--WTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           +   EGLR  AY D    A  WTI YGHTG +V  G+  T+ + + +L +D  K+   + 
Sbjct: 31  ISSHEGLRYAAYPDPATHAAPWTICYGHTGPEVKPGLVATQSQCDKWLAEDLRKAEQQV- 89

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
             S      ++  L A   FV+N GIGN+  ST  + ++    ++A ++  +W+ A    
Sbjct: 90  -RSVVKVRITQGELDAYTSFVYNAGIGNFRSSTMLKLINQGKRKEACDQFPRWSYANKIK 148

Query: 154 LPGLVKRRDAEVKLLLE 170
           L GL KRR  E  + L+
Sbjct: 149 LEGLAKRRYEERAMCLK 165


>gi|17228662|ref|NP_485210.1| lysin [Nostoc sp. PCC 7120]
 gi|17130513|dbj|BAB73124.1| lysin [Nostoc sp. PCC 7120]
          Length = 242

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 87/176 (49%), Gaps = 16/176 (9%)

Query: 4   INRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDI--GGGAWTIGYGH 61
           I R I   K   G +G     K+P+P   + ++KEFEG +L AY D    G  +TIG+G 
Sbjct: 72  IQRQIEIAKLYGGASG-----KLPLPG--VNLIKEFEGCKLIAYPDPLSKGKPYTIGWGS 124

Query: 62  T----GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNL 117
           T    GS+ + G  +T+ EA++ L+    +     LE  P  ++ +  +  A+  F +NL
Sbjct: 125 TVKKDGSEWSLGEKMTQVEADELLILQLERKYLPSLEKIPGWENLNPYQQGALLSFAYNL 184

Query: 118 GIGNYNKSTFK---QRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           G   Y    F+   + ++ Q+W+K       +   G  V  GL +RR AE KL L+
Sbjct: 185 GANFYGSKGFETITRVLNNQEWDKIEPTLTMYRNPGSSVEAGLRRRRVAEAKLFLQ 240


>gi|289976635|gb|ADD21680.1| endolysin [Caulobacter phage Cd1]
          Length = 185

 Score = 73.9 bits (180), Expect = 7e-12,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 73/138 (52%), Gaps = 3/138 (2%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           A +  +  +EG     Y+D+ G  WT+ YG TG+ V  G   T++E    L +D  +   
Sbjct: 19  AGVAFIAGWEGKENAPYKDMVG-VWTVCYGSTGAHVRPGGVRTDEECITLLEEDLVRFEK 77

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            +   +P  K+  +N+  A+    FN+G   Y  STF ++ +A D + A+ E  +W+ AG
Sbjct: 78  AVNRCTPPPKN--QNQFDAMVSLSFNIGENAYCGSTFARKFNAGDVQGASNEFPRWSYAG 135

Query: 151 GKVLPGLVKRRDAEVKLL 168
           GK + GL+ RR AE +L 
Sbjct: 136 GKQVRGLLNRRLAEKRLF 153


>gi|167582256|ref|ZP_02375130.1| glycoside hydrolase family 24 [Burkholderia thailandensis TXDOH]
          Length = 142

 Score = 73.9 bits (180), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 72/143 (50%), Gaps = 11/143 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+ +FEGL L A  D  G   T   G T  DV  G   T +E    L +   +    +L+
Sbjct: 1   MVPKFEGLELVARPDPIG-IITACNGDT-KDVHAGQRFTPEECRARLEQRLIEHAEPVLK 58

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KKWT 147
            +P LK  + N+L A   F +N+G G Y  ST  +R ++ DW+ A            +W 
Sbjct: 59  CTPVLKGHT-NQLAAAVSFAYNVGAGAYCGSTTAKRFNSGDWKGACRALNEADSGRPQWV 117

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+VLPGLVKRR AE + L E
Sbjct: 118 TAGGRVLPGLVKRR-AEERALCE 139


>gi|15837115|ref|NP_297803.1| phage-related endolysin [Xylella fastidiosa 9a5c]
 gi|9105368|gb|AAF83323.1|AE003900_2 phage-related endolysin [Xylella fastidiosa 9a5c]
          Length = 154

 Score = 73.6 bits (179), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 51/132 (38%), Positives = 70/132 (53%), Gaps = 9/132 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLLLES 95
           +EGL+   Y+DI G  WT+ YGHTG++V  G T TE E +  L   L++A+  +   + S
Sbjct: 23  WEGLKHRPYKDIVG-VWTVCYGHTGANVVIGKTYTEAECDALLQADLREANGYVRRCI-S 80

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P L    E  LV+     FNLG      ST +++  A DW  A  E  +W  AGG+ + 
Sbjct: 81  VPMLPHI-EASLVSA---TFNLGPKVVCGSTLQRKALANDWPGACAELDRWKHAGGREVR 136

Query: 156 GLVKRRDAEVKL 167
           GLV RR  E  L
Sbjct: 137 GLVLRRADERAL 148


>gi|304319792|ref|YP_003853435.1| lysozyme family protein [Parvularcula bermudensis HTCC2503]
 gi|303298695|gb|ADM08294.1| lysozyme family protein [Parvularcula bermudensis HTCC2503]
          Length = 344

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 79/145 (54%), Gaps = 11/145 (7%)

Query: 33  IKMLKEFEGLRLTAYRDI----GGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           + ++K +EGLRLTA  +     G   W++GYGH  +   +GMT+TEKEA   L  D    
Sbjct: 24  LNLIKAYEGLRLTAQAEPALPDGERLWSVGYGHRKT-AAQGMTVTEKEAARLLADDIGPI 82

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             L+   S      ++N   A+   +FN+G  N+ +ST   +++  D   AA+  ++W++
Sbjct: 83  EGLI--QSTVRCPLNQNEHDALVSLIFNIGEENFRRSTVLAKLNDGDKLAAADAIERWSR 140

Query: 149 A--GGKV--LPGLVKRRDAEVKLLL 169
           A   G++  L GLV+RR AE  L L
Sbjct: 141 ARVDGRLVKLDGLVRRRAAEKSLFL 165


>gi|310815730|ref|YP_003963694.1| lysozyme [Ketogulonicigenium vulgare Y25]
 gi|308754465|gb|ADO42394.1| lysozyme [Ketogulonicigenium vulgare Y25]
          Length = 180

 Score = 73.6 bits (179), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 3/144 (2%)

Query: 30  NALIKMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
            A+   +  +EG RL AY D       WT+ +G T + V +G + T  E +  L++  S 
Sbjct: 35  TAIAVFVGPWEGERLEAYLDRIADPPVWTVCFGETRA-VQQGDSYTSAECQKMLIEALSV 93

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L     AL    +   VA+  + +N+G+G    ST  +  ++ DW+ A ++  +W 
Sbjct: 94  YHAGLARCVAALPDQPQGVQVALTSWAYNVGVGAACGSTLARLANSGDWQAACQQLPRWN 153

Query: 148 KAGGKVLPGLVKRRDAEVKLLLES 171
           +AGG+ + GL  RR AE +L L +
Sbjct: 154 RAGGQPVAGLTNRRAAEQRLCLNA 177


>gi|212710952|ref|ZP_03319080.1| hypothetical protein PROVALCAL_02021 [Providencia alcalifaciens DSM
           30120]
 gi|212686649|gb|EEB46177.1| hypothetical protein PROVALCAL_02021 [Providencia alcalifaciens DSM
           30120]
          Length = 189

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 68/133 (51%), Gaps = 5/133 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + M+  FEG+    Y+D+     T+ +GHTG+D+    T +E E    L  D  K    +
Sbjct: 21  VSMIAYFEGMETKPYKDVVN-VTTVCFGHTGADIIPTKTYSESECLALLESDLDKVRKGV 79

Query: 93  LESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
               P +K    +N    +  F +N+G G + +ST  ++++A D   A  E K+WT AGG
Sbjct: 80  ---DPLIKVDLDDNTRATIYSFAYNVGTGAFARSTMLKKLNAGDIAGACNELKRWTYAGG 136

Query: 152 KVLPGLVKRRDAE 164
           K   GL+ RR+ E
Sbjct: 137 KEWKGLITRREIE 149


>gi|169868552|ref|XP_001840847.1| lysozyme [Coprinopsis cinerea okayama7#130]
 gi|116498005|gb|EAU80900.1| lysozyme [Coprinopsis cinerea okayama7#130]
          Length = 271

 Score = 73.6 bits (179), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 52/149 (34%), Positives = 78/149 (52%), Gaps = 14/149 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS--DVTE---GMTITEKEAEDFLLKDA-- 85
           + +LKEFEG   + Y+D+ G   T+GYGH  S  D +E      +T+ + E+ L KD   
Sbjct: 118 LDLLKEFEGWAASPYKDVAGYP-TVGYGHKCSKNDCSELGYKFPMTKAQGEELLAKDVKG 176

Query: 86  -SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAEE 142
             K ++  +  +  L   ++N+  A+  + FN+G G    ST   R++  D     A EE
Sbjct: 177 FEKCISDYINDTIKL---NDNQYGALVSWSFNVGCGAAKDSTLISRLNKGDSPNTVAGEE 233

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
             +W KAGGKV+ GL  RR  EV+L   S
Sbjct: 234 LPRWNKAGGKVVDGLTNRRKKEVELFKTS 262


>gi|227358575|ref|ZP_03842895.1| lysozyme [Proteus mirabilis ATCC 29906]
 gi|227161190|gb|EEI46273.1| lysozyme [Proteus mirabilis ATCC 29906]
          Length = 120

 Score = 72.8 bits (177), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/116 (37%), Positives = 63/116 (54%), Gaps = 4/116 (3%)

Query: 53  GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALK-STSENRLVAVA 111
           G  T+ YGHTG D+ +G   T++E +  L  D  K+     +    +K S  +    A+ 
Sbjct: 3   GVLTVCYGHTGKDIIQGKRYTQQECDALLQIDFIKTQQ---QVDALIKVSLDDYTKAALY 59

Query: 112 DFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
            F FN+G   + +ST  ++++A D   A EE K+W  AGGKV  GLV RR+AE  L
Sbjct: 60  SFAFNVGTTAFARSTLLKKLNAGDRAGACEEMKRWIYAGGKVWRGLVSRREAESAL 115


>gi|320539113|ref|ZP_08038784.1| putative phage lysozyme [Serratia symbiotica str. Tucson]
 gi|320030751|gb|EFW12759.1| putative phage lysozyme [Serratia symbiotica str. Tucson]
          Length = 141

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 76/135 (56%), Gaps = 4/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++++EGL+LTAY+       TIG+GHT   V  G  IT+ +A+ FL  D   ++  L  
Sbjct: 10  LIRQYEGLKLTAYK-CSAVKDTIGFGHT-HGVKPGDHITKAQADAFL--DEGLAVFELTI 65

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           ++   +  + ++  A+    FN+G   +  ST  ++ +  D + AA+E  +W   G  V+
Sbjct: 66  NTAIKRPMNPHQFDAMVALAFNIGGAAFAGSTLVKKFNTGDIQGAAKEFPRWCHCGRIVV 125

Query: 155 PGLVKRRDAEVKLLL 169
           PGLVKRR AE ++ L
Sbjct: 126 PGLVKRRAAEREMFL 140


>gi|315046960|ref|XP_003172855.1| glycoside hydrolase family 24 [Arthroderma gypseum CBS 118893]
 gi|311343241|gb|EFR02444.1| glycoside hydrolase family 24 [Arthroderma gypseum CBS 118893]
          Length = 192

 Score = 72.8 bits (177), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 71/144 (49%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++KEFEG   +   D   G  T+GYGH        +V     +TE  A   L +D 
Sbjct: 36  ATIALVKEFEGFVPSPAPD-PIGLPTVGYGHLCQSKNCGEVGFPFPLTEDTATQLLSQDI 94

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
                 +   +      +EN+  A+  + FN+G GN   S+  +R++A +       EE 
Sbjct: 95  KAPQQTITLKTADGVHLNENQYGALVSWTFNVGPGNVATSSLLKRLNALEDVNTVLREEL 154

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            KW  AGGKVLPGLV+RR AEV L
Sbjct: 155 PKWKYAGGKVLPGLVRRRAAEVAL 178


>gi|16126412|ref|NP_420976.1| lysozyme family protein [Caulobacter crescentus CB15]
 gi|221235192|ref|YP_002517628.1| lysozyme-family localization factor spmX [Caulobacter crescentus
           NA1000]
 gi|13423670|gb|AAK24144.1| lysozyme family protein [Caulobacter crescentus CB15]
 gi|220964364|gb|ACL95720.1| lysozyme-family localization factor spmX [Caulobacter crescentus
           NA1000]
          Length = 431

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 79/146 (54%), Gaps = 8/146 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A + ++K FEG R  A + +  G WT+GYGHT +   EG +++EK+AE  LL D   
Sbjct: 7   VSRAAVDLIKRFEGYRQKAAQ-LPDGRWTVGYGHTLT-AREGASVSEKDAEALLLYDLIS 64

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
             + + E +      ++N+  A+  F FN+G+ N+ +S   +R++     +AA   + W 
Sbjct: 65  VAHSVNEHT--YTPLNQNQFDALVCFAFNIGLDNFLRSGVLRRINEGSLLQAACAMEMWR 122

Query: 148 KAGGK----VLPGLVKRRDAEVKLLL 169
           KA  +    V+  LV+RR AE  L L
Sbjct: 123 KADFEGERIVIDALVRRRSAEKTLFL 148


>gi|15838905|ref|NP_299593.1| phage-related lysozyme [Xylella fastidiosa 9a5c]
 gi|9107481|gb|AAF85113.1|AE004042_12 phage-related lysozyme [Xylella fastidiosa 9a5c]
          Length = 182

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 71/142 (50%), Gaps = 13/142 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNL 91
           I ++K FEG +L  Y    GG  TIGYG TG  V   M +  E+EA      DA     L
Sbjct: 25  IALIKFFEGCKLNPY-TCPGGVLTIGYGETGKHVRPDMRLANEQEA------DARLRARL 77

Query: 92  LLESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             E  PA++        + +  A+    FN+G G +++ST  ++++A D   AAE+   W
Sbjct: 78  AKEFEPAVRRYVRVPLKQQQFDALVSLSFNIGTGAFHRSTLLRKLNAGDVAGAAEQFHVW 137

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AGG +  GL+ RR AE  L 
Sbjct: 138 KWAGGSIQSGLIIRRAAERALF 159


>gi|238695615|ref|YP_002922642.1| P28 [Xanthomonas phage phiL7]
 gi|190343982|gb|ACE75768.1| P28 [Xanthomonas phage phiL7]
          Length = 174

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 71/142 (50%), Gaps = 4/142 (2%)

Query: 31  ALIKMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           A +  +   EGLR   Y D   GG  +T+ YGHTG +V  GM + + + + +L +D  K+
Sbjct: 27  AGVVAVSNHEGLRYATYPDPATGGAPYTVCYGHTGPEVKPGMVVKQAQCDKWLAQDLRKA 86

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             ++L  S A     +  L A   FVFN+G GN+  ST  + ++    ++A ++  +W  
Sbjct: 87  QGVVL--STARVRIQQGELDAYTSFVFNVGGGNWRSSTMLRLLNQGKRKEACDQFPRWVY 144

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           A    + GL  RR  E    L+
Sbjct: 145 ANKIKMEGLATRRYEERATCLK 166


>gi|315041156|ref|XP_003169955.1| lysozyme [Arthroderma gypseum CBS 118893]
 gi|311345917|gb|EFR05120.1| lysozyme [Arthroderma gypseum CBS 118893]
          Length = 190

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 55/152 (36%), Positives = 75/152 (49%), Gaps = 18/152 (11%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDA 85
           A I ++K FEG       D   G  T+GYGH       ++V     +TE  A + L++D 
Sbjct: 34  ATISLIKHFEGFVPRPAPD-PIGLPTVGYGHACRTKGCAEVPFPFPLTEDTATELLMQDV 92

Query: 86  SKSLNLLLESSPALKSTSE-----NRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA 139
                   + S  L +T E     N   A+  + FN+G G   KS+  +R++  QD    
Sbjct: 93  KS-----FQQSITLSTTDEVVLNANEYGALVSWAFNIGGGAAKKSSLIRRLNQGQDVNTV 147

Query: 140 A-EECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
             EE   W KAGGKVLPGLV+RR AEV+L  E
Sbjct: 148 LREELPLWNKAGGKVLPGLVRRRAAEVELASE 179


>gi|171320600|ref|ZP_02909622.1| Lysozyme [Burkholderia ambifaria MEX-5]
 gi|171094175|gb|EDT39260.1| Lysozyme [Burkholderia ambifaria MEX-5]
          Length = 148

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 57/143 (39%), Positives = 72/143 (50%), Gaps = 14/143 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEA---EDFLLKDAS 86
           I ++K+FEGLRL  Y D  G   TIGYGH        T  +T  E EA    D  L+ A 
Sbjct: 13  IALIKQFEGLRLARYLDAVGKP-TIGYGHLILPNERFTRPLTPAEAEALLRRD--LRGAE 69

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            +L  LL         ++ +  A+  FVFNLG G    ST  + ++A    +AA +   W
Sbjct: 70  LNLRKLLHVP-----VTQQQFDALMSFVFNLGAGRLRSSTLLRYLNAGARARAANQFLVW 124

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
            KAGGK L GL KRR AE  L L
Sbjct: 125 NKAGGKPLAGLTKRRQAERALFL 147


>gi|254252429|ref|ZP_04945747.1| Phage-related lysozyme (muraminidase) [Burkholderia dolosa AUO158]
 gi|124895038|gb|EAY68918.1| Phage-related lysozyme (muraminidase) [Burkholderia dolosa AUO158]
          Length = 165

 Score = 72.4 bits (176), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 68/144 (47%), Gaps = 10/144 (6%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEGL L A  D  G   T  YG T  DV  G   T  E    L +        
Sbjct: 21  LFSIVPKFEGLELVARPDPIG-IITACYGDT-KDVRAGQRFTPDECRARLEQQLIAHAEP 78

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L+ +P LK  +  +L A   F +N+G G Y  ST  +R +A DW+ A            
Sbjct: 79  VLKCTPVLKGHT-YQLAAAVSFAYNVGTGAYCGSTTAKRFNAGDWKGACRAMNESDAGKP 137

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLL 168
           +W   GG+VLPGLV+RR+ E  L 
Sbjct: 138 QWVYGGGRVLPGLVERREFERALC 161


>gi|167725565|ref|ZP_02408801.1| glycoside hydrolase family 24 [Burkholderia pseudomallei DM98]
          Length = 142

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 50/137 (36%), Positives = 66/137 (48%), Gaps = 10/137 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+ +FEGL L A  D  G   T  YG T  DV  G   T +E    L +   +    +L+
Sbjct: 1   MVPKFEGLELVARPDPIG-IITACYGDT-KDVRAGQRFTPEECRARLEQRLIEHAEPVLK 58

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KKWT 147
            +P LK  +  +L A   F +N+G   Y  ST  +R +A DW  A            +W 
Sbjct: 59  CTPVLKGHT-YQLAAAVSFAYNIGPRAYCGSTTAKRFNAGDWRGACRAINESDNGRPQWV 117

Query: 148 KAGGKVLPGLVKRRDAE 164
            AGG+VLPGLVKRR  E
Sbjct: 118 TAGGRVLPGLVKRRATE 134


>gi|211731824|gb|ACJ10136.1| lysozyme [Bacteriophage APSE-6]
          Length = 157

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG+R   Y+D GG   T+ YGHTG +V      T++E    L  D   ++ ++  
Sbjct: 24  LVQWHEGIRHKPYKD-GGYVLTVCYGHTGEEVILAKRYTDEECLALLDSDLKAAMAVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
            +      +E +  A+A FV+N+G G + +ST  ++++A D   A  E ++W    GKV 
Sbjct: 81  ETQVTVPLTEMQKAALASFVYNVGSGAFARSTLLKKLNAGDMPGACNEMRRWKYDEGKVS 140

Query: 155 PGLVKRRDAEVKLLL 169
            GL+ RR  E +L L
Sbjct: 141 KGLINRRAVERELCL 155


>gi|169774295|ref|XP_001821615.1| lysozyme [Aspergillus oryzae RIB40]
 gi|83769478|dbj|BAE59613.1| unnamed protein product [Aspergillus oryzae]
          Length = 183

 Score = 72.0 bits (175), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 8/149 (5%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFL 81
           PV    + ++K FE  + + Y D G G  TIGYGH     T S+VT    ++E +A   L
Sbjct: 23  PVNQNGLNLIKSFESFQPSVYDD-GFGNPTIGYGHLCGDATCSEVTYPKPLSEADASRLL 81

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD--WEKA 139
             D     + L  +     + ++N+  A+  + FN+G GN  KS    R++  +     A
Sbjct: 82  ADDLVSYQDALTNALADPVTLNDNQYAALVSWTFNIGNGNMQKSDLVARMNKGENVATVA 141

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            +E  +W KA G+V+ GL +RR AE+ L 
Sbjct: 142 HDELPQWNKANGQVVNGLTRRRKAELDLF 170


>gi|238497189|ref|XP_002379830.1| lysozyme, putative [Aspergillus flavus NRRL3357]
 gi|220694710|gb|EED51054.1| lysozyme, putative [Aspergillus flavus NRRL3357]
          Length = 183

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/149 (32%), Positives = 75/149 (50%), Gaps = 8/149 (5%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFL 81
           PV    + ++K FE  + + Y D G G  TIGYGH     T S+VT    ++E +A   L
Sbjct: 23  PVNQNGLNLIKSFESFQPSVYDD-GFGNPTIGYGHLCGDATCSEVTYPKPLSEADASRLL 81

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD--WEKA 139
             D     + L  +     + ++N+  A+  + FN+G GN  KS    R++  +     A
Sbjct: 82  ADDLVSYQDALTNALADPVTLNDNQYAALVSWTFNIGNGNMQKSDLVARMNKGENVATVA 141

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            +E  +W KA G+V+ GL +RR AE+ L 
Sbjct: 142 HDELPQWNKANGQVVNGLTRRRKAELDLF 170


>gi|170110100|ref|XP_001886256.1| glycoside hydrolase family 24 protein [Laccaria bicolor S238N-H82]
 gi|164638840|gb|EDR03115.1| glycoside hydrolase family 24 protein [Laccaria bicolor S238N-H82]
          Length = 181

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 73/143 (51%), Gaps = 8/143 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           I +++ FEG  + + R    G  T+GYGH       S+V     +T+  A   L  D + 
Sbjct: 29  INLIERFEGF-VPSPRPDPIGLPTVGYGHLCKTKGCSEVPFKFPVTKANAVTLLHSDLTT 87

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAEECKK 145
             N +          ++N+  A+  + +N+G GN   S+  +R++A +     AA+E  +
Sbjct: 88  FQNCVNSDIKRSVHLNDNQYGALVSWAYNVGCGNIKTSSLVRRLNAGEDPNTVAAQELPQ 147

Query: 146 WTKAGGKVLPGLVKRRDAEVKLL 168
           W K GGKVLPGLV+RR  EVKL 
Sbjct: 148 WNKGGGKVLPGLVRRRAEEVKLF 170


>gi|322703674|gb|EFY95279.1| glycoside hydrolase family 24 protein [Metarhizium anisopliae ARSEF
           23]
          Length = 428

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 77/147 (52%), Gaps = 9/147 (6%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAW-TIGYGH-----TGSDVTEGMT-ITEKEAEDFLLK 83
           A +K +  FEG     Y D G     T+GYGH       ++V      +++ +    L  
Sbjct: 27  ATVKFISTFEGWYDHVYPDPGPQHLETLGYGHLCKKPNCAEVKYPFPPLSKADGLKLLSD 86

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAE 141
           D S + N + + + A  + + N+  A+  + FN+G GN   S   +R++A +     AA+
Sbjct: 87  DMSVAENCIYQDTSAKVTLNANQYGALVSWAFNVGCGNVASSRLIRRLNAGEDPNTVAAQ 146

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           E  +W +AGGKVLPGL +RR+AEV+L 
Sbjct: 147 ELPQWNRAGGKVLPGLTRRRNAEVELF 173


>gi|307580030|gb|ADN63999.1| phage-related lysozyme [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 137

 Score = 71.6 bits (174), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 66/115 (57%), Gaps = 12/115 (10%)

Query: 56  TIGYGHTGSDVTEGMTIT-EKEAEDFLLKDASKSLNLLLESSPALK-----STSENRLVA 109
           TIGYG TG  V  G+ +T E+EA      DA     L  E  PA++     + ++++  A
Sbjct: 3   TIGYGETGKHVVPGLRLTNEQEA------DARLRARLAKEFEPAVRRHVKVTLAQHQFDA 56

Query: 110 VADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
           +    FN+G+G +++ST  ++++A D   AAE+   W  AGG+V  GLV+RR AE
Sbjct: 57  LVSLSFNIGVGAFHRSTLLRKLNAGDVAGAAEQFHVWKWAGGRVQSGLVRRRKAE 111


>gi|237748239|ref|ZP_04578719.1| glycoside hydrolase [Oxalobacter formigenes OXCC13]
 gi|229379601|gb|EEO29692.1| glycoside hydrolase [Oxalobacter formigenes OXCC13]
          Length = 163

 Score = 71.2 bits (173), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 69/132 (52%), Gaps = 8/132 (6%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG R  AY+D   G  T+GYG T     +G+T+  +   D  L     S N   +     
Sbjct: 35  EGYRGEAYKD-AVGVPTVGYGET-----KGVTMKSRTTPDRALVQLLSSANRHADDIRQC 88

Query: 100 KSTS--ENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
            S    ++   A     +N+G  N+  ST  ++++A++++ A  E ++W KAGGKVLPGL
Sbjct: 89  ISVPLYQHEFDAYVSLAYNIGAKNFCHSTLVRKLNAENYKGACTEIRRWNKAGGKVLPGL 148

Query: 158 VKRRDAEVKLLL 169
            KRR+ E ++ +
Sbjct: 149 TKRREKEYRMCM 160


>gi|332877433|ref|ZP_08445180.1| phage lysozyme [Capnocytophaga sp. oral taxon 329 str. F0087]
 gi|332684539|gb|EGJ57389.1| phage lysozyme [Capnocytophaga sp. oral taxon 329 str. F0087]
          Length = 147

 Score = 71.2 bits (173), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 76/146 (52%), Gaps = 12/146 (8%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           +   N+LI+ +K FEG R TAYR    G WTIGYGHT + V  G  +TE EAE  L +D 
Sbjct: 1   MKASNSLIEAIKRFEGFRGTAYR-CPAGVWTIGYGHT-AGVKRGDKMTEGEAERQLRRDL 58

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTF--KQRVDAQDWEKAAEEC 143
           ++    + +      +  +N+  A+ DF +NLG      ST   K R  A D E  A E 
Sbjct: 59  AEYEAFVDKLGV---TERQNKFDALVDFAYNLGCDALAGSTLLKKIRACAPDAEVRA-EF 114

Query: 144 KKW---TKAGGKV-LPGLVKRRDAEV 165
            KW   T AG K  L GLVKRR  E 
Sbjct: 115 MKWVYATVAGKKRKLEGLVKRRKWEA 140


>gi|307314492|ref|ZP_07594095.1| glycoside hydrolase family 24 [Escherichia coli W]
 gi|306905915|gb|EFN36437.1| glycoside hydrolase family 24 [Escherichia coli W]
 gi|315060109|gb|ADT74436.1| lysis-like protein [Escherichia coli W]
 gi|323379333|gb|ADX51601.1| glycoside hydrolase family 24 [Escherichia coli KO11]
 gi|332342207|gb|AEE55541.1| phage lysozyme [Escherichia coli UMNK88]
          Length = 170

 Score = 70.9 bits (172), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     +SL
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERSL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        AV  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|296813401|ref|XP_002847038.1| lysozyme [Arthroderma otae CBS 113480]
 gi|238842294|gb|EEQ31956.1| lysozyme [Arthroderma otae CBS 113480]
          Length = 197

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 73/145 (50%), Gaps = 8/145 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           I ++K FEG       D   G  T+GYGH        +V     +TE+ A + L +D   
Sbjct: 43  IALIKHFEGFVPRPAPD-PIGLPTVGYGHLCRTKGCGEVPFPFPLTEESATELLHQDVKS 101

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKAA-EECKK 145
               +  S+      + N+  A+  + FN+G G   KS+  +R++  QD +    EE   
Sbjct: 102 PQQSITLSTADSVVLNANQYGALVSWAFNVGGGAAKKSSLIKRLNQGQDVDTVIREELPL 161

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLE 170
           W KAGG VLPGLV+RR AEV+L +E
Sbjct: 162 WNKAGGHVLPGLVRRRKAEVELAME 186


>gi|302892501|ref|XP_003045132.1| hypothetical protein NECHADRAFT_81573 [Nectria haematococca mpVI
           77-13-4]
 gi|256726057|gb|EEU39419.1| hypothetical protein NECHADRAFT_81573 [Nectria haematococca mpVI
           77-13-4]
          Length = 188

 Score = 70.9 bits (172), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 51/172 (29%), Positives = 88/172 (51%), Gaps = 16/172 (9%)

Query: 7   IISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG--- 63
           ++ F+  ++G+ G       PV  A + +++EFEG R   Y D  G   T+GYGH     
Sbjct: 10  LLYFLSVLVGVRG--ACIGPPVNQATLSLVEEFEGFRADVYIDATGNP-TVGYGHLCKQS 66

Query: 64  --SDVTEGMTITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLG 118
             S++   + +++ + +  L   +K A + + L   S+  L +   N+  A+  + FN+G
Sbjct: 67  GCSEIPYPIPLSQADGQKLLQDDIKVAQQCITLDTTSAVVLNA---NQYGALVSWAFNVG 123

Query: 119 IGNYNKSTFKQRVD-AQDWEK-AAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            G    ST  +R++  +D    A+EE  KW K  G+ + GL +RR AEV+L 
Sbjct: 124 CGASGDSTLIRRLNNGEDANTVASEELPKWNKGNGQPIAGLTRRRAAEVELF 175


>gi|237747857|ref|ZP_04578337.1| glycoside hydrolase [Oxalobacter formigenes OXCC13]
 gi|229379219|gb|EEO29310.1| glycoside hydrolase [Oxalobacter formigenes OXCC13]
          Length = 162

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 45/130 (34%), Positives = 67/130 (51%), Gaps = 4/130 (3%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG R  AY+D   G  T+GYG T   VT     T   A   LL  A++  + + +     
Sbjct: 34  EGYRGEAYKD-AVGVPTVGYGET-KGVTMKSRTTPDRALVQLLTSANRHADDIRQCIKV- 90

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
               ++   A     +N+G  N+  ST  +R++A D+  +  E K+W KAGGKVLPGLV 
Sbjct: 91  -PLYQHEFDAYVSLAYNIGAKNFCGSTLVRRLNAGDYTGSCREIKRWNKAGGKVLPGLVN 149

Query: 160 RRDAEVKLLL 169
           RR+ E ++ +
Sbjct: 150 RREKEYRMCM 159


>gi|300907207|ref|ZP_07124870.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|301303634|ref|ZP_07209756.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|300401082|gb|EFJ84620.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|300841133|gb|EFK68893.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|315257864|gb|EFU37832.1| phage lysozyme [Escherichia coli MS 85-1]
          Length = 170

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P LK        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPLKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|21241825|ref|NP_641407.1| phage-related lysozyme [Xanthomonas axonopodis pv. citri str. 306]
 gi|21107204|gb|AAM35943.1| phage-related lysozyme [Xanthomonas axonopodis pv. citri str. 306]
          Length = 149

 Score = 70.5 bits (171), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 72/137 (52%), Gaps = 7/137 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           + K  EGLRL +Y     G  TIGYGHTG DVT G+TIT++ A+  L  D +K+L  + +
Sbjct: 11  LTKLSEGLRLRSY-VCPAGKLTIGYGHTGYDVTPGLTITQERADALLEADLAKALAGVRK 69

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW----TKAG 150
                 +  +    A+ DFVFNLG      ST  + +++ ++   + +  +W        
Sbjct: 70  YVHVPLTAQQE--AALVDFVFNLGAERLRTSTLLRLLNSGNYASVSTQLPRWVYGEVNGK 127

Query: 151 GKVLPGLVKRRDAEVKL 167
            K LPGL+ RR A V +
Sbjct: 128 AKRLPGLIVRRRANVAM 144


>gi|291558336|emb|CBL37136.1| Phage-related lysozyme (muraminidase) [butyrate-producing bacterium
           SSC/2]
          Length = 224

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 53/153 (34%), Positives = 81/153 (52%), Gaps = 17/153 (11%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD-------VTEGMTITEKEAEDF 80
           V N  IK++K+FEGL   AYRD   G WTIGYG T +D       +  G+ I+EK A+++
Sbjct: 4   VTNKCIKLVKKFEGLYKKAYRD-EVGVWTIGYGITNADKSITGATIKAGLVISEKTADNW 62

Query: 81  LLKDA-SKSLNLLLESSPALKSTSENRLVAVADFVFNLG-IGNYNKSTFKQRVDAQDWEK 138
           L +   SK L  +++      + ++N + A+  F +N+G I     +  + R        
Sbjct: 63  LERSLNSKYLQKVMKYDKKY-NWNQNEIDALVSFAYNIGSIDGLTANGTRSRATI----- 116

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
            A +  ++ KA GKV  GL +RR AE KL L +
Sbjct: 117 -AAKILEYNKAAGKVYRGLTRRRKAERKLFLTA 148


>gi|296804118|ref|XP_002842911.1| glycoside hydrolase family 24 [Arthroderma otae CBS 113480]
 gi|238845513|gb|EEQ35175.1| glycoside hydrolase family 24 [Arthroderma otae CBS 113480]
          Length = 192

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 70/144 (48%), Gaps = 8/144 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++KEFE    +   D   G  T+GYGH        +V     +TE  A   L +D 
Sbjct: 36  ATISLVKEFERFVPSPSPD-PIGLPTVGYGHLCQSKNCGEVGFPFPLTEDTATQLLAQDI 94

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EEC 143
                 +   +      +EN+  A+  + FN+G GN   S+  +R++A +       EE 
Sbjct: 95  KAPQQTITLKTVNGVHLNENQYGALVSWTFNVGPGNVATSSLLKRLNALEDVNTVLREEL 154

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            KW  AGGKVLPGLV+RR AEV L
Sbjct: 155 PKWKYAGGKVLPGLVRRRAAEVAL 178


>gi|167842175|ref|ZP_02468859.1| glycoside hydrolase family 24 [Burkholderia thailandensis MSMB43]
          Length = 142

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 70/143 (48%), Gaps = 11/143 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+ +FEGL L A  D  G   T   G T  DV  G   T  +    L +   +    +L+
Sbjct: 1   MVPKFEGLELVARPDPIG-IITACNGDT-KDVRAGQRFTPDQCRARLEQRLIEHAEPVLK 58

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KKWT 147
            +P LK  +  +L A   F +N+G G Y  ST  +R +A DW+ A            +W 
Sbjct: 59  CTPVLKGHT-YQLAAAVSFAYNVGAGAYCGSTTAKRFNAGDWKGACRALNEADNGRPQWV 117

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
            AGG+VLPGLVKRR AE + L E
Sbjct: 118 TAGGRVLPGLVKRR-AEERALCE 139


>gi|238796821|ref|ZP_04640326.1| Phage lysozyme [Yersinia mollaretii ATCC 43969]
 gi|238719309|gb|EEQ11120.1| Phage lysozyme [Yersinia mollaretii ATCC 43969]
          Length = 158

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 72/131 (54%), Gaps = 3/131 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG + TAY D+ G   T+  GHTGSD+  G   +++E +  L +D    +   ++ +  
Sbjct: 23  LEGRQHTAYYDVAG-VMTLCDGHTGSDIIRGKQYSDQECDAMLQRDLL-PVKRWVDGAVK 80

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
           +      R  A+  F +N+G   +  ST  +++++ ++  A EE ++W +AGGK  PGL+
Sbjct: 81  VPLGDYTR-AALYSFTYNVGRTAFLNSTLLKKLNSGNFTAACEELRRWIRAGGKQWPGLI 139

Query: 159 KRRDAEVKLLL 169
            RR+ E +L L
Sbjct: 140 NRREIERELCL 150


>gi|331028030|ref|YP_004421745.1| lysozyme [Synechococcus phage S-CBS3]
 gi|294805643|gb|ADF42481.1| lysozyme [Synechococcus phage S-CBS3]
          Length = 359

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 71/144 (49%), Gaps = 9/144 (6%)

Query: 33  IKMLKEFEGLRLTAYRDI--GGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDAS 86
           I ++KEFEG  L AY D   GG  WTIGYG T    G  V  G  IT  EA+  L ++  
Sbjct: 65  IALIKEFEGCHLRAYPDPLSGGDPWTIGYGTTRYQNGVKVQRGDQITVIEADLLLRQEID 124

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLG---IGNYNKSTFKQRVDAQDWEKAAEEC 143
           +    L  + P  K+ ++++  A+  F +NLG   +G     T  + +  +DW       
Sbjct: 125 RIAAKLASTVPHWKAMNDDQRCALISFAYNLGPDFVGLAGFETITRCLRDRDWAAVPAAL 184

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
           + +   G  V  GL++RR AE KL
Sbjct: 185 ELYRNPGTNVEAGLLRRRRAEGKL 208


>gi|312970947|ref|ZP_07785126.1| phage lysozyme family protein [Escherichia coli 1827-70]
 gi|331656895|ref|ZP_08357857.1| putative lysozyme [Escherichia coli TA206]
 gi|310336708|gb|EFQ01875.1| phage lysozyme family protein [Escherichia coli 1827-70]
 gi|331055143|gb|EGI27152.1| putative lysozyme [Escherichia coli TA206]
          Length = 170

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        AV  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|317491577|ref|ZP_07950013.1| phage lysozyme [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316921124|gb|EFV42447.1| phage lysozyme [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 164

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/130 (31%), Positives = 70/130 (53%), Gaps = 5/130 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG     Y+D+ G   T+  GHTG D+      ++ E +     D  +   +  + +P+
Sbjct: 33  LEGREYVPYKDVVG-IITVCDGHTGKDIILNKRYSDAECDALTKADLEQ---IAKQVNPS 88

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K  T+E +L A+  F +N+G   + KST  ++++A D+  A +E K+W  AGGK   GL
Sbjct: 89  IKVKTTETQLAAIYSFSYNVGATAFIKSTMLKKLNAGDYSGACDELKRWVYAGGKKWKGL 148

Query: 158 VKRRDAEVKL 167
           + RRD E ++
Sbjct: 149 MNRRDVEYEV 158


>gi|262403679|ref|ZP_06080237.1| lysozyme [Vibrio sp. RC586]
 gi|262350183|gb|EEY99318.1| lysozyme [Vibrio sp. RC586]
          Length = 179

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 48/176 (27%), Positives = 84/176 (47%), Gaps = 19/176 (10%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C +  +++ V      N DD+   + V    ++ +   EG R  AY+      WTIG G
Sbjct: 12  VCSVTAVLAIV-----FNIDDE---LSVSENGLRHIANEEGCRAKAYQ-CSADVWTIGLG 62

Query: 61  HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
           HT S V +G   T ++   + +KD + +  ++ +      + +E  ++    FVFNLG G
Sbjct: 63  HT-SGVKQGDKATNEQVAQYFVKDVATAEKVVKKYITQTPNQAEYDMMV--SFVFNLGAG 119

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK-------VLPGLVKRRDAEVKLLL 169
           N+  ST  ++ +  D + A ++  +W    GK         PG+ KRRD E+ + L
Sbjct: 120 NFQTSTLLRKFNQGDNQSACQQYPRWVYVNGKDCRIEENDCPGIPKRRDKEMNICL 175


>gi|170112706|ref|XP_001887554.1| glycoside hydrolase family 24 protein [Laccaria bicolor S238N-H82]
 gi|164637456|gb|EDR01741.1| glycoside hydrolase family 24 protein [Laccaria bicolor S238N-H82]
          Length = 265

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 72/145 (49%), Gaps = 8/145 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKDA 85
           A I ++K+FEG   +   D  G   T+GYGH       ++V     +TE EA   L  D 
Sbjct: 109 ATIALIKKFEGFVASPSPDPIG-LPTVGYGHLCQTKNCAEVPFSFPLTEAEASTLLNSDL 167

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA-QDWEK-AAEEC 143
                 + +   +    ++N+  A+  + FN G G    ST   R++A QD +  AA+E 
Sbjct: 168 KTYEACITKDIVSSVRLNDNQYGALCSWAFNEGCGAAGSSTLIARLNAGQDPDAVAAQEL 227

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLL 168
            KW  AGGKVL GLV RR AEV L 
Sbjct: 228 PKWDIAGGKVLQGLVNRRAAEVALF 252


>gi|156933799|ref|YP_001437715.1| hypothetical protein ESA_01625 [Cronobacter sakazakii ATCC BAA-894]
 gi|156532053|gb|ABU76879.1| hypothetical protein ESA_01625 [Cronobacter sakazakii ATCC BAA-894]
          Length = 162

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 73/145 (50%), Gaps = 5/145 (3%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           I +  A++      EG     YRD+ G   T+  GHTG D+  G   T+ E +     D 
Sbjct: 19  IAIATAMVAGKDGLEGREYVPYRDVVG-VLTVCDGHTGKDIIPGKRYTDAECDALTQADM 77

Query: 86  SKSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
           +   ++  +  P +K +T++ +  A+  F +N+G     KST  ++++  D+  A  E K
Sbjct: 78  T---HIARQIDPHIKVNTTDTQRAAIYSFAYNVGPSAAIKSTLMKKLNDGDYVGACNELK 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLL 169
           +W  AGGK   GL+ RR+ E ++ +
Sbjct: 135 RWIYAGGKKWRGLMSRREVEHQVCM 159


>gi|51596140|ref|YP_070331.1| endolysin (lysis protein) (lysozyme) [Yersinia pseudotuberculosis
           IP 32953]
 gi|51589422|emb|CAH21044.1| probable endolysin (lysis protein) (lysozyme) [Yersinia
           pseudotuberculosis IP 32953]
          Length = 162

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 67/133 (50%), Gaps = 7/133 (5%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL--LESS 96
            EG   T YRD+ G   T+  GHTG D+      ++ E +  L +D       +  + + 
Sbjct: 33  LEGREYTPYRDVVG-VLTVCDGHTGKDIIPSKRYSDAECDALLHQDLIPVFATIDRIVNV 91

Query: 97  PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPG 156
           P      + R  A+A F +N+GI     ST  ++++  D   A +E ++W KAGGKV  G
Sbjct: 92  P----MPDFRKAALASFGYNVGITAMTHSTMVKKLNRGDTSGACDELRRWIKAGGKVWKG 147

Query: 157 LVKRRDAEVKLLL 169
           LV RR+ E +L L
Sbjct: 148 LVNRREVERELCL 160


>gi|322614435|gb|EFY11366.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322621500|gb|EFY18353.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624361|gb|EFY21194.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322626558|gb|EFY23363.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322633580|gb|EFY30322.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322638377|gb|EFY35075.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322647324|gb|EFY43820.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322649280|gb|EFY45717.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322656000|gb|EFY52300.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322661395|gb|EFY57620.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322662594|gb|EFY58802.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322666967|gb|EFY63142.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322671336|gb|EFY67459.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322677657|gb|EFY73720.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322681517|gb|EFY77547.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322683917|gb|EFY79927.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323195486|gb|EFZ80664.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323200459|gb|EFZ85539.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203037|gb|EFZ88069.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323205278|gb|EFZ90253.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323210572|gb|EFZ95456.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218147|gb|EGA02859.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323221587|gb|EGA06000.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323227652|gb|EGA11807.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323230910|gb|EGA15028.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323234738|gb|EGA18824.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323238777|gb|EGA22827.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323241477|gb|EGA25508.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323248377|gb|EGA32313.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253225|gb|EGA37055.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323257021|gb|EGA40730.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323260506|gb|EGA44117.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264437|gb|EGA47943.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323269572|gb|EGA53025.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 169

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T SDV  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SDVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|322832206|ref|YP_004212233.1| glycoside hydrolase family 24 [Rahnella sp. Y9602]
 gi|321167407|gb|ADW73106.1| glycoside hydrolase family 24 [Rahnella sp. Y9602]
          Length = 169

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 68/138 (49%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ +FEG RL+AY+    G WT G GHT + V     I+E++A   L++D  +    +
Sbjct: 34  LALIADFEGCRLSAYQ-CSAGVWTNGIGHT-AGVKPQTQISERQAAVNLVEDVMRVEKGI 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P   +  +    AV  F FN+G+    KST    ++  +W KA E+  +W    G 
Sbjct: 92  ARCMPV--AMPQPVYDAVVSFAFNVGVTAACKSTLAFFINKGEWRKACEQLPRWAFVNGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
            + GL +RR  E+   L 
Sbjct: 150 RVTGLERRRANELAYCLR 167


>gi|167566440|ref|ZP_02359356.1| gp24 [Burkholderia oklahomensis EO147]
          Length = 142

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEG  L A  D  G   T  +G T  DV  G   T  E    L +   +    +L+
Sbjct: 1   MIPVFEGEVLVARPDPIG-IITACHGDT-KDVRAGQRFTRDECRARLEQRLIEHAEPVLK 58

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KKWT 147
            +P LK  + N+L A   F +N+G   Y  ST  +R +A DW  A            +W 
Sbjct: 59  CTPDLKGHA-NQLAAAVSFAYNIGPVAYCGSTTAKRFNAGDWRGACRAMNESDGGRPQWV 117

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
            AGG+VLPGLVKRR AE +L 
Sbjct: 118 TAGGRVLPGLVKRRAAERELC 138


>gi|307578196|gb|ADN62165.1| phage-related lysozyme [Xylella fastidiosa subsp. fastidiosa GB514]
          Length = 190

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L+ Y    GG  TIGYG TG  V  G+ +T ++  D  L+       L 
Sbjct: 9   IALIKFFEGCKLSPY-TCPGGVLTIGYGETGKHVVPGLRLTNEQEADARLRA-----RLA 62

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++     + ++++  A+    FN+G G +++ST  ++++A D   AAE+   W 
Sbjct: 63  KEFEPAVRRHVKVTLAQHQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAEQFHVWK 122

Query: 148 KAGGKV 153
            AGG +
Sbjct: 123 WAGGSI 128


>gi|157369116|ref|YP_001477105.1| glycoside hydrolase family protein [Serratia proteamaculans 568]
 gi|157320880|gb|ABV39977.1| glycoside hydrolase family 24 [Serratia proteamaculans 568]
          Length = 170

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 71/138 (51%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ +FEG RL+ Y+    G WT G GHT + V  G  I E++A   L++D  +++   
Sbjct: 33  LRLIADFEGCRLSPYQ-CSAGIWTNGIGHT-AGVKSGSVINERQAAANLIEDV-RTVEHG 89

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           +    A++   +    AV+ F FN+G+     ST    +  Q W+ A ++  +W    G 
Sbjct: 90  IARCMAVE-MPQPVYDAVSAFAFNVGVSAACNSTLATFIKRQQWQAACDQLPRWIYVKGV 148

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL +RR AE  L L+
Sbjct: 149 KSQGLERRRHAERALCLQ 166


>gi|77864683|ref|YP_355393.1| gp58 [Burkholderia phage Bcep176]
 gi|161520434|ref|YP_001583861.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC
           17616]
 gi|189353375|ref|YP_001949002.1| bacteriophage lysozyme [Burkholderia multivorans ATCC 17616]
 gi|76885869|gb|ABA60059.1| gp58 [Burkholderia phage Bcep176]
 gi|160344484|gb|ABX17569.1| glycoside hydrolase family 24 [Burkholderia multivorans ATCC 17616]
 gi|189337397|dbj|BAG46466.1| bacteriophage lysozyme [Burkholderia multivorans ATCC 17616]
          Length = 165

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 71/145 (48%), Gaps = 11/145 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
             ++ +FEGL L A  D  G   T   G T  DV  G   T  E    L +   +    +
Sbjct: 22  FSIVPKFEGLELVARPDPIG-IITACNGDT-KDVRAGQRFTPDECRARLEQRLIEHAEPV 79

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KK 145
           L+ +P+LK  +  +L A   F +N+G G Y  ST  +R ++ DW+ A            +
Sbjct: 80  LKCTPSLKGHT-YQLAAAVSFAYNVGSGAYCSSTTAKRFNSGDWKGACRALNEADNGRPQ 138

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLE 170
           W  AGG+VLPGLVKRR AE + L E
Sbjct: 139 WVTAGGRVLPGLVKRR-AEERALCE 162


>gi|28199208|ref|NP_779522.1| phage-related lysozyme [Xylella fastidiosa Temecula1]
 gi|28057314|gb|AAO29171.1| phage-related lysozyme [Xylella fastidiosa Temecula1]
          Length = 206

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 68/126 (53%), Gaps = 11/126 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L+ Y    GG  TIGYG TG  V  G+ +T ++  D  L+       L 
Sbjct: 25  IALIKFFEGCKLSPY-TCPGGVLTIGYGETGKHVVPGLRLTNEQEADARLRA-----RLA 78

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++     + ++++  A+    FN+G G +++ST  ++++A D   AAE+   W 
Sbjct: 79  KEFEPAVRRHVKVTLAQHQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAEQFHVWK 138

Query: 148 KAGGKV 153
            AGG +
Sbjct: 139 WAGGSI 144


>gi|309795379|ref|ZP_07689797.1| phage lysozyme [Escherichia coli MS 145-7]
 gi|308121029|gb|EFO58291.1| phage lysozyme [Escherichia coli MS 145-7]
          Length = 171

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        AV  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLK 167


>gi|322700831|gb|EFY92583.1| glycoside hydrolase family 24 protein [Metarhizium acridum CQMa
           102]
          Length = 489

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 79/160 (49%), Gaps = 39/160 (24%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAW-TIGYGH-----------------TGSD----VTEGM 70
           +K +  FEG     YRD G     T+GYGH                 + +D    +++ M
Sbjct: 29  VKFISGFEGWSDHVYRDPGPQHLETLGYGHLCKKPNCAEVKYPFPPLSKADGLKLLSDDM 88

Query: 71  TITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR 130
           ++    AE+ + KD +  + L           + N+  A+  + FN+G GN   S   +R
Sbjct: 89  SV----AENCIYKDVNPKVAL-----------NANQYGALVSWAFNVGCGNVASSRLIRR 133

Query: 131 VDA-QDWEK-AAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           ++A +D    AA+E  +W KAGGKVLPGL +RR+AEV+L 
Sbjct: 134 LNAGEDPNTVAAQELPQWNKAGGKVLPGLTRRRNAEVELF 173


>gi|331676614|ref|ZP_08377310.1| putative lysozyme [Escherichia coli H591]
 gi|331075303|gb|EGI46601.1| putative lysozyme [Escherichia coli H591]
          Length = 170

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  + ++W   
Sbjct: 92  KRCVKQQPPQKVYD-----AAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLQRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|331672369|ref|ZP_08373160.1| putative lysozyme [Escherichia coli TA280]
 gi|331070564|gb|EGI41928.1| putative lysozyme [Escherichia coli TA280]
          Length = 180

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 43  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 100

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        AV  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 101 ERCVKQQPPQKVYD-----AVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 155

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 156 KGVFNQGLDNRRAREMAWCLK 176


>gi|187477836|ref|YP_785860.1| phage lysozyme [Bordetella avium 197N]
 gi|115422422|emb|CAJ48947.1| Phage lysozyme [Bordetella avium 197N]
          Length = 151

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 46/143 (32%), Positives = 74/143 (51%), Gaps = 6/143 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRD-IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS 86
           V +A I ++  +EG  L AY D +G      G+ H    V  G   T +  +    ++  
Sbjct: 10  VVSAAIALVAAWEGRSLIAYADPVGIPTICEGFTH---GVKLGDVATPERCDALTEQEVR 66

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
           ++L ++  S P  +   ++  VA+A FV+N+G G Y  ST  +++ A D   A  E  +W
Sbjct: 67  RALAVVDGSVP--RPLPDSVRVALASFVYNVGPGAYGGSTLTRKLRAGDLAGACRELPRW 124

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
             AGG  L GL +RRDAE+++ L
Sbjct: 125 VYAGGTKLRGLERRRDAEMRICL 147


>gi|26246847|ref|NP_752887.1| Fels-2 prophage: prophage lysozyme [Escherichia coli CFT073]
 gi|306812725|ref|ZP_07446918.1| putative lysozyme protein R of prophage [Escherichia coli NC101]
 gi|26107247|gb|AAN79430.1|AE016758_34 Fels-2 prophage: probable prophage lysozyme [Escherichia coli
           CFT073]
 gi|305853488|gb|EFM53927.1| putative lysozyme protein R of prophage [Escherichia coli NC101]
 gi|324009692|gb|EGB78911.1| phage lysozyme [Escherichia coli MS 57-2]
          Length = 170

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        +V  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----SVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|218700163|ref|YP_002407792.1| putative lysozyme protein R of prophage [Escherichia coli IAI39]
 gi|218370149|emb|CAR17939.1| putative lysozyme protein R of prophage [Escherichia coli IAI39]
          Length = 170

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        +V  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----SVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|331662236|ref|ZP_08363159.1| putative lysozyme [Escherichia coli TA143]
 gi|331060658|gb|EGI32622.1| putative lysozyme [Escherichia coli TA143]
          Length = 170

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG  L  Y+    G WT G G+T S V  G TITE++A + L+ +     +SL
Sbjct: 34  LKLIADYEGCHLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERSL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        AV  F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AVVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|167577662|ref|ZP_02370536.1| glycoside hydrolase family 24 [Burkholderia thailandensis TXDOH]
          Length = 169

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 50/144 (34%), Positives = 67/144 (46%), Gaps = 10/144 (6%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L+ ++  FEG  L A  D  G   T  +G T  DV  G   T +E    L +   +    
Sbjct: 25  LLSIVPAFEGEVLVARPDPIGIV-TACHGDT-KDVRAGQRFTPEECRARLEQRLIEHAEP 82

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L+ +P LK  +  +L A   F +N+G   Y  ST  +R  A DW  A            
Sbjct: 83  VLKCTPGLKGHT-YQLAAAVSFAYNVGANAYCNSTTAKRFSAGDWRGACRALNESDSGRP 141

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLL 168
           +W  AGG+VLPGLVKRR AE  L 
Sbjct: 142 QWVTAGGRVLPGLVKRRAAERALC 165


>gi|75910618|ref|YP_324914.1| glycoside hydrolase family protein [Anabaena variabilis ATCC 29413]
 gi|75704343|gb|ABA24019.1| Glycoside hydrolase, family 24 [Anabaena variabilis ATCC 29413]
          Length = 243

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 85/177 (48%), Gaps = 16/177 (9%)

Query: 4   INRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDI--GGGAWTIGYGH 61
           I R I   K   G +G     K+P+P   + ++KEFEG +L AY D    G  +TIG+G 
Sbjct: 72  IQRQIEIAKLYGGASG-----KLPLPG--VNLIKEFEGCKLIAYPDPLSKGKPYTIGWGS 124

Query: 62  T----GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNL 117
           T    GS+ + G  IT+ EA++ L+    +     LE     +  +  +  A+  F +NL
Sbjct: 125 TVKKDGSEWSLGEKITQVEADELLIFQLERKYLPPLERILRWEDFNPYQQGALLSFAYNL 184

Query: 118 GIGNYNKSTFK---QRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           G   Y    F+   + ++ Q+W+K       +   G  V  GL +RR AE KL L+ 
Sbjct: 185 GANFYGSKGFETITRVLNNQEWDKIEPTLIMYRNPGSPVEAGLRRRRVAEAKLFLQP 241


>gi|38707815|ref|NP_944846.1| Lysin (lysozyme) [Enterobacteria phage Felix 01]
 gi|33340418|gb|AAQ14769.1| putative lysis protein [Enterobacteria phage Felix 01]
          Length = 154

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 55/147 (37%), Positives = 75/147 (51%), Gaps = 12/147 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSL 89
           ++ +K FEGL+L AY D   G  TIGYG     G  V  GM IT ++AE +LL D  K  
Sbjct: 8   LEAIKFFEGLKLEAYED-SAGIPTIGYGTIRIDGKPVKMGMKITAEQAEQYLLADVEK-- 64

Query: 90  NLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             +   + A+K  TS+N   A+    +N+GI     STF +R +A +    AE  + W K
Sbjct: 65  -FVAAVNKAIKVPTSQNEFDALVSETYNIGITAMQDSTFIKRHNAGNKVGCAEAMQWWNK 123

Query: 149 A---GGKVLP-GLVKRRDAEVKLLLES 171
               G KV   GL  RR  E  + L+S
Sbjct: 124 VTVKGQKVTSNGLKNRRRMEADIYLDS 150


>gi|323973825|gb|EGB68999.1| phage lysozyme [Escherichia coli TA007]
          Length = 169

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 63/138 (45%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ + EG RLT Y+    G WT G GHT   V +G  ITE++A   L+ D       L
Sbjct: 33  LALIADLEGCRLTPYQ-CSAGVWTSGIGHTAGVVPKG-EITERQAAANLVADVLNVEKRL 90

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              +P       +   A+  F FN+G G   +ST    +  Q W +A ++  +W    G+
Sbjct: 91  AVCAPV--KMPPHVYDALVSFSFNVGTGAACRSTLVSFIKRQQWPQACDQLTRWVYVNGE 148

Query: 153 VLPGLVKRRDAEVKLLLE 170
           V  GL  RR  E    L 
Sbjct: 149 VNKGLENRRARERTYCLR 166


>gi|256021053|ref|ZP_05434918.1| glycoside hydrolase family protein [Shigella sp. D9]
 gi|332282280|ref|ZP_08394693.1| phage lysozyme [Shigella sp. D9]
 gi|332104632|gb|EGJ07978.1| phage lysozyme [Shigella sp. D9]
          Length = 171

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     +SL
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERSL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLK 167


>gi|323190838|gb|EFZ76106.1| phage lysozyme family protein [Escherichia coli RN587/1]
          Length = 157

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 21  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 78

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  + ++W   
Sbjct: 79  ERCVKQQPPQKVYD-----AAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLQRWVYV 133

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 134 KGVFNQGLDNRRAREMAWCLQ 154


>gi|302891745|ref|XP_003044754.1| hypothetical protein NECHADRAFT_94402 [Nectria haematococca mpVI
           77-13-4]
 gi|256725679|gb|EEU39041.1| hypothetical protein NECHADRAFT_94402 [Nectria haematococca mpVI
           77-13-4]
          Length = 262

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 51/162 (31%), Positives = 80/162 (49%), Gaps = 19/162 (11%)

Query: 16  GMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-----DVTEGM 70
           G  G  K N+     A + ++  FEG R   Y+D  G   T+GYGH  S     DV   +
Sbjct: 96  GSCGAPKSNQ-----ATVNLIASFEGFRANIYKDAAGYP-TVGYGHLCSNSKCTDVKYSI 149

Query: 71  TITEKEAEDFLLKDASK---SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTF 127
            +++   +  L  D +K    +  +++S+  L   ++N+  A+  + FN G G    ST 
Sbjct: 150 PLSQANGKKLLASDMAKFEKCITAMVKSNVKL---NKNQYGALVSWSFNNGCGAAKTSTL 206

Query: 128 KQRVDAQDWEKA--AEECKKWTKAGGKVLPGLVKRRDAEVKL 167
            +R++  +      ++E  KW  AGGK L GLV+RR AEV L
Sbjct: 207 IKRLNKGEAPNTVISQELPKWVYAGGKKLNGLVRRRKAEVAL 248


>gi|198241915|ref|YP_002216719.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|215485959|ref|YP_002328390.1| predicted lysozyme [Escherichia coli O127:H6 str. E2348/69]
 gi|218690758|ref|YP_002398970.1| putative lysozyme protein R of prophage [Escherichia coli ED1a]
 gi|312969103|ref|ZP_07783310.1| phage lysozyme family protein [Escherichia coli 2362-75]
 gi|197936431|gb|ACH73764.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|215264031|emb|CAS08372.1| predicted lysozyme [Escherichia coli O127:H6 str. E2348/69]
 gi|218428322|emb|CAR09248.2| putative lysozyme protein R of prophage [Escherichia coli ED1a]
 gi|312286505|gb|EFR14418.1| phage lysozyme family protein [Escherichia coli 2362-75]
 gi|326624476|gb|EGE30821.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 170

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|157160350|ref|YP_001457668.1| phage lysozyme [Escherichia coli HS]
 gi|213162916|ref|ZP_03348626.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. E00-7866]
 gi|213419343|ref|ZP_03352409.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. E01-6750]
 gi|213424728|ref|ZP_03357478.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. E02-1180]
 gi|213583393|ref|ZP_03365219.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-0664]
 gi|213608007|ref|ZP_03368833.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-2068]
 gi|213645978|ref|ZP_03376031.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. J185]
 gi|213852883|ref|ZP_03382415.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. M223]
 gi|289809816|ref|ZP_06540445.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. AG3]
 gi|157066030|gb|ABV05285.1| phage lysozyme [Escherichia coli HS]
 gi|320177422|gb|EFW52422.1| Prophage lysozyme ; Phage lysin [Shigella dysenteriae CDC 74-1112]
 gi|320199059|gb|EFW73656.1| Prophage lysozyme ; Phage lysin [Escherichia coli EC4100B]
 gi|323938226|gb|EGB34486.1| phage lysozyme [Escherichia coli E1520]
 gi|323946311|gb|EGB42343.1| phage lysozyme [Escherichia coli H120]
 gi|324112694|gb|EGC06670.1| phage lysozyme [Escherichia fergusonii B253]
          Length = 170

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|323942742|gb|EGB38907.1| phage lysozyme [Escherichia coli E482]
          Length = 170

 Score = 68.2 bits (165), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----AAVSFAFNVGTGNACNSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|39970045|ref|XP_366413.1| hypothetical protein MGG_10631 [Magnaporthe oryzae 70-15]
 gi|145010069|gb|EDJ94725.1| hypothetical protein MGG_10631 [Magnaporthe oryzae 70-15]
          Length = 357

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 75/149 (50%), Gaps = 14/149 (9%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLLKD 84
            A + ++KEFEG     Y D  G   T+GYGH     T S+V   + ++    E  L  D
Sbjct: 199 QASLDLVKEFEGWFPDIYLDPVG-LPTVGYGHLCSNPTCSEVPYPIPLSVANGEALLQSD 257

Query: 85  ---ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--A 139
              A + L+  L  S  L     N+  A+  +VFN+G G    ST   R++A + +   A
Sbjct: 258 LGIARRCLSADLVDSVVLN---PNQYGALVSWVFNMGCGAQKSSTLTARLNAGEDKSVVA 314

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            +E  +W  AGG+VL GLV+RR AEV L 
Sbjct: 315 RQELPRWVYAGGQVLNGLVRRRAAEVALF 343


>gi|315121788|ref|YP_004062277.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495190|gb|ADR51789.1| phage-related lysozyme [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 54

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 41/54 (75%), Gaps = 1/54 (1%)

Query: 28 VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL 81
          +P  LI ++K+FEGLRL+AYR      WTIGYGHTG+DV E + ITE++A+D L
Sbjct: 1  MPQLLIDLIKKFEGLRLSAYR-CPASIWTIGYGHTGNDVFEDLGITEQQADDLL 53


>gi|222034338|emb|CAP77079.1| Fels-2 prophage: prophage lysozyme [Escherichia coli LF82]
 gi|323185213|gb|EFZ70578.1| phage lysozyme family protein [Escherichia coli 1357]
 gi|323963876|gb|EGB59370.1| phage lysozyme [Escherichia coli M863]
 gi|327252347|gb|EGE64019.1| phage lysozyme family protein [Escherichia coli STEC_7v]
          Length = 171

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W +A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWAEACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLK 167


>gi|298290051|ref|YP_003691990.1| glycoside hydrolase family 24 [Starkeya novella DSM 506]
 gi|296926562|gb|ADH87371.1| glycoside hydrolase family 24 [Starkeya novella DSM 506]
          Length = 196

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 72/140 (51%), Gaps = 8/140 (5%)

Query: 29  PNALI----KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           P A++     ++K +EGLRL AYRDI G  WTI YG T   V  GM  T  E E  L + 
Sbjct: 41  PAAVVLAAEHIIKGWEGLRLIAYRDIVG-VWTICYGET-KGVRAGMRKTAAECEALLYER 98

Query: 85  ASKSLNLLLES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
             +   + + +  +PA          A+    +N G+G +  ST  + + A+ W +A + 
Sbjct: 99  VYRDFYIPMSACAAPAFVQAPVPVQAAMLGGGYNFGVGGWCGSTTARYIRAKLWRQACDA 158

Query: 143 CKKWTKAGGKVLPGLVKRRD 162
              W +AGGKV+ GLV RR+
Sbjct: 159 QTAWNRAGGKVVQGLVNRRE 178


>gi|323172211|gb|EFZ57849.1| phage lysozyme family protein [Escherichia coli LT-68]
          Length = 157

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 21  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 78

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 79  ERCVKQQPPQKVYD-----AAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 133

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 134 KGVFNQGLDNRRAREMAWCLQ 154


>gi|213027109|ref|ZP_03341556.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. 404ty]
          Length = 171

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/139 (30%), Positives = 68/139 (48%), Gaps = 5/139 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +  +     
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAA 91

Query: 93  LESSPALKSTSENRLV-AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           LE    +K     ++  A   F FN+G GN   ST  + ++ + W  A  +  +W    G
Sbjct: 92  LER--CVKQQPPQKVYDAAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYVKG 149

Query: 152 KVLPGLVKRRDAEVKLLLE 170
               GL  RR  E+   L+
Sbjct: 150 VFNQGLDNRRAREMAWCLQ 168


>gi|16762256|ref|NP_457873.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|29143745|ref|NP_807087.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|25289385|pir||AI0927 probable lysozyme nucD [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16504560|emb|CAD09443.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29139380|gb|AAO70947.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|315615250|gb|EFU95886.1| phage lysozyme family protein [Escherichia coli 3431]
          Length = 157

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 21  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 78

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 79  ERCVKQQPPQKVYD-----AAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 133

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 134 KGVFNQGLDNRRAREMAWCLQ 154


>gi|302652563|ref|XP_003018128.1| hypothetical protein TRV_07824 [Trichophyton verrucosum HKI 0517]
 gi|291181740|gb|EFE37483.1| hypothetical protein TRV_07824 [Trichophyton verrucosum HKI 0517]
          Length = 192

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 73/146 (50%), Gaps = 8/146 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           I ++K FEG       D   G  T+GYGH       S+V     +TE+ A + L++D   
Sbjct: 38  IALIKHFEGFVPRPAPD-PIGLPTVGYGHLCRTNGCSEVPFSFPLTEETATELLMQDVKS 96

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKAA-EECKK 145
               +  S+      + N+  A+  + +N+G     KS+   R++  QD +    EE   
Sbjct: 97  PQQSITLSTTDQVVLNANQYGALVSWAYNVGGDAAKKSSLISRLNQGQDVDVVIREELPL 156

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLES 171
           W KAGG VLPGLV+RR AEV+L  E+
Sbjct: 157 WNKAGGHVLPGLVRRRAAEVELASEN 182


>gi|82543319|ref|YP_407266.1| lysozyme protein R of prophage CP-933K [Shigella boydii Sb227]
 gi|81244730|gb|ABB65438.1| putative lysozyme protein R of prophage CP-933K [Shigella boydii
           Sb227]
 gi|320185719|gb|EFW60475.1| Prophage lysozyme ; Phage lysin [Shigella flexneri CDC 796-83]
 gi|332097158|gb|EGJ02141.1| phage lysozyme family protein [Shigella boydii 3594-74]
          Length = 170

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  EKCVKQQPPQKVYD-----AAVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|330996229|ref|ZP_08320119.1| phage lysozyme [Paraprevotella xylaniphila YIT 11841]
 gi|329573733|gb|EGG55324.1| phage lysozyme [Paraprevotella xylaniphila YIT 11841]
          Length = 171

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 59/149 (39%), Positives = 76/149 (51%), Gaps = 12/149 (8%)

Query: 22  KHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL 81
           K+  +   N LI+ +K FEG R TAY+    G WTIGYGHT   V  G  +TE EAE  L
Sbjct: 21  KNVDMKASNTLIEAIKRFEGFRGTAYK-CPAGVWTIGYGHT-VGVKRGDKMTEGEAERQL 78

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTF--KQRVDAQDWEKA 139
            +D ++    + +      +  +N+  A+ DF +NLG      ST   K R  A D E  
Sbjct: 79  RRDLAEYEAFVDKLGV---TERQNKFDALVDFAYNLGCDALAGSTLLKKIRACAPDAEVR 135

Query: 140 AEECKKW---TKAGGKV-LPGLVKRRDAE 164
           A E  +W   T AG K  L GLVKRR  E
Sbjct: 136 A-EFMRWVYATVAGKKRKLDGLVKRRKWE 163


>gi|91794604|ref|YP_564255.1| glycoside hydrolase family protein [Shewanella denitrificans OS217]
 gi|91716606|gb|ABE56532.1| glycoside hydrolase, family 24 [Shewanella denitrificans OS217]
          Length = 159

 Score = 67.8 bits (164), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 53  GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVAD 112
           G  T  +GHTG D+  GM  +  +    L  D  K    L + +PAL   +E   +A   
Sbjct: 39  GVSTACFGHTGKDIKVGMVFSRDQCLKLLATDLDKFNQALRKLAPAL---TEGEHIAYLS 95

Query: 113 FVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           F++N+G   ++ ST +++    +   A +E  +W  A G+ LPGLVKRR  E +  + 
Sbjct: 96  FIYNVGTEAFSTSTLRKKFLNGERVAACDELLRWVYAKGRRLPGLVKRRSNERRFCMR 153


>gi|167647120|ref|YP_001684783.1| glycoside hydrolase family protein [Caulobacter sp. K31]
 gi|167349550|gb|ABZ72285.1| glycoside hydrolase family 24 [Caulobacter sp. K31]
          Length = 417

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 8/146 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A + ++K FEG R+ A + +  G WT+GYGHT +    G +++E++AE  LL D   
Sbjct: 7   VSRAAVDLIKRFEGYRMKAAQ-LPDGRWTLGYGHTLT-ARAGASVSEQDAEALLLYDLIT 64

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
             + + E+       ++N+  A+  F FN+G  N+ +S   +R++     +AA   + W 
Sbjct: 65  VAHAVNEN--IYTPLNQNQFDALVCFAFNIGTENFIRSGVLRRLNEGSLLQAACAMEMWR 122

Query: 148 KAGGK----VLPGLVKRRDAEVKLLL 169
           KA  +    V+  LV+RR AE  L L
Sbjct: 123 KADFEGERIVIDALVRRRSAEKTLFL 148


>gi|114765577|ref|ZP_01444678.1| Phage-related lysozyme [Pelagibaca bermudensis HTCC2601]
 gi|114542026|gb|EAU45059.1| Phage-related lysozyme [Roseovarius sp. HTCC2601]
          Length = 263

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 49/169 (28%), Positives = 74/169 (43%), Gaps = 19/169 (11%)

Query: 18  NGDDKHNKIPVPNAL--------------IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG 63
            G   H+  PV  A+              I ++ ++EGL   AYRD  G  WT+ YG T 
Sbjct: 93  TGQRAHDPAPVAPAVSQAQAAEAAFLDVAIPLVSKWEGLETEAYRDPVG-IWTVCYGET- 150

Query: 64  SDVTEGMTITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
             V  G   T ++  + L   + +    L+    +    +     R  A +   +N+G+ 
Sbjct: 151 QGVQPGDQYTAEQCAEMLGRRILEYRAGLHRHFTADTRARRLPPTRDAAYSSLAYNVGVS 210

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
              KST  +R++A D     E    W KAGG+VL GLV RR  E +L +
Sbjct: 211 AAGKSTATRRLNAGDVPGGCEALTWWNKAGGRVLRGLVNRRTDERRLCM 259


>gi|331646092|ref|ZP_08347195.1| putative lysozyme [Escherichia coli M605]
 gi|330910608|gb|EGH39118.1| prophage lysozyme ; Phage lysin [Escherichia coli AA86]
 gi|331044844|gb|EGI16971.1| putative lysozyme [Escherichia coli M605]
          Length = 171

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLK 167


>gi|170020771|ref|YP_001725725.1| glycoside hydrolase family protein [Escherichia coli ATCC 8739]
 gi|169755699|gb|ACA78398.1| glycoside hydrolase family 24 [Escherichia coli ATCC 8739]
          Length = 171

 Score = 67.4 bits (163), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 68/141 (48%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLK 167


>gi|315498135|ref|YP_004086939.1| glycoside hydrolase family 24 [Asticcacaulis excentricus CB 48]
 gi|315416147|gb|ADU12788.1| glycoside hydrolase family 24 [Asticcacaulis excentricus CB 48]
          Length = 810

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Composition-based stats.
 Identities = 51/148 (34%), Positives = 80/148 (54%), Gaps = 12/148 (8%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           +  A ++++K FEGLR  A + +  G W IGYGHT S   EG  +T ++A+  L  D   
Sbjct: 7   ISRAGVELIKSFEGLRQQASQ-LPDGRWMIGYGHTFS-AREGARVTAEDADALLRFD--- 61

Query: 88  SLNLLLESSPALKST--SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            L  ++E+   L  T  ++N+  A+  F FN+GI  + +S   +RV+     +AA+    
Sbjct: 62  -LLPIVEAVNNLVHTPLTQNQFDALVSFCFNIGIEAFGQSDVLRRVNEGRVTEAAQAMDN 120

Query: 146 WTKA--GGK--VLPGLVKRRDAEVKLLL 169
           WT A   G+  VL  L++RR +E  L L
Sbjct: 121 WTSAEFNGQTYVLAPLIRRRASEKSLFL 148


>gi|238761974|ref|ZP_04622947.1| Phage lysozyme [Yersinia kristensenii ATCC 33638]
 gi|238699702|gb|EEP92446.1| Phage lysozyme [Yersinia kristensenii ATCC 33638]
          Length = 168

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 71/131 (54%), Gaps = 3/131 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG + TAY D+ G   T+  GHTG D+  G   +++E +  L +D  + +   ++++  
Sbjct: 31  LEGRKYTAYYDVAG-VLTLCDGHTGHDIIRGKHYSDQECDALLQRDL-QPVKKWVDNAVQ 88

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
           +      R  A+  F +N+G   + +ST  +++++ D   A +E ++W  AGG+   GL+
Sbjct: 89  VPIGDYTR-AALYSFTYNVGYSAFIQSTLLKKLNSGDISAACDELRRWIMAGGQRWQGLI 147

Query: 159 KRRDAEVKLLL 169
            RR+ E +L L
Sbjct: 148 NRREVERELCL 158


>gi|260599218|ref|YP_003211789.1| putative lysozyme from lambdoid prophage DLP12 [Cronobacter
           turicensis z3032]
 gi|260218395|emb|CBA33467.1| Probable lysozyme from lambdoid prophage DLP12 [Cronobacter
           turicensis z3032]
          Length = 162

 Score = 67.0 bits (162), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 70/133 (52%), Gaps = 3/133 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
            +++ EG+ LT YRD  G   TI  G T  DV  G T +E+E    L K    ++  +  
Sbjct: 28  FIEQQEGVSLTPYRDPVGIP-TICAGITSVDVITGKTYSERECRVLLAKHMQPAVEAV-- 84

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           +     + ++ +  A+  F +N+G+  + +ST   +++  D   A +E ++WT AGG+  
Sbjct: 85  NRGVRVTLNDYQKAALYSFTYNVGVSAFRRSTLLAKLNRHDLTGACDELRRWTWAGGRQW 144

Query: 155 PGLVKRRDAEVKL 167
            GL+ RR+ E +L
Sbjct: 145 QGLITRREMERQL 157


>gi|169868484|ref|XP_001840813.1| lysozyme [Coprinopsis cinerea okayama7#130]
 gi|116497971|gb|EAU80866.1| lysozyme [Coprinopsis cinerea okayama7#130]
          Length = 262

 Score = 67.0 bits (162), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/149 (34%), Positives = 74/149 (49%), Gaps = 14/149 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           ++ +K++EG   +   D  G   T+GYGH       S+V     +TE +A   L  D   
Sbjct: 99  VEHIKQWEGFVKSPAPDPIG-LPTVGYGHLCKTKGCSEVPYKFPLTEAQATSLLKTDLKT 157

Query: 88  SLNLLLESSPALKST---SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAEE 142
             N +   S  LK +   + N+  A+  + FN+G GN + S    R++  +     A++E
Sbjct: 158 FQNCI---SSQLKDSVRLNANQYGALVSWAFNVGCGNTSGSALISRLNKGESPNTVASQE 214

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
             KW KAGGKVL GLV RR AEV L   S
Sbjct: 215 LPKWNKAGGKVLQGLVNRRKAEVTLFKTS 243


>gi|71902392|ref|ZP_00684356.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
 gi|71727880|gb|EAO30117.1| Glycoside hydrolase, family 24 [Xylella fastidiosa Ann-1]
          Length = 148

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 66/129 (51%), Gaps = 11/129 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L  Y    GG  TIGYG TG  V  G+ +T ++  D +L+       L 
Sbjct: 25  IALIKFFEGCKLIPY-TCPGGVLTIGYGETGKHVVPGLRLTNEQEADAMLRA-----RLA 78

Query: 93  LESSPALK-----STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            E  PA++        + +  A+    FN+G G +++ST  ++++A D   AA++   W 
Sbjct: 79  KEFEPAVRRYVRVPLKQQQFDALVSLSFNIGAGAFHRSTLLRKLNAGDVAGAAQQFHVWK 138

Query: 148 KAGGKVLPG 156
            AGG +  G
Sbjct: 139 WAGGSIQQG 147


>gi|204929489|ref|ZP_03220563.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|204321208|gb|EDZ06408.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
          Length = 169

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  EKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|16421261|gb|AAL21602.1| Fels-2 prophage protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|312913736|dbj|BAJ37710.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. T000240]
          Length = 169

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMTWCLK 167


>gi|169868498|ref|XP_001840820.1| lysozyme [Coprinopsis cinerea okayama7#130]
 gi|116497978|gb|EAU80873.1| lysozyme [Coprinopsis cinerea okayama7#130]
          Length = 268

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 51/153 (33%), Positives = 76/153 (49%), Gaps = 16/153 (10%)

Query: 27  PVPNALIKMLKEFEG-LRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDF 80
           PV +  ++ +K  EG +R  A   IG    T+GYGH       S+V     +TE +A   
Sbjct: 108 PVNSRTVQEIKNSEGFVRSPAPDPIG--LPTVGYGHLCKNKGCSEVPYSFPLTEAQATSL 165

Query: 81  LLKDA---SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137
           L+ D     K ++  +  S  L   +EN+  A+  + FN+G GN   S    R++  +  
Sbjct: 166 LMTDLKTFQKCISDQINDSIRL---NENQYGALVSWAFNVGCGNTASSALISRLNKGESP 222

Query: 138 K--AAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              A EE  +W  AGG+VLPGLV RR+ E+ L 
Sbjct: 223 NKVAEEELPRWKYAGGQVLPGLVARRNREIALF 255


>gi|213424711|ref|ZP_03357461.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Typhi
           str. E02-1180]
 gi|213645983|ref|ZP_03376036.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Typhi
           str. J185]
 gi|213852891|ref|ZP_03382423.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Typhi
           str. M223]
          Length = 169

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  EKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|34335046|gb|AAQ65021.1| unknown [synthetic construct]
 gi|323131058|gb|ADX18488.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. 4/74]
          Length = 169

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|288549714|ref|ZP_05967950.2| putative phage lysozyme [Enterobacter cancerogenus ATCC 35316]
 gi|288318019|gb|EFC56957.1| putative phage lysozyme [Enterobacter cancerogenus ATCC 35316]
          Length = 160

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/132 (30%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ + EG RLT Y+    G WT G GHT   V +G  ITE++A   L+ D       L
Sbjct: 24  LALIADLEGCRLTPYQ-CSAGVWTSGIGHTAGVVPKG-EITERQAAANLVADVMTVEKRL 81

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              +P      ++   A+  F FN+G G   +ST    +    W +A ++  +W    G 
Sbjct: 82  AVCAPV--EMPQHVYDALVSFSFNVGTGAACRSTLVSYIKRHQWWQACDQLTRWVYVNGS 139

Query: 153 VLPGLVKRRDAE 164
           +  GL  RR  E
Sbjct: 140 INKGLENRRTRE 151


>gi|197248284|ref|YP_002147647.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|200386682|ref|ZP_03213294.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|296104751|ref|YP_003614897.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
 gi|197211987|gb|ACH49384.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Agona
           str. SL483]
 gi|199603780|gb|EDZ02325.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|295059210|gb|ADF63948.1| phage lysozyme [Enterobacter cloacae subsp. cloacae ATCC 13047]
          Length = 169

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|226940481|ref|YP_002795555.1| Lysozyme [Laribacter hongkongensis HLHK9]
 gi|226715408|gb|ACO74546.1| Lysozyme [Laribacter hongkongensis HLHK9]
          Length = 154

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/125 (36%), Positives = 61/125 (48%), Gaps = 3/125 (2%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG R TAY  + G   TIG+G T   V  G  IT  +A    L D  K    L +     
Sbjct: 24  EGYRDTAYIPVPGDVPTIGFGTT-EGVKMGDRITPPKALARALTDVQKFEGALKQC--VR 80

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
               ++   A     +N+G G +  ST  ++++A D+  A  E  +WT AGGK LPGLVK
Sbjct: 81  VPLHQHEYDAFVSLAYNIGSGAFCGSTLVRKLNAGDYAGACAEIDRWTYAGGKRLPGLVK 140

Query: 160 RRDAE 164
           RR  E
Sbjct: 141 RRAEE 145


>gi|260599025|ref|YP_003211596.1| hypothetical protein CTU_32330 [Cronobacter turicensis z3032]
 gi|260218202|emb|CBA33076.1| hypothetical protein CTU_32330 [Cronobacter turicensis z3032]
          Length = 150

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 64/138 (46%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ + EG RL  Y+    G WT G GHT + V     ITE+EA   L+ D  K    L
Sbjct: 14  LALIGDLEGCRLKPYQ-CSAGVWTSGIGHT-AGVVPARDITEREAAVNLVGDVLKVEKAL 71

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              +P   +       AV  F FN+G G   +ST    ++A+ W +A ++  +W    G 
Sbjct: 72  AVCAPV--AMPPPVYDAVVSFSFNVGTGAACRSTLMGFINAKKWAQACDQLPRWVYVNGV 129

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E  L L+
Sbjct: 130 RNAGLENRRARERALCLK 147


>gi|85707728|ref|ZP_01038794.1| Gifsy-2 prophage lysozyme [Erythrobacter sp. NAP1]
 gi|85689262|gb|EAQ29265.1| Gifsy-2 prophage lysozyme [Erythrobacter sp. NAP1]
          Length = 265

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 54/167 (32%), Positives = 85/167 (50%), Gaps = 26/167 (15%)

Query: 21  DKHNKIPVPNALIKMLKEFEG---LR----LTAYRD--IGGGAWTIGYGHTGSDVTEGM- 70
           D+ +   +  A I ++K+FEG   LR    + AY D   GG  WTIG+G TG D   G+ 
Sbjct: 101 DRKSPRRIGEAGIALIKQFEGCAQLRRDGLVGAYPDPGTGGDPWTIGWGATGIDDQTGLG 160

Query: 71  ------TI-TEKEAEDFLLKDASK---SLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
                 T+ T+ + +  L +D  +    +   + S+P    T++ +  A+  F +N G  
Sbjct: 161 ERIGPATVWTQDQCDARLARDLERYAAEVAHAIGSAP----TTQGQFDALVSFHYNTGA- 215

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
             +K+T  ++  A D+  A  E  +W  AGG+VL GLV+RR  E KL
Sbjct: 216 -IHKATLTKKHKAGDYAGAVAEFARWKHAGGRVLKGLVRRRAEEAKL 261


>gi|16763085|ref|NP_458702.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhi str.
           CT18]
 gi|29144567|ref|NP_807909.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|56414679|ref|YP_151754.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197363606|ref|YP_002143243.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|213163831|ref|ZP_03349541.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi str. E00-7866]
 gi|213416691|ref|ZP_03349835.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi str. E01-6750]
 gi|25289386|pir||AI1036 probable lysozyme nucD2 [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|16505393|emb|CAD06742.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi]
 gi|29140205|gb|AAO71769.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi str. Ty2]
 gi|56128936|gb|AAV78442.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. ATCC 9150]
 gi|197095083|emb|CAR60629.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Paratyphi A str. AKU_12601]
          Length = 156

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 21  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 79  EKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 136

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 137 FNQGLDNRRAREMAWCLK 154


>gi|39546347|ref|NP_461643.2| prophage lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|169936041|ref|YP_001718740.1| endolysin [Enterobacteria phage Fels-2]
          Length = 158

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 23  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 80

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 81  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 138

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 139 FNQGLDNRRAREMTWCLK 156


>gi|312601724|gb|ADQ92398.1| lysozyme [Salmonella phage RE-2010]
          Length = 171

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 78/169 (46%), Gaps = 10/169 (5%)

Query: 2   CIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH 61
           C++  +++ V  + G      H  +      +K++ ++EG RL  Y+    G WT G G+
Sbjct: 9   CLVGAVLAIVATLPGF--QSLHTSV----EGLKLIADYEGCRLQPYQ-CSAGVWTDGIGN 61

Query: 62  TGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN 121
           T S V  G TITE++A   L+ +  +    L +    ++   +    AV  F FN+G GN
Sbjct: 62  T-SGVVPGKTITERQAAQGLITNVLRVERALDKC--VVQPMPQKVYDAVVSFAFNVGTGN 118

Query: 122 YNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
              ST  + ++ + W  A  +  +W    G    GL  RR  E+   L+
Sbjct: 119 ACSSTLVKLLNQRRWADACLQLPRWVYVKGVFNQGLDNRRAREMAWCLK 167


>gi|301159273|emb|CBW18788.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhimurium str. SL1344]
          Length = 156

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 21  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 79  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGV 136

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 137 FNQGLDNRRAREMAWCLK 154


>gi|259417292|ref|ZP_05741211.1| lysozyme [Silicibacter sp. TrichCH4B]
 gi|259346198|gb|EEW58012.1| lysozyme [Silicibacter sp. TrichCH4B]
          Length = 240

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 76/142 (53%), Gaps = 10/142 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I  + ++EGLR  AYRDI G  WT+ YG T   V  G + ++ E +  L ++      ++
Sbjct: 103 ISFIGQWEGLRTEAYRDIVG-VWTVCYGET-KGVRPGDSYSKAECDAMLAREI-----IV 155

Query: 93  LESSPALKSTSENRL---VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
            E++     T++  +   VA+  + +N+G     +ST  ++ +A D   A  E  +W +A
Sbjct: 156 YEAALDRCLTADVPIGMKVALVSWTYNVGPAAACRSTLLRKANAGDLTGACNELPRWNRA 215

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
           GG+V+ GL  RR +E  + L++
Sbjct: 216 GGRVIRGLANRRMSERAMCLKA 237


>gi|159029869|emb|CAO90923.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 256

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 80/163 (49%), Gaps = 26/163 (15%)

Query: 30  NALIKMLKEFEGLRLTAYRD--------IGGGAW---------TIGYGH----TGSDVTE 68
           +A ++++KEFEGL    +R           GG           TIG+G+    T  DV +
Sbjct: 96  DAGLELVKEFEGLHSRTFRSGPRRGQLVPNGGVTAYFDPVRVPTIGWGNIDSVTARDV-D 154

Query: 69  GMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFK 128
              IT  EAE+ L  D + + + +  S       ++N   A+  F FNLG G    ST +
Sbjct: 155 VKVITLLEAENLLRSDLASAEDAV--SDLITVPLNDNEFSALVSFTFNLGAGALQDSTLR 212

Query: 129 QRVDAQD--WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           +R++  D     A +E +KW  AGG+ LPGLV+RR AE  L L
Sbjct: 213 KRLNRGDNRVSIANDEFRKWVLAGGRELPGLVRRRKAERDLFL 255


>gi|321474562|gb|EFX85527.1| hypothetical protein DAPPUDRAFT_300287 [Daphnia pulex]
          Length = 280

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/143 (30%), Positives = 68/143 (47%), Gaps = 8/143 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLN 90
           ++K FEGL L AYRD+ GG WTIGYG+T    G  V  G T T+   +        +S  
Sbjct: 127 LIKCFEGLCLNAYRDV-GGIWTIGYGNTRWEDGRAVASGDTCTKARCDSLFNYWVDESFA 185

Query: 91  LLLESSPALKSTSENRLV--AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA-EECKKWT 147
             +++     S   N++   A+  F +N+G   ++ ST  ++V A   +    +E  KW 
Sbjct: 186 PAVDADIGSPSPDVNQVQFEALVSFTYNVGTAAFHSSTLLKKVQANPNDPTIRDEFMKWV 245

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
              G  + GL+ RR+ E      
Sbjct: 246 NVNGVPVQGLINRREKEADYYFS 268


>gi|70724916|ref|YP_257123.1| hypothetical protein pSG3GP_14 [Sodalis glossinidius]
 gi|68697147|emb|CAI59405.1| hypothetical protein pSG3.14 [Sodalis glossinidius]
          Length = 144

 Score = 66.2 bits (160), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 72/140 (51%), Gaps = 11/140 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++   EG RL AY+    G WTIGYGHT     EG+   +K + D  L+  +  +   ++
Sbjct: 10  LIMRLEGGRLRAYQ-CRAGIWTIGYGHT-----EGVKPGDKISLDQALELFNHDVQWAVD 63

Query: 95  SSPALKST--SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG- 151
           +  AL     S+ +  A+  FVFN+G   + +S   ++++A D   AA E  +W + GG 
Sbjct: 64  AVNALVKVPLSQGQFEALCSFVFNVGRAAFAQSRLLKKLNAGDVAGAAAEFPRWDRGGGA 123

Query: 152 --KVLPGLVKRRDAEVKLLL 169
              ++PGL +RR  E    L
Sbjct: 124 KIHIIPGLTRRRAEEQAHFL 143


>gi|238798099|ref|ZP_04641587.1| Lysozyme [Yersinia mollaretii ATCC 43969]
 gi|238718079|gb|EEQ09907.1| Lysozyme [Yersinia mollaretii ATCC 43969]
          Length = 149

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG +L AY+      WT G GHT + V  G  I+E++    L+ D  +    +
Sbjct: 14  LKLIADYEGCQLNAYQ-CSANVWTNGIGHT-AGVKPGSVISERQVAVNLVADVQRVERAM 71

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P   +  +    AV  F FN+G G   +ST    ++  DW  A  +  +W    G 
Sbjct: 72  AVCMPV--AMPQPVYDAVVSFAFNVGTGAACRSTLAFYINKSDWRSACNQLPRWVYVNGV 129

Query: 153 VLPGLVKRRDAE 164
              GL +RR  E
Sbjct: 130 KTKGLERRRTTE 141


>gi|51596090|ref|YP_070281.1| phage lysozyme [Yersinia pseudotuberculosis IP 32953]
 gi|51589372|emb|CAH20994.1| putative phage lysozyme [Yersinia pseudotuberculosis IP 32953]
          Length = 168

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 62/138 (44%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG +L AY+      WT G GHT   V  G  I+E++    L+ D  +    +
Sbjct: 33  LKLIADYEGCQLNAYQ-CSANVWTNGIGHT-VGVKPGSVISERQVAVNLVADVQRVERAI 90

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P   +  +    AV  F FN+G G   +ST    V+  DW  A  +  +W    G 
Sbjct: 91  AVCMPV--TMPQPVYDAVVSFAFNVGPGAACRSTLAFFVNKSDWHSACNQLPRWVYVNGV 148

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL +RR  E K  L 
Sbjct: 149 KTKGLERRRVTEQKHCLS 166


>gi|218559560|ref|YP_002392473.1| lysozyme protein R of prophage [Escherichia coli S88]
 gi|300916277|ref|ZP_07133024.1| phage lysozyme [Escherichia coli MS 115-1]
 gi|218366329|emb|CAR04080.1| putative lysozyme protein R of prophage [Escherichia coli S88]
 gi|300416366|gb|EFJ99676.1| phage lysozyme [Escherichia coli MS 115-1]
          Length = 170

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 67/141 (47%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G  ITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKIITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G GN   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTGNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|194430147|ref|ZP_03062649.1| lysozyme [Escherichia coli B171]
 gi|194411811|gb|EDX28131.1| lysozyme [Escherichia coli B171]
 gi|323159470|gb|EFZ45451.1| phage lysozyme family protein [Escherichia coli E128010]
          Length = 177

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 74/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++     + SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--ALSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|238801771|ref|YP_002922821.1| lysin [Enterobacteria phage WV8]
 gi|216262984|gb|ACJ71852.1| lysin [Enterobacteria phage WV8]
          Length = 154

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 71/143 (49%), Gaps = 10/143 (6%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K FEGL L AY D   G  TIGYG     G  V  GM IT ++AE +LL D  K +  +
Sbjct: 11  IKFFEGLELEAYED-SAGIPTIGYGTIRIDGKPVKMGMKITAEQAEQYLLADVEKFVAAV 69

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--- 149
            ++      TS+N   A+    +N+GI     STF +R +A +    AE  + W K    
Sbjct: 70  NKAVNV--PTSQNEFDALVSETYNIGITAMQDSTFIKRHNAGNKVGCAEAMQWWNKVTVK 127

Query: 150 GGKVLP-GLVKRRDAEVKLLLES 171
           G KV   GL  RR  E  + L+S
Sbjct: 128 GKKVTSNGLKNRRRMEADIYLDS 150


>gi|316934292|ref|YP_004109274.1| glycoside hydrolase family 24 [Rhodopseudomonas palustris DX-1]
 gi|315602006|gb|ADU44541.1| glycoside hydrolase family 24 [Rhodopseudomonas palustris DX-1]
          Length = 209

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 72/139 (51%), Gaps = 6/139 (4%)

Query: 33  IKMLKEFEGLRLTAYRD-IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           + ++ +FEGL L A  D +  G  T+ +G T   V  G   T+++ E  L   A+K    
Sbjct: 21  VPVVSDFEGLWLVAKPDTLAHGIPTVCFGET-EGVKIGDRYTKEQCEQML---ANKLPRY 76

Query: 92  LLESSPALKSTSENRL-VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           L E    +K+   NR   A   F +N+G G + +ST  +R++A    +A E  + W KAG
Sbjct: 77  LYEIDRCIKAPVSNRTRAAYLSFAYNVGSGGFCRSTALKRLNAGRDAEACEAMRPWNKAG 136

Query: 151 GKVLPGLVKRRDAEVKLLL 169
           GK   GL  RR+ E+K+ L
Sbjct: 137 GKFRQGLANRREKEIKMCL 155


>gi|965070|gb|AAA96012.1| phage lysozyme [Serratia marcescens]
          Length = 179

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ + EG RL+ Y+    G WT G GHT + V     I E++A   L+ D  ++   +
Sbjct: 42  LRLIADLEGCRLSPYQ-CSAGVWTQGIGHT-AGVIPDKAIDERKAAMDLVDDVRRTERGM 99

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P   + S+    AV  F FN+G+    +ST    +  + W +A ++  +W    GK
Sbjct: 100 ATCLP--DTLSQQTYDAVIAFAFNVGVSAACRSTLVALLQQRQWRQACDQVPRWVYVNGK 157

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL +RR  E  L L+
Sbjct: 158 KNKGLEQRRAMERALCLQ 175


>gi|322831449|ref|YP_004211476.1| glycoside hydrolase family 24 [Rahnella sp. Y9602]
 gi|321166650|gb|ADW72349.1| glycoside hydrolase family 24 [Rahnella sp. Y9602]
          Length = 169

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ +FEG +L  Y+    G WT G GHT + V     +TE +A + LL D  ++   +
Sbjct: 34  LRLITDFEGCQLQPYQ-CSAGVWTSGIGHT-AGVKPAQEVTEHQAAENLLGDIQQTERAV 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +  P +    +    AV  F FN+G G   KST    ++ Q W++A ++  +W    G+
Sbjct: 92  KKCMPVI--MPQPVFDAVVSFSFNVGTGAACKSTLAFFINQQQWQQACDQLPRWVFVNGE 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL +RR+AE  L L+
Sbjct: 150 RNRGLERRRNAERTLCLK 167


>gi|257082993|ref|ZP_05577354.1| bacterial SH3 domain-containing protein [Enterococcus faecalis
           E1Sol]
 gi|256991023|gb|EEU78325.1| bacterial SH3 domain-containing protein [Enterococcus faecalis
           E1Sol]
          Length = 588

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 42  LRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           L+  A RD   G  +IGYGH  +D   +  GMTITE +AE  L  D S+    L+    A
Sbjct: 19  LKAVAGRD---GILSIGYGHLSNDRHPIKSGMTITESQAEQILRDDLSEHAT-LISKLLA 74

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV-LPGL 157
           +K+T +N+  A+  F  + G+G    S      + +++  AA E K +    G + LP L
Sbjct: 75  IKAT-QNQFDALVSFSHSKGLGFLPSSDVMHFTNTKEFNSAAREMKLYVYDIGSIKLPKL 133

Query: 158 VKRRDAEVKLLLE 170
           V+RR+AE  L LE
Sbjct: 134 VERRNAEASLYLE 146


>gi|262042505|ref|ZP_06015663.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259040143|gb|EEW41256.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 156

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 66/138 (47%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V +G TITE++A    + +  +    L
Sbjct: 21  LKLIADYEGCRLQPYQ-CDAGVWTDGIGNT-SGVVQGKTITERQAAGSFITNVLRVEKAL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
                 L S  +N   A+    FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 79  --DRCVLVSVPQNVYDALVSLAFNVGTGNACSSTMVKFINQKRWRDACYQLPRWVYVKGV 136

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 137 FNQGLENRRGRELAWCLK 154


>gi|256962431|ref|ZP_05566602.1| predicted protein [Enterococcus faecalis Merz96]
 gi|293384203|ref|ZP_06630093.1| putative phage lysozyme [Enterococcus faecalis R712]
 gi|293388391|ref|ZP_06632900.1| putative phage lysozyme [Enterococcus faecalis S613]
 gi|312979139|ref|ZP_07790848.1| phage lysozyme [Enterococcus faecalis DAPTO 516]
 gi|256952927|gb|EEU69559.1| predicted protein [Enterococcus faecalis Merz96]
 gi|291078447|gb|EFE15811.1| putative phage lysozyme [Enterococcus faecalis R712]
 gi|291082230|gb|EFE19193.1| putative phage lysozyme [Enterococcus faecalis S613]
 gi|311288075|gb|EFQ66631.1| phage lysozyme [Enterococcus faecalis DAPTO 516]
          Length = 588

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 42  LRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           L+  A RD   G  +IGYGH  +D   +  GMTITE +AE  L  D S+    L+    A
Sbjct: 19  LKAVAGRD---GILSIGYGHLSNDRHPIKSGMTITESQAEQILRDDLSEHAT-LISKLLA 74

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV-LPGL 157
           +K+T +N+  A+  F  + G+G    S      + +++  AA E K +    G + LP L
Sbjct: 75  IKAT-QNQFDALVSFSHSKGLGFLPSSDVMHFTNTKEFNSAAREMKLYVYDIGSIKLPKL 133

Query: 158 VKRRDAEVKLLLE 170
           V+RR+AE  L LE
Sbjct: 134 VERRNAEASLYLE 146


>gi|307315148|ref|ZP_07594730.1| glycoside hydrolase family 24 [Sinorhizobium meliloti BL225C]
 gi|306898880|gb|EFN29531.1| glycoside hydrolase family 24 [Sinorhizobium meliloti BL225C]
          Length = 588

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 75/142 (52%), Gaps = 10/142 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVT-EGMTITEKEAEDFLLKDASK 87
           +  ML E E + L +Y D G G  TIG GHT   G  V   GMTI+  EA +    D +K
Sbjct: 8   ICAMLAE-EAIVLASYND-GTGTMTIGAGHTAAAGPPVPRSGMTISITEAINIYRNDLAK 65

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           + N +  +  A+   S+++  A+  + FN   G  + +T  ++++  D   AA E  +W 
Sbjct: 66  TENQVQSAVRAV--LSQHQFDALVSWHFN--TGAISSATLTRKLNTGDVAGAAAEFARWN 121

Query: 148 KAGGKVLPGLVKRRDAEVKLLL 169
           K+ GKVL GL+ RRD E  + L
Sbjct: 122 KSKGKVLEGLIARRDRETAMFL 143


>gi|322831313|ref|YP_004211340.1| glycoside hydrolase family 24 [Rahnella sp. Y9602]
 gi|321166514|gb|ADW72213.1| glycoside hydrolase family 24 [Rahnella sp. Y9602]
          Length = 169

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ +FEG RL+AY+    G WT G GHT + V     I+E++A   L++D  +    +
Sbjct: 34  LALIADFEGCRLSAYQ-CSAGVWTNGIGHT-AGVRPQTQISERQAAVNLVEDVMRVEKGI 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P   +  +    AV  F FN+G+    +ST    +    W  A E+  +W    G 
Sbjct: 92  ARCMPV--AMPQPVYDAVVSFAFNVGVAAACQSTLAFFISKGKWRDACEQLPRWVFVNGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
            + GL +RR  E+   L 
Sbjct: 150 RVTGLERRRANELAYCLR 167


>gi|197085629|ref|YP_002128449.1| gp15 putative lysozyme [Iodobacteriophage phiPLPE]
 gi|195964727|gb|ACG60337.1| gp15 putative lysozyme [Iodobacteriophage phiPLPE]
          Length = 167

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 69/143 (48%), Gaps = 16/143 (11%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG+ L AY+D   G  TI YG T   V  G T T++E E  L K     L  + +  P L
Sbjct: 27  EGISLKAYKD-PVGIPTICYGET-QGVHYGDTKTKEECEAMLYKRIGDYLGPVDKMMPGL 84

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKST-----------FKQRVDAQDWEKAAEECKKWTK 148
               +NR +A  DF +N+G+G   + T           F     A  W+++ E   K+  
Sbjct: 85  ---PDNRRIAYTDFAYNVGLGKLTERTKRNGKEIIGTSFVDLEKAGKWQESCERLNKYVY 141

Query: 149 AGGKVLPGLVKRRDAEVKLLLES 171
           A GK L GLVKRR  E ++ ++S
Sbjct: 142 AAGKKLNGLVKRRAEEYQICMKS 164


>gi|315163119|gb|EFU07136.1| phage lysozyme [Enterococcus faecalis TX0645]
          Length = 588

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 9/133 (6%)

Query: 42  LRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           L+  A RD   G  +IGYGH  +D   +  GMTITE +AE  L  D S+    L+    A
Sbjct: 19  LKAVAGRD---GILSIGYGHLSNDRHPIKSGMTITESQAEQILRDDLSEHAT-LISKLLA 74

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV-LPGL 157
           +K+T +N+  A+  F  + G+G    S      + +++  AA E K +    G + LP L
Sbjct: 75  IKAT-QNQFDALVSFSHSKGLGFLPSSDVMHFTNTKEFNSAAREMKLYVYDIGSIKLPKL 133

Query: 158 VKRRDAEVKLLLE 170
           V+RR+AE  L LE
Sbjct: 134 VERRNAEASLYLE 146


>gi|269975344|gb|ACZ55568.1| lysin [Staphylococcus phage SA1]
          Length = 154

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 54/144 (37%), Positives = 72/144 (50%), Gaps = 12/144 (8%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K FEGL+L AY D   G  TIGYG     G  V  GM IT ++AE +LL D  K    +
Sbjct: 11  IKFFEGLKLDAYED-SAGIPTIGYGTIRIDGKPVKMGMKITAEQAEQYLLADVEK---FV 66

Query: 93  LESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA-- 149
              + A+K  TS+N   A+    +N+GI     STF +R +  +    AE  + W K   
Sbjct: 67  AAVNKAIKVPTSQNEFDALVSETYNIGITAMQDSTFIKRHNDGNKVGCAEAMQWWNKVTV 126

Query: 150 -GGKVLP-GLVKRRDAEVKLLLES 171
            G KV   GL  RR  E  + L+S
Sbjct: 127 KGKKVTSNGLKNRRRMEADIYLDS 150


>gi|161524970|ref|YP_001579982.1| glycoside hydrolase family protein [Burkholderia multivorans ATCC
           17616]
 gi|189350283|ref|YP_001945911.1| bacteriophage lysozyme [Burkholderia multivorans ATCC 17616]
 gi|160342399|gb|ABX15485.1| glycoside hydrolase family 24 [Burkholderia multivorans ATCC 17616]
 gi|189334305|dbj|BAG43375.1| bacteriophage lysozyme [Burkholderia multivorans ATCC 17616]
          Length = 165

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 70/145 (48%), Gaps = 11/145 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
             M+ +FEG  L A  D  G   T  +G T  DV  G   T  +    L +   +    +
Sbjct: 22  FSMVPKFEGEMLVAGPDPIG-IITGCFGDT-KDVKLGQRFTHDQCIARLEQRLIEHAEPV 79

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KK 145
           L+ +P LK  +  +L A   F +N+G G Y  ST  +R +A DW+ A            +
Sbjct: 80  LKCTPGLKGHT-YQLAAAVSFAYNVGSGAYCGSTTAKRFNAGDWKGACRALNEADNGRPQ 138

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLE 170
           W  AGG+VLPGLVKRR AE + L E
Sbjct: 139 WVTAGGRVLPGLVKRR-AEERALCE 162


>gi|115491283|ref|XP_001210269.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gi|114197129|gb|EAU38829.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
          Length = 185

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 76/151 (50%), Gaps = 8/151 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLL 82
           V  A IK++K +E      Y D G G  T+GYGH     + SDV+  + ++E + E    
Sbjct: 26  VNEATIKLMKGYESWEADVYDD-GYGNPTVGYGHLCDDWSCSDVSYDIPLSESDGEKLFA 84

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKAAE 141
           +D     N ++ +     + ++N+  A+  + FN+G G   +ST  +R++  +D +  AE
Sbjct: 85  EDIVAYQNGVVAALSDDVTLNDNQYGALVSWCFNVGTGAVAESTLAKRLNNGEDPDTVAE 144

Query: 142 E-CKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           E   KW  A G    GL  RR AE+KL   S
Sbjct: 145 EELPKWVYANGAPSEGLKNRRAAELKLFTTS 175


>gi|238760791|ref|ZP_04621900.1| Lysozyme [Yersinia aldovae ATCC 35236]
 gi|238700987|gb|EEP93595.1| Lysozyme [Yersinia aldovae ATCC 35236]
          Length = 149

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 39/134 (29%), Positives = 62/134 (46%), Gaps = 4/134 (2%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           A +K++ ++EG +L AY+      WT G GHT + V  G  I+E++    L+ D  +   
Sbjct: 12  AGLKLIADYEGCQLNAYQ-CSANVWTNGIGHT-AGVKPGSVISERQVAANLVADVQRVER 69

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            +    P   +  +    AV  F FN+G G   +ST    ++  DW  A  +  +W    
Sbjct: 70  AMAVCMPV--AIPQPVYDAVVSFAFNVGTGAACRSTLAFYINKGDWRNACNQLPRWVYVN 127

Query: 151 GKVLPGLVKRRDAE 164
           G    GL +RR  E
Sbjct: 128 GVKTKGLERRRTTE 141


>gi|116221999|ref|YP_794054.1| lysozyme protein R [Stx2-converting phage 86]
 gi|115500809|dbj|BAF34039.1| lysozyme protein R [Stx2-converting phage 86]
          Length = 177

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|153818452|ref|ZP_01971119.1| fels-2 prophage protein [Vibrio cholerae NCTC 8457]
 gi|126511011|gb|EAZ73605.1| fels-2 prophage protein [Vibrio cholerae NCTC 8457]
          Length = 179

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 45/176 (25%), Positives = 84/176 (47%), Gaps = 19/176 (10%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C +  +++ V      N DD+   + V    ++ +   EG RL AY+      WT G G
Sbjct: 12  VCSVTAVLAIV-----FNIDDE---LSVSENGLRHIANEEGCRLKAYQ-CSADRWTAGMG 62

Query: 61  HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
           HT   +T    +TE++  ++ +KD +++   + +      + +E  ++    FVFNLG G
Sbjct: 63  HT-EGITVSTLLTEQQVAEYFVKDVARAERFVKKQITKKPNQAEYDMMV--SFVFNLGAG 119

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK-------VLPGLVKRRDAEVKLLL 169
           N+  ST  ++ +  D + A ++  +W    GK          G+ KRR+ E+ + L
Sbjct: 120 NFQTSTLLRKFNQGDNQGACQQYPRWVYVNGKDCRVKENDCEGITKRRNKEMNICL 175


>gi|188532724|ref|YP_001906521.1| Putative phage lysozyme [Erwinia tasmaniensis Et1/99]
 gi|188027766|emb|CAO95623.1| Putative phage lysozyme [Erwinia tasmaniensis Et1/99]
          Length = 169

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 65/138 (47%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    GAWT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGAWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERQL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    A     FN+G GN   ST    ++ Q W  A  +  +W    G 
Sbjct: 92  EKC--VVQPMPQKVYDAAVSLAFNVGTGNACSSTLVTLLNQQRWADACHQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|85058072|ref|YP_453774.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84778592|dbj|BAE73369.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 154

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/136 (30%), Positives = 72/136 (52%), Gaps = 7/136 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG+  T YRD  GG  ++ YGHTG+     + I+   +   LL    K+   +++
Sbjct: 24  LIQWHEGVLYTPYRD-SGGVLSVCYGHTGA-----VAISSPVSATSLLDSDQKAAMAIVD 77

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           ++     T EN+  A+A FV+N+  G + +ST  ++++A D   A +E + W    GKV 
Sbjct: 78  ANVTAPLT-ENQKAALASFVYNVARGAFARSTLLKKLNAGDRAGACDEMRCWKYVDGKVS 136

Query: 155 PGLVKRRDAEVKLLLE 170
            GLV  R  E +  L+
Sbjct: 137 KGLVNWRSVEREFCLK 152


>gi|262039722|ref|ZP_06013004.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259042934|gb|EEW43923.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 176

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 52/156 (33%), Positives = 76/156 (48%), Gaps = 24/156 (15%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  + + L E EG  LT+YRD G G WTI  G T   G  VT+GM +T+ + +     +
Sbjct: 22  APVLMDQFLNEKEGNSLTSYRD-GAGIWTICRGATRVDGRPVTQGMKLTQAKCDQVNAVE 80

Query: 85  ASKSL-----NLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEK 138
            +K+L     N+ +  +P  K       V +A F  +N+G G    STF ++++A D + 
Sbjct: 81  RNKALAWVDQNVRVRLTPPQK-------VGIASFCPYNIGPGKCFPSTFYRKLNAGDRKG 133

Query: 139 AAEECKKWTKAGGKVLP-------GLVKRRDAEVKL 167
           A  E ++W   GGK          G V RRD E  L
Sbjct: 134 ACAEIRRWIFDGGKDCRVRSNNCYGQVSRRDQESAL 169


>gi|288550426|ref|ZP_05970372.2| putative lysozyme [Enterobacter cancerogenus ATCC 35316]
 gi|288315155|gb|EFC54093.1| putative lysozyme [Enterobacter cancerogenus ATCC 35316]
          Length = 156

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 59/132 (44%), Gaps = 4/132 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ + EG RL+ YR    G WT G GHT + V     ITE++A   L+ D  K    L
Sbjct: 21  LALIADLEGCRLSPYR-CSAGVWTSGIGHT-AGVVPTREITERDAAANLIADVMKVEKRL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              +P           A+  F FN+G G   +ST    ++ + W +A  E  +W    G 
Sbjct: 79  AACAPV--EMPPRVYDALVSFAFNVGTGAACRSTLVSLINRKQWPQACGELPRWVYVNGN 136

Query: 153 VLPGLVKRRDAE 164
              GL  RR  E
Sbjct: 137 KNAGLENRRARE 148


>gi|321223505|gb|EFX48570.1| Prophage lysozyme ; Phage lysin [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
          Length = 171

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 67/138 (48%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  +    L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLRVERAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W    G 
Sbjct: 92  DKC--VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACLQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRAREMAWCLK 167


>gi|254284928|ref|ZP_04959894.1| phage lysozyme [Vibrio cholerae AM-19226]
 gi|150424931|gb|EDN16708.1| phage lysozyme [Vibrio cholerae AM-19226]
          Length = 175

 Score = 65.1 bits (157), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 72/147 (48%), Gaps = 17/147 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE-AEDFL--LKDASKSL 89
           ++ +   EG R  AY+      WT G GHT S V  G  +++++ AE+F+  ++ A +S+
Sbjct: 33  LEHIANLEGCRRQAYQ-CSADVWTHGIGHT-SGVKAGDVVSDQQIAENFISDIRQAERSV 90

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N  L      +  ++ +   +  FVFNLG G++ +ST  +  +  DW+ A  E  +W   
Sbjct: 91  NRAL-----TRDVTQAQFDVLVSFVFNLGEGSFRRSTMLKLFNQGDWQNACREFSRWVYV 145

Query: 150 GGK-------VLPGLVKRRDAEVKLLL 169
            GK          G+V RR+ E    L
Sbjct: 146 NGKNCRDPDSECSGIVTRREVEQNACL 172


>gi|509552|gb|AAA98440.1| putative phage lysozyme [Serratia marcescens]
          Length = 179

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ + EG RL+ Y+    G WT G GHT + V  G  I E +A   L+ D  ++   +
Sbjct: 42  LRLIADLEGCRLSPYQ-CSAGVWTQGIGHT-AGVIPGKAIDEHKAAMDLVDDVRRTERGM 99

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P   + S+    A   F FN+G+     ST    +  + W +A ++  +W    GK
Sbjct: 100 AACLP--DTLSQQTYDAAIAFAFNVGVSAACHSTLVALLQQRQWRQACDQLPRWVYVNGK 157

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL +RR  E  L L+
Sbjct: 158 KNKGLEQRRAMERALCLQ 175


>gi|315615862|gb|EFU96493.1| phage lysozyme family protein [Escherichia coli 3431]
          Length = 177

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVLPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVAKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|294636148|ref|ZP_06714569.1| lysozyme [Edwardsiella tarda ATCC 23685]
 gi|291090546|gb|EFE23107.1| lysozyme [Edwardsiella tarda ATCC 23685]
          Length = 179

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  + + L E EG RL AYRD G G W+I  G T   G  V +GM +TE++ + +   +
Sbjct: 24  APQLMDQFLTEKEGNRLVAYRD-GSGIWSICRGVTRVDGRPVAKGMRLTEQQCQKYNAIE 82

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E + V +A F  +N+G G    STF ++++A D   A  E 
Sbjct: 83  RDKALAWVARNVHV--PLTEPQKVGIASFCPYNIGPGKCFTSTFYRKLNAGDRRGACREI 140

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           ++W    G+          G V RRD E  L
Sbjct: 141 RRWIYDRGRDCRIRSNNCFGQVTRRDEEAAL 171


>gi|315154355|gb|EFT98371.1| phage lysozyme [Enterococcus faecalis TX0031]
          Length = 382

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 73/143 (51%), Gaps = 10/143 (6%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKS 88
           L K    F  L+  A RD   G  +IGYGH  +D   +  GMTITE +AE  L  D S+ 
Sbjct: 10  LCKKYSSFS-LKAVAGRD---GILSIGYGHLSNDRHPIKSGMTITESQAEQILRDDLSEH 65

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
              L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K +  
Sbjct: 66  AT-LISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDVMHFTNTKEFNSAAREMKLYVY 123

Query: 149 AGGKV-LPGLVKRRDAEVKLLLE 170
             G + LP LV+RR+AE  L LE
Sbjct: 124 DIGSIKLPKLVERRNAEASLYLE 146


>gi|146313129|ref|YP_001178203.1| glycoside hydrolase family protein [Enterobacter sp. 638]
 gi|145320005|gb|ABP62152.1| glycoside hydrolase, family 24 [Enterobacter sp. 638]
          Length = 170

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 62/133 (46%), Gaps = 6/133 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + +L + EG RLT Y+    G WT G GHT   V +G  ITE+EA   L+ D   +   L
Sbjct: 33  LALLADLEGCRLTPYQ-CSAGVWTSGIGHTAGVVPKG-DITEREAAANLVADVLNTEQRL 90

Query: 93  LESSPA-LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
               P  +     + LV+   F FN+G G   +ST    +  Q W +A ++  +W    G
Sbjct: 91  AVCVPVKMPPRVYDTLVS---FSFNVGTGAACRSTLVSFIKRQQWWQACDQLTRWVYVNG 147

Query: 152 KVLPGLVKRRDAE 164
               GL  RR  E
Sbjct: 148 VKNKGLENRRARE 160


>gi|327253358|gb|EGE65000.1| phage lysozyme family protein [Escherichia coli STEC_7v]
          Length = 177

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVAKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|318604149|emb|CBY25647.1| prophage lysozyme; Phage lysin [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|318605352|emb|CBY26850.1| prophage lysozyme; Phage lysin [Yersinia enterocolitica subsp.
           palearctica Y11]
          Length = 168

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG +L AY+      WT G GHT + V  G  I+E++    L+ D  +    +
Sbjct: 33  LKLIADYEGCQLNAYQ-CSANVWTNGIGHT-AGVKPGSVISERQVAVNLVADVQQVERAI 90

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P +    +    AV  F FN+G G   +ST    V+  DW  A  +  +W    G 
Sbjct: 91  AVCMPLV--MPQPVYDAVVSFAFNVGTGAACRSTLAFFVNKGDWRSACNQLPRWVYVNGV 148

Query: 153 VLPGLVKRRDAE 164
              GL +RR  E
Sbjct: 149 KTKGLERRRTTE 160


>gi|299744000|ref|XP_001840818.2| lysozyme [Coprinopsis cinerea okayama7#130]
 gi|298405918|gb|EAU80871.2| lysozyme [Coprinopsis cinerea okayama7#130]
          Length = 272

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 7/123 (5%)

Query: 53  GAWTIGYGH----TG-SDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRL 107
           G  T+GYGH    TG ++V     +T+ +A   L+ D     N +          ++N+ 
Sbjct: 137 GLPTVGYGHLCQRTGCTEVPYSFPLTQAQAHALLISDLRTYQNCIARDIVDSVRLNDNQY 196

Query: 108 VAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAEECKKWTKAGGKVLPGLVKRRDAEV 165
            A+  + FN+G  N   ST  +R++A +     A +E  +W  AGG+VLPGLV RR  EV
Sbjct: 197 GALVSWAFNVGCTNTASSTLIRRLNAGENPNTVAEQELPRWNMAGGQVLPGLVTRRAREV 256

Query: 166 KLL 168
            L 
Sbjct: 257 TLF 259


>gi|188493498|ref|ZP_03000768.1| phage lysozyme [Escherichia coli 53638]
 gi|188488697|gb|EDU63800.1| phage lysozyme [Escherichia coli 53638]
          Length = 147

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKS 88
           +  LK  E  +LTAY D   G WTIG GHTG      V +GMTIT+  A+  L  D S  
Sbjct: 8   LAALKREENCKLTAYPD-PRGVWTIGTGHTGKVDGVAVHKGMTITQDTADRLLRDDLSWV 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + + E        ++++  A+   +FN+G   +  ST +++++A ++  AA+   KW++
Sbjct: 67  EHCIAERVTV--PLNQSQYDALCSLIFNIGADAFIGSTVRRQLNAGNYTAAADAFLKWSR 124

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           AG      L  RR  E  + L
Sbjct: 125 AGSNPTI-LAPRRGRERAMFL 144


>gi|323953471|gb|EGB49337.1| phage lysozyme [Escherichia coli H252]
          Length = 170

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 66/141 (46%), Gaps = 10/141 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAKGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              ++  P  K        A   F FN+G  N   ST  + ++ + W  A  +  +W   
Sbjct: 92  ERCVKQQPPQKVYD-----ATVSFAFNVGTDNACSSTLVKLLNQRRWADACRQLPRWVYV 146

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G    GL  RR  E+   L+
Sbjct: 147 KGVFNQGLDNRRAREMAWCLQ 167


>gi|326471211|gb|EGD95220.1| Lysozyme [Trichophyton tonsurans CBS 112818]
 gi|326484212|gb|EGE08222.1| lysozyme [Trichophyton equinum CBS 127.97]
          Length = 192

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 48/145 (33%), Positives = 71/145 (48%), Gaps = 8/145 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           I ++K FEG       D   G  T+GYGH       S+V     +TE+ A + L++D   
Sbjct: 38  IALIKHFEGFVPRPAPD-PIGLPTVGYGHLCRTKGCSEVPFPFPLTEETATELLMQDVKS 96

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKAA-EECKK 145
               +  S+      + N+  A+  + +N+G     KS+   R++  QD +    EE   
Sbjct: 97  PQQSITLSTTDQVVLNANQYGALVSWAYNVGGSAAKKSSLISRLNQGQDVDAVIREELPL 156

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLE 170
           W KAGG VL GLV+RR AEV+L  E
Sbjct: 157 WNKAGGHVLSGLVRRRAAEVELASE 181


>gi|167646574|ref|YP_001684237.1| glycoside hydrolase family protein [Caulobacter sp. K31]
 gi|167349004|gb|ABZ71739.1| glycoside hydrolase family 24 [Caulobacter sp. K31]
          Length = 182

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 49/160 (30%), Positives = 72/160 (45%), Gaps = 28/160 (17%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIG---GGAWTIGYG----HTGSDVTEGM-TITEKEA 77
           + VP A   ++K  EG     Y D G   GG WTIGYG      G  VT     I E +A
Sbjct: 9   VTVPPAATVVVKRVEGFFGHPYDDNGALPGGTWTIGYGTIRDAAGKPVTPSTPAIAEAQA 68

Query: 78  EDFLLKDASKS---------LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFK 128
              L++D  ++         ++LL           E+   A+  + +NLG G    ST  
Sbjct: 69  TKLLMRDMQRAAKDVANRVNIDLL-----------EHEAAALISWTYNLGDGALRTSTLL 117

Query: 129 QRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           ++++A D   A  E ++W    GK L GL++RR AE  + 
Sbjct: 118 RKLNAGDKAAAPSEMRRWINQAGKPLVGLLRRRWAEAAIF 157


>gi|331652757|ref|ZP_08353763.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           M718]
 gi|331049513|gb|EGI21584.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           M718]
          Length = 177

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 74/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +   L   +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKVL--LTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|253689547|ref|YP_003018737.1| glycoside hydrolase family 24 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
 gi|251756125|gb|ACT14201.1| glycoside hydrolase family 24 [Pectobacterium carotovorum subsp.
           carotovorum PC1]
          Length = 169

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 70/142 (49%), Gaps = 12/142 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ + EG RL+ Y+      WT G GHT + V  G TITE+EA   L+ D      L 
Sbjct: 33  LALIADLEGCRLSPYQ-CSANLWTNGIGHT-AGVVPGKTITEREAAVNLVADV-----LR 85

Query: 93  LESSPALKSTSENRLVAVAD----FVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
           +E + A +  + N   AV D    F FN+G+G   +ST    ++   W  A ++  +W  
Sbjct: 86  VEKALA-RCMAVNMPQAVYDAIVSFAFNVGVGAACRSTLAFFINKGQWRNACDQLLRWVY 144

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
             G+V  G+  RR  E  + L+
Sbjct: 145 VNGEVSRGIETRRQRERAVCLK 166


>gi|312907856|ref|ZP_07766842.1| phage lysozyme [Enterococcus faecalis DAPTO 512]
 gi|310626152|gb|EFQ09435.1| phage lysozyme [Enterococcus faecalis DAPTO 512]
          Length = 396

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 10/143 (6%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKS 88
           L K    F  L+  A RD   G  +IGYGH  +D   +  GMTITE +AE  L  D S+ 
Sbjct: 10  LCKKYSSFS-LKAVAGRD---GILSIGYGHLSNDRHPIKSGMTITESQAEQILRDDLSEH 65

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             L+ +   A+K+T +N+  A+  F  + G+G    S      + +++  AA E K +  
Sbjct: 66  ATLISKLL-AIKAT-QNQFDALVSFSHSKGLGFLPSSDVMHFTNTKEFNSAAREMKLYVY 123

Query: 149 AGGKV-LPGLVKRRDAEVKLLLE 170
             G + LP LV+RR+AE  L LE
Sbjct: 124 DIGSIKLPKLVERRNAEASLYLE 146


>gi|300948752|ref|ZP_07162827.1| phage lysozyme [Escherichia coli MS 116-1]
 gi|300956175|ref|ZP_07168489.1| phage lysozyme [Escherichia coli MS 175-1]
 gi|300316980|gb|EFJ66764.1| phage lysozyme [Escherichia coli MS 175-1]
 gi|300451765|gb|EFK15385.1| phage lysozyme [Escherichia coli MS 116-1]
          Length = 177

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 74/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +   L   +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKVL--LTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|226940671|ref|YP_002795745.1| Lysozyme [Laribacter hongkongensis HLHK9]
 gi|226715598|gb|ACO74736.1| Lysozyme [Laribacter hongkongensis HLHK9]
          Length = 154

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 59/125 (47%), Gaps = 3/125 (2%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG R TAY  + G   TIG+G T   V  G  IT  +A    L D  K    L +     
Sbjct: 24  EGYRDTAYIPVPGDVPTIGFGTT-EGVKMGDRITPPKALARALTDVQKFEGALKQC--VR 80

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
               ++   A     +N+G G +  ST   +++A D+  A  E  +W  AGGK LPGLVK
Sbjct: 81  VPLHQHEYDAYVSLAYNIGPGAFCGSTLVLKLNAGDYAGACAEIDRWVYAGGKRLPGLVK 140

Query: 160 RRDAE 164
           RR  E
Sbjct: 141 RRAEE 145


>gi|226940548|ref|YP_002795622.1| Lysozyme [Laribacter hongkongensis HLHK9]
 gi|226715475|gb|ACO74613.1| Lysozyme [Laribacter hongkongensis HLHK9]
          Length = 154

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 60/125 (48%), Gaps = 3/125 (2%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG R  AY  + G   TIG+G T   V  G  IT  +A    L D  K    L +     
Sbjct: 24  EGYRDAAYIPVPGDVPTIGFGTT-EGVKMGDRITPPKALARALTDVQKFEGALKQC--VR 80

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
            S  +    A     +N+G G++  ST  ++++A D+  A  E  +W  AGGK LPGLVK
Sbjct: 81  VSLHQYEYDAFVSLAYNIGSGSFCGSTLVRKLNAGDYAGACSEIDRWVYAGGKRLPGLVK 140

Query: 160 RRDAE 164
           RR  E
Sbjct: 141 RRAEE 145


>gi|114562847|ref|YP_750360.1| glycoside hydrolase family protein [Shewanella frigidimarina NCIMB
           400]
 gi|114334140|gb|ABI71522.1| glycoside hydrolase, family 24 [Shewanella frigidimarina NCIMB 400]
          Length = 155

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 62/131 (47%), Gaps = 4/131 (3%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG  L  Y D   G  T  +G TG ++  GM  T ++  D L          L++ +P L
Sbjct: 27  EGEVLRTYID-PAGIETACFGQTGHNIKLGMVFTHQQCLDMLATSLKSFDRELVKLTPPL 85

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVK 159
              SE   +A   F++N+G   +  ST ++++ A D   A  E  +W  A  K LPGL+K
Sbjct: 86  ---SEGEHIAYLSFIYNVGADAFGASTLRKKLWAGDRVGACNELPRWVYAKKKKLPGLIK 142

Query: 160 RRDAEVKLLLE 170
           RR  E +  L 
Sbjct: 143 RRSNERRYCLR 153


>gi|218694480|ref|YP_002402147.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli 55989]
 gi|218351212|emb|CAU96916.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli 55989]
          Length = 177

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|315619751|gb|EFV00271.1| phage lysozyme family protein [Escherichia coli 3431]
          Length = 177

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVLPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|323965403|gb|EGB60859.1| phage lysozyme [Escherichia coli M863]
 gi|327250334|gb|EGE62053.1| phage lysozyme family protein [Escherichia coli STEC_7v]
          Length = 177

 Score = 63.9 bits (154), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVAKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G + RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQISRRDQESAL 170


>gi|218551646|ref|YP_002385438.1| membrane-associated lysozyme; Qin prophage [Escherichia fergusonii
           ATCC 35469]
 gi|218359188|emb|CAQ91853.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           fergusonii ATCC 35469]
          Length = 177

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E + V +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKVGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|193066662|ref|ZP_03047694.1| phage lysozyme [Escherichia coli E22]
 gi|193071653|ref|ZP_03052557.1| phage lysozyme [Escherichia coli E110019]
 gi|260854944|ref|YP_003228835.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|291282681|ref|YP_003499499.1| putative endolysin [Escherichia coli O55:H7 str. CB9615]
 gi|291283925|ref|YP_003500743.1| putative endolysin [Escherichia coli O55:H7 str. CB9615]
 gi|192925687|gb|EDV80349.1| phage lysozyme [Escherichia coli E22]
 gi|192955048|gb|EDV85547.1| phage lysozyme [Escherichia coli E110019]
 gi|257753593|dbj|BAI25095.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|290762554|gb|ADD56515.1| putative endolysin [Escherichia coli O55:H7 str. CB9615]
 gi|290763798|gb|ADD57759.1| putative endolysin [Escherichia coli O55:H7 str. CB9615]
 gi|320662621|gb|EFX29987.1| putative endolysin of prophage CP-933N [Escherichia coli O55:H7
           str. USDA 5905]
 gi|323153271|gb|EFZ39530.1| phage lysozyme family protein [Escherichia coli EPECa14]
          Length = 177

 Score = 63.9 bits (154), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|307284216|ref|ZP_07564383.1| phage lysozyme [Enterococcus faecalis TX0860]
 gi|306503317|gb|EFM72568.1| phage lysozyme [Enterococcus faecalis TX0860]
 gi|315578114|gb|EFU90305.1| phage lysozyme [Enterococcus faecalis TX0630]
          Length = 497

 Score = 63.5 bits (153), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 51/143 (35%), Positives = 74/143 (51%), Gaps = 10/143 (6%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKS 88
           L K    F  L+  A RD   G  +IGYGH  +D   +  GMTITE +AE  L  D S+ 
Sbjct: 10  LCKKYSSFS-LKAVAGRD---GILSIGYGHLSNDRHPIKSGMTITESQAEQILRDDLSEH 65

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             L+ +   A+K+T +N+  A+  F  + G+G    S      + +++  AA E K +  
Sbjct: 66  ATLISKLL-AIKAT-QNQFDALVSFSHSKGLGFLPSSDVMHFTNTKEFNSAAREMKLYVY 123

Query: 149 AGGKV-LPGLVKRRDAEVKLLLE 170
             G + LP LV+RR+AE  L LE
Sbjct: 124 DIGSIKLPKLVERRNAEASLYLE 146


>gi|71834140|ref|YP_277498.1| hypothetical phage-related lysozyme [Enterobacteria phage JK06]
 gi|71149570|gb|AAZ29308.1| JK_58P [Enterobacteria phage JK06]
          Length = 160

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 68/143 (47%), Gaps = 9/143 (6%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +  L E EG+    Y+D+ G  WT+  G TG DV  G   T+KE +  L+K  S     +
Sbjct: 20  VPFLNEHEGVEHKPYKDVAG-VWTVCAGITGPDVIRGKIYTQKECDTLLMKHLSIHRTAV 78

Query: 93  LESSPALK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK---KWTK 148
                ALK     +   A+  F FN+G     KST  +R+++ D        +   K T 
Sbjct: 79  ---DKALKVDVPVSTRAALYSFSFNVGTNAMRKSTAMRRINSGDIYGGCNALRLFNKITI 135

Query: 149 AGGKVLP-GLVKRRDAEVKLLLE 170
            G KV+  GL  RRDAEVKL + 
Sbjct: 136 NGKKVVSKGLDNRRDAEVKLCVS 158


>gi|156935211|ref|YP_001439127.1| hypothetical protein ESA_03062 [Cronobacter sakazakii ATCC BAA-894]
 gi|156533465|gb|ABU78291.1| hypothetical protein ESA_03062 [Cronobacter sakazakii ATCC BAA-894]
          Length = 164

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 41/135 (30%), Positives = 72/135 (53%), Gaps = 3/135 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++++ EG++   Y D  G   T+  G TG DV  G   T++E +D L K     +  + +
Sbjct: 26  LIQDQEGVKYKPYLDPVGIP-TVCAGITGPDVKMGKVYTKQECDDLLNKHMQPVIKAV-D 83

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           +S  +  ++  R  A+  F +N+G+  +  ST  ++++  D + A +E +KWT AGGK  
Sbjct: 84  ASVKVPISAYQR-AALYSFTYNVGVSAFRSSTLLKKLNNGDRKGACDELRKWTWAGGKQW 142

Query: 155 PGLVKRRDAEVKLLL 169
            GL  RR+ E  + L
Sbjct: 143 KGLQTRREIERSMCL 157


>gi|309798008|ref|ZP_07692385.1| phage lysozyme [Escherichia coli MS 145-7]
 gi|308118384|gb|EFO55646.1| phage lysozyme [Escherichia coli MS 145-7]
          Length = 180

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 75/157 (47%), Gaps = 17/157 (10%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFL 81
           + P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +   
Sbjct: 20  RAPAPDILDQFLNEKEGNHTTAYRD-GSGIWTICRGATVVDGKPVFPGMKLSKEKCDQVN 78

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAA 140
             +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A 
Sbjct: 79  AIERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNADDRKGAC 136

Query: 141 EECKKWTKAGGKVLP----------GLVKRRDAEVKL 167
           E  + W K GG+             G V+RRD E  L
Sbjct: 137 EAIRWWIKDGGRDCRLTKGQKNGCYGQVERRDQESAL 173


>gi|15801268|ref|NP_287285.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H7
           EDL933]
 gi|168763153|ref|ZP_02788160.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|217329192|ref|ZP_03445272.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|12514707|gb|AAG55897.1|AE005323_13 putative endolysin of prophage CP-933N [Escherichia coli O157:H7
           str. EDL933]
 gi|189366668|gb|EDU85084.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|217317631|gb|EEC26059.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|323179806|gb|EFZ65366.1| phage lysozyme family protein [Escherichia coli 1180]
          Length = 177

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|315616065|gb|EFU96688.1| phage lysozyme family protein [Escherichia coli 3431]
          Length = 177

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|284043195|ref|YP_003393535.1| glycoside hydrolase family 24 [Conexibacter woesei DSM 14684]
 gi|283947416|gb|ADB50160.1| glycoside hydrolase family 24 [Conexibacter woesei DSM 14684]
          Length = 391

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 48/162 (29%), Positives = 79/162 (48%), Gaps = 31/162 (19%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----------------GSDVTEGMTITEKE 76
           + ++++FEG     Y D  G A T+GYGH                  +  T G  +T  E
Sbjct: 236 LALIEQFEGFFAHPYDDPAGHA-TVGYGHLLHFGPVTAVDRRGRWLAAQATPGR-LTPAE 293

Query: 77  AEDFLLKDASKSLNLLLESSPALK----STSENRLVAVADFVFNLGIGNYNKST-FKQRV 131
           A + L ++ ++         PA++    S ++++  A+  FV+N+G G     T   + +
Sbjct: 294 ARELLRQELAEKYE------PAVRALRLSLTQHQHDALVSFVYNVGTGALGAETGIGRAL 347

Query: 132 DAQDWEKAAEECKKWTKAG--GKVLPGLVKRRDAEVKLLLES 171
            AQ W  AA+E  +W KAG   + LPGL +RR AE +L L++
Sbjct: 348 RAQRWSAAADELLRWDKAGHPPRPLPGLTRRRRAERELFLKA 389


>gi|302871056|ref|YP_003839692.1| glycoside hydrolase family 24 [Caldicellulosiruptor obsidiansis
           OB47]
 gi|302573915|gb|ADL41706.1| glycoside hydrolase family 24 [Caldicellulosiruptor obsidiansis
           OB47]
          Length = 290

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/164 (30%), Positives = 78/164 (47%), Gaps = 27/164 (16%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG-----------MTITEKEAED 79
           AL + +K +EG    AYRD   G WTIG GH   D   G             ITE++A +
Sbjct: 110 ALFEFVKSYEGYSSIAYRD-KDGVWTIGIGHVLRDKELGEYVDLKTNKPKKAITEEKAYE 168

Query: 80  FL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR------ 130
           F    +K A+ ++N  +E++      S+N+  A+  F FN+G    N    K R      
Sbjct: 169 FFKNDIKGATDAINKFMENNKI--QLSQNQFDALVSFTFNVGSAWTNNEMSKTRDDIIKV 226

Query: 131 ----VDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
               +D +   +  ++   W+KA G+VL GL +RR  E K+ ++
Sbjct: 227 VKNGIDTKLERELRDDFLSWSKAKGQVLEGLQRRRYDEWKMFVK 270


>gi|309793308|ref|ZP_07687735.1| phage lysozyme [Escherichia coli MS 145-7]
 gi|308122895|gb|EFO60157.1| phage lysozyme [Escherichia coli MS 145-7]
 gi|320177441|gb|EFW52440.1| Phage endolysin [Shigella dysenteriae CDC 74-1112]
          Length = 177

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|323962527|gb|EGB58107.1| phage lysozyme [Escherichia coli H489]
          Length = 177

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|300937232|ref|ZP_07152080.1| phage lysozyme [Escherichia coli MS 21-1]
 gi|300457707|gb|EFK21200.1| phage lysozyme [Escherichia coli MS 21-1]
          Length = 177

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRVRSNNCYGQVSRRDQESAL 170


>gi|327302878|ref|XP_003236131.1| glycoside hydrolase family 24 protein [Trichophyton rubrum CBS
           118892]
 gi|326461473|gb|EGD86926.1| glycoside hydrolase family 24 protein [Trichophyton rubrum CBS
           118892]
          Length = 246

 Score = 63.5 bits (153), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/165 (31%), Positives = 79/165 (47%), Gaps = 17/165 (10%)

Query: 10  FVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----S 64
           F +  IG N +D+          I ++K FEG  L    D   G  T+GYGH       S
Sbjct: 53  FKRDCIGSNVNDE---------TIGLIKHFEGFVLRPAPD-PIGLPTVGYGHLCRTKGCS 102

Query: 65  DVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNK 124
           +V+    +TE+ A + L++D   S   +  S+      + N+  A+  + + +G     K
Sbjct: 103 EVSFPFFLTEETATELLIQDVKSSQQSITLSTTDQVVFNANQSGALVSWAYTVGGATAKK 162

Query: 125 STFKQRVD-AQDWEKAA-EECKKWTKAGGKVLPGLVKRRDAEVKL 167
           S+   R++  QD +    EE   W KAG  VLPG V+RR AEV+L
Sbjct: 163 SSLISRLNREQDVDAVIREELPLWNKAGRHVLPGQVRRRAAEVEL 207


>gi|320657732|gb|EFX25519.1| Phage-related lysozyme (muraminidase) [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|188495647|ref|ZP_03002917.1| phage lysozyme [Escherichia coli 53638]
 gi|188490846|gb|EDU65949.1| phage lysozyme [Escherichia coli 53638]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATTVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQEAAL 170


>gi|218689218|ref|YP_002397430.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218704566|ref|YP_002412085.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli UMN026]
 gi|293404447|ref|ZP_06648441.1| lysozyme [Escherichia coli FVEC1412]
 gi|298380224|ref|ZP_06989829.1| lysozyme lambdoid prophage Qin [Escherichia coli FVEC1302]
 gi|300895946|ref|ZP_07114517.1| phage lysozyme [Escherichia coli MS 198-1]
 gi|301017502|ref|ZP_07182193.1| phage lysozyme [Escherichia coli MS 69-1]
 gi|218426782|emb|CAR07629.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218431663|emb|CAR12544.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli UMN026]
 gi|291429033|gb|EFF02058.1| lysozyme [Escherichia coli FVEC1412]
 gi|298279922|gb|EFI21430.1| lysozyme lambdoid prophage Qin [Escherichia coli FVEC1302]
 gi|300360157|gb|EFJ76027.1| phage lysozyme [Escherichia coli MS 198-1]
 gi|300400194|gb|EFJ83732.1| phage lysozyme [Escherichia coli MS 69-1]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|86139978|ref|ZP_01058543.1| putative lysozyme [Roseobacter sp. MED193]
 gi|85823396|gb|EAQ43606.1| putative lysozyme [Roseobacter sp. MED193]
          Length = 241

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 41/142 (28%), Positives = 72/142 (50%), Gaps = 12/142 (8%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDA 85
           ++ I  +  +EGLR  AYRD+ G  WT+ YG T     +D        E  A + L+ +A
Sbjct: 99  SSAIAFVGGWEGLRQEAYRDVVG-VWTVCYGKTKGVRPTDRYSKAQCDEMLAAEILVYEA 157

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
           +    L +     +K       +A+  + +N+G G    ST  +  +A D   A +E ++
Sbjct: 158 ALDQCLTVTVPEGMK-------IALVSWTYNVGAGAACGSTLMRLANAGDLAGACDELQR 210

Query: 146 WTKAGGKVLPGLVKRRDAEVKL 167
           W +AGG++  GL +RR +E+++
Sbjct: 211 WNRAGGRMWRGLTRRRISEMEM 232


>gi|260844244|ref|YP_003222022.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|291283182|ref|YP_003500000.1| Phage-related lysozyme (muraminidase) [Escherichia coli O55:H7 str.
           CB9615]
 gi|257759391|dbj|BAI30888.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|290763055|gb|ADD57016.1| Phage-related lysozyme (muraminidase) [Escherichia coli O55:H7 str.
           CB9615]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|331685826|ref|ZP_08386407.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           H299]
 gi|331077023|gb|EGI48240.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           H299]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|26247305|ref|NP_753345.1| lysozyme from lambdoid prophage Qin [Escherichia coli CFT073]
 gi|253773640|ref|YP_003036471.1| Lysozyme [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|254161439|ref|YP_003044547.1| putative lysozyme [Escherichia coli B str. REL606]
 gi|300974666|ref|ZP_07172694.1| phage lysozyme [Escherichia coli MS 45-1]
 gi|331652424|ref|ZP_08353443.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           M718]
 gi|26107706|gb|AAN79905.1|AE016759_179 Probable lysozyme from lambdoid prophage Qin [Escherichia coli
           CFT073]
 gi|242377135|emb|CAQ31863.1| Qin prophage, predicted lysozyme [Escherichia coli BL21(DE3)]
 gi|253324684|gb|ACT29286.1| Lysozyme [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253973340|gb|ACT39011.1| predicted lysozyme [Escherichia coli B str. REL606]
 gi|253977552|gb|ACT43222.1| predicted lysozyme [Escherichia coli BL21(DE3)]
 gi|300410518|gb|EFJ94056.1| phage lysozyme [Escherichia coli MS 45-1]
 gi|315291588|gb|EFU50948.1| phage lysozyme [Escherichia coli MS 153-1]
 gi|331050702|gb|EGI22760.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           M718]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMRLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|152984203|ref|YP_001350399.1| lysozyme [Pseudomonas aeruginosa PA7]
 gi|152989652|ref|YP_001346088.1| lysozyme [Pseudomonas aeruginosa PA7]
 gi|150959361|gb|ABR81386.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Pseudomonas
           aeruginosa PA7]
 gi|150964810|gb|ABR86835.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Pseudomonas
           aeruginosa PA7]
          Length = 153

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/129 (34%), Positives = 66/129 (51%), Gaps = 4/129 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           FEG  L AY D  G   TI  G T + V  G   T  E +  L ++  ++++ +      
Sbjct: 24  FEGRSLVAYLDPVG-IPTICEGIT-AGVRMGDRATPAECDALLERELQRAVDAV--DRQV 79

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
           L    + R  A+  FV+N+G G   +ST  ++++A D   A  E  +W  AGGK L GLV
Sbjct: 80  LVPLPDTRRAALGSFVYNVGEGQLARSTLLRKLNAGDVRGACAELSRWVYAGGKKLGGLV 139

Query: 159 KRRDAEVKL 167
           +RR AE +L
Sbjct: 140 RRRAAEREL 148


>gi|38707914|ref|NP_945054.1| gp24 [Burkholderia phage phi1026b]
 gi|76811859|ref|YP_333098.1| hypothetical protein BURPS1710b_1695 [Burkholderia pseudomallei
           1710b]
 gi|38505406|gb|AAR23175.1| gp24 [Burkholderia phage phi1026b]
 gi|76581312|gb|ABA50787.1| gp24 [Burkholderia pseudomallei 1710b]
          Length = 163

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 63/140 (45%), Gaps = 10/140 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L+ ++  FEG  L A  D  G   T   G T  DV  G   T  E    L +   +    
Sbjct: 19  LLSIIPAFEGEVLVARPDPIG-IVTACNGDT-KDVYAGQRFTRDECRARLEQRLIEHAEP 76

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P L+  +  +L A   F +N+G   Y  ST  +R +A DW  A            
Sbjct: 77  VLTCTPGLRGRT-YQLAAAVSFAYNIGPRAYCGSTTARRFNAGDWRGACRAINESDNGRP 135

Query: 145 KWTKAGGKVLPGLVKRRDAE 164
           +W  AGG+VLPGLVKRR  E
Sbjct: 136 QWVTAGGRVLPGLVKRRATE 155


>gi|9628685|ref|NP_043551.1| lysin [Lactococcus phage c2]
 gi|50402201|sp|P62692|LYS_BPLC2 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|50402202|sp|P62693|LYS_BPPHV RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|1146301|gb|AAA92182.1| lysin [Lactococcus phage c2]
 gi|2689214|emb|CAA34300.1| lysin (AA 1-226) [Lactococcus phage phi-vML3]
          Length = 226

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (50%), Gaps = 19/142 (13%)

Query: 33  IKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           + ++KEFEG RLTAY+ +     +TIG+GH G  VT G T T+ +A+  L  D +     
Sbjct: 8   LNLIKEFEGCRLTAYKPVPWEQMYTIGWGHYG--VTAGTTWTQAQADSQLEIDINNKYAP 65

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK-----AAEECKKW 146
           ++++    K+ ++N   A+    +N G      + F     A  W        A    K+
Sbjct: 66  MVDAYVKGKA-NQNEFDALVSLAYNCG------NVFV----ADGWAPFSHAYCASMIPKY 114

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AGG+VL GLV+RR AE+ L 
Sbjct: 115 RNAGGQVLQGLVRRRQAELNLF 136


>gi|330999729|ref|ZP_08323438.1| phage lysozyme [Parasutterella excrementihominis YIT 11859]
 gi|329574235|gb|EGG55811.1| phage lysozyme [Parasutterella excrementihominis YIT 11859]
          Length = 165

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 56/163 (34%), Positives = 78/163 (47%), Gaps = 33/163 (20%)

Query: 30  NALIK--MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           N LI    +K++EGLRL AYR   GG  TIGYGHT   V  G +I+ +EAE  L  D   
Sbjct: 12  NPLIAEDFVKKWEGLRLKAYR-CPGGVLTIGYGHT-KGVKPGQSISRQEAEKLLRDD--- 66

Query: 88  SLNLLLESSPALKSTSENRL-----VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
               L+E +  L      +L     +A+ D  FNLG+    KS     +++   + A E 
Sbjct: 67  ----LIEHAEGLAPYVTCKLTAGQYIALLDLAFNLGVSAVAKSKTLGYLNSGKLDLAKEG 122

Query: 143 CKKWTKA-------------GGK----VLPGLVKRRDAEVKLL 168
            + + K               GK    +LPGL+ RR+ EVKL+
Sbjct: 123 FRSFAKKKIRDRNGNLVKDEHGKQMYEILPGLMNRREDEVKLM 165


>gi|194435198|ref|ZP_03067427.1| lysozyme [Shigella dysenteriae 1012]
 gi|194416559|gb|EDX32699.1| lysozyme [Shigella dysenteriae 1012]
 gi|332094964|gb|EGJ00004.1| phage lysozyme family protein [Shigella dysenteriae 155-74]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVVPGMKLSKEKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQEAAL 170


>gi|295096854|emb|CBK85944.1| Phage-related lysozyme (muraminidase) [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 179

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 73/154 (47%), Gaps = 17/154 (11%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG  LTAY+D G G WTI  G T   G  V +GM +T+ + +     +
Sbjct: 22  APQILDQFLNEKEGNSLTAYKD-GSGIWTICRGATMVDGKPVAQGMKLTQAKCDQVNAIE 80

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 81  RDKALAWVDRNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACESI 138

Query: 144 KKWTKAGGKVLP----------GLVKRRDAEVKL 167
           + W K GG+             G V+RRD E  L
Sbjct: 139 RWWIKDGGRDCRLTKGQKNGCYGQVERRDQESAL 172


>gi|193069583|ref|ZP_03050536.1| phage lysozyme [Escherichia coli E110019]
 gi|193070518|ref|ZP_03051458.1| phage lysozyme [Escherichia coli E110019]
 gi|192956212|gb|EDV86675.1| phage lysozyme [Escherichia coli E110019]
 gi|192957130|gb|EDV87580.1| phage lysozyme [Escherichia coli E110019]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVAKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|218557472|ref|YP_002390385.1| membrane-associated lysozyme; Qin prophage [Escherichia coli S88]
 gi|218364241|emb|CAR01907.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli S88]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|311278457|ref|YP_003940688.1| glycoside hydrolase family 24 [Enterobacter cloacae SCF1]
 gi|308747652|gb|ADO47404.1| glycoside hydrolase family 24 [Enterobacter cloacae SCF1]
          Length = 168

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 59/138 (42%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + +L + EG RL  Y+    G WT G GHT   V+    I+E+EA   L+ D  K    L
Sbjct: 33  LALLADLEGCRLRPYQ-CSAGVWTSGIGHTAG-VSPARDISEREAAHNLIDDVIKVEQRL 90

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
              +PA     +    A+  F FN+G      ST    V+ + W  A ++  +W    G 
Sbjct: 91  NACTPA--EIPQPVYDALVSFAFNVGASAACASTLAYFVNQRQWRNACDQLPRWVFINGI 148

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E    L 
Sbjct: 149 KSQGLENRRQRERAYCLR 166


>gi|237509854|ref|ZP_04522569.1| phage lysozyme [Burkholderia pseudomallei MSHR346]
 gi|235002059|gb|EEP51483.1| phage lysozyme [Burkholderia pseudomallei MSHR346]
          Length = 169

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/140 (33%), Positives = 63/140 (45%), Gaps = 10/140 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L+ ++  FEG  L A  D  G   T   G T  DV  G   T  E    L +   +    
Sbjct: 25  LLSIIPAFEGEVLVARPDPIGIV-TACNGDT-KDVYAGQRFTRDECRARLEQRLIEHAEP 82

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P L+  +  +L A   F +N+G   Y  ST  +R +A DW  A            
Sbjct: 83  VLTCTPGLRGRT-YQLAAAVSFAYNIGPRAYCGSTTARRFNAGDWRGACRAINESDNGRP 141

Query: 145 KWTKAGGKVLPGLVKRRDAE 164
           +W  AGG+VLPGLVKRR  E
Sbjct: 142 QWVTAGGRVLPGLVKRRATE 161


>gi|117624135|ref|YP_853048.1| putative phage lysozyme [Escherichia coli APEC O1]
 gi|115513259|gb|ABJ01334.1| putative phage lysozyme [Escherichia coli APEC O1]
          Length = 177

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/152 (34%), Positives = 75/152 (49%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L   +E +  +  T E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKAL-AWVERNIKVPMT-EPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|506456|emb|CAA84289.1| lysin [Lactococcus phage c2]
          Length = 241

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 72/142 (50%), Gaps = 19/142 (13%)

Query: 33  IKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           + ++KEFEG RLTAY+ +     +TIG+GH G  VT G T T+ +A+  L  D +     
Sbjct: 23  LNLIKEFEGCRLTAYKPVPWEQMYTIGWGHYG--VTAGTTWTQAQADSQLEIDINNKYAP 80

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK-----AAEECKKW 146
           ++++    K+ ++N   A+    +N G      + F     A  W        A    K+
Sbjct: 81  MVDAYVKGKA-NQNEFDALVSLAYNCG------NVFV----ADGWAPFSHAYCASMIPKY 129

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AGG+VL GLV+RR AE+ L 
Sbjct: 130 RNAGGQVLQGLVRRRQAELNLF 151


>gi|260868594|ref|YP_003234996.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|257764950|dbj|BAI36445.1| putative endolysin [Escherichia coli O111:H- str. 11128]
          Length = 177

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVIPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|114797826|ref|YP_759989.1| putative lysozyme [Hyphomonas neptunium ATCC 15444]
 gi|114738000|gb|ABI76125.1| putative lysozyme [Hyphomonas neptunium ATCC 15444]
          Length = 421

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 71/141 (50%), Gaps = 7/141 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++K FEG R  A R +  G W +GYGHT +    G+ +T ++AE  L       +  L
Sbjct: 12  LELIKGFEGFRPRASR-LPDGRWIVGYGHTRT-ARPGLQVTPQDAELVLAHSDLPLIEQL 69

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--G 150
           ++    L   ++N   A+  F +N+G G +  S+    ++  D   AA +   W K    
Sbjct: 70  IQDE-VLAPLTQNEFDALVSFAWNIGPGAFQSSSVLANLNEGDRLSAASDMWLWRKGRVS 128

Query: 151 G--KVLPGLVKRRDAEVKLLL 169
           G  K++  LV+RR AE+ L L
Sbjct: 129 GEVKIIDALVRRRAAEISLFL 149


>gi|256424879|ref|YP_003125532.1| glycoside hydrolase family 24 [Chitinophaga pinensis DSM 2588]
 gi|256039787|gb|ACU63331.1| glycoside hydrolase family 24 [Chitinophaga pinensis DSM 2588]
          Length = 165

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 74/151 (49%), Gaps = 18/151 (11%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSL 89
           K++K FE  RL AY+D   G WTIG+G+T    G  V +G TIT++ A+          +
Sbjct: 9   KLIKHFEKCRLAAYQD-SKGIWTIGWGNTVYEDGKAVKKGDTITQQRADALFTNIKKGFV 67

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ-----------RVDAQDWEK 138
             + + +  +K   + +  A+  F +N+G  + NK+   +           + D +D   
Sbjct: 68  ADVNKLTTGIKGLKQQQFDALVCFAYNVG-SDMNKNGIAEGLGDSTLLKVVKADPKD-PS 125

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
              E  KW  +GGKVL GL +RR AE  L +
Sbjct: 126 VVMEFLKWNMSGGKVLDGLTRRRKAEAYLYM 156


>gi|67524523|ref|XP_660323.1| hypothetical protein AN2719.2 [Aspergillus nidulans FGSC A4]
 gi|40743831|gb|EAA63017.1| hypothetical protein AN2719.2 [Aspergillus nidulans FGSC A4]
 gi|259486370|tpe|CBF84153.1| TPA: conserved hypothetical protein [Aspergillus nidulans FGSC A4]
          Length = 186

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 77/151 (50%), Gaps = 8/151 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLL 82
           V  A   ++K FE      Y D G G  TIGYGH     + SDV   + ++E++      
Sbjct: 27  VNTATTDLMKAFESWEPDVYDD-GYGNPTIGYGHLCSDWSCSDVAYDIPLSEEDGVKLFA 85

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AA 140
           +D +   + ++ +  +  + ++N+  A+  + +N+G G   +ST   R++A +     A 
Sbjct: 86  EDIAVYQDGVVSALDSSVTLNDNQYGALVSWCYNVGAGAVAESTLAARLNAGEDPNTVAE 145

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           EE  KW  A G+V  GL +RR+AE++L   S
Sbjct: 146 EELIKWVYANGEVSEGLKRRRNAEIELFQTS 176


>gi|331674153|ref|ZP_08374913.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           TA280]
 gi|331068247|gb|EGI39642.1| putative lysozyme from lambdoid prophage Qin [Escherichia coli
           TA280]
          Length = 177

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 52/153 (33%), Positives = 75/153 (49%), Gaps = 16/153 (10%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALK-STSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAE 141
           +  K+L  +  +   LK   +E +   +A F  +N+G G    STF +R++A D + A E
Sbjct: 81  ERDKALAWVERN---LKVPLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACE 137

Query: 142 ECKKWTKAGGKVLP-------GLVKRRDAEVKL 167
             + W K GG+          G V RRD E  L
Sbjct: 138 AIRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|320663415|gb|EFX30710.1| Phage-related lysozyme (muraminidase) [Escherichia coli O55:H7 str.
           USDA 5905]
          Length = 177

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|290474427|ref|YP_003467307.1| putative Qin prophage; lysozyme [Xenorhabdus bovienii SS-2004]
 gi|289173740|emb|CBJ80520.1| putative Qin prophage; lysozyme [Xenorhabdus bovienii SS-2004]
          Length = 179

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 78/152 (51%), Gaps = 17/152 (11%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKS 88
           L + L E EG RL+AYRD GGG WTI  G T   G  V +GM +  ++ +     +A ++
Sbjct: 26  LSQFLDEKEGNRLSAYRD-GGGIWTICRGVTRIDGKAVYKGMKLAPEQCDVLNRIEADRA 84

Query: 89  LNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           ++ + ++       ++ ++  +A F  +N+G G    STF ++++A D + A  E K+W 
Sbjct: 85  IDWVKKNVRV--PLTDPQIAGIASFCPYNIGPGKCFSSTFYRKLNAGDKKGACAEIKRWV 142

Query: 148 KAGGKVLP----------GLVKRRDAEVKLLL 169
             GG+             G V RRD E +L+ 
Sbjct: 143 YDGGRDCRKTQGQPNGCYGQVLRRDQEAELVC 174


>gi|323157301|gb|EFZ43419.1| phage lysozyme family protein [Escherichia coli EPECa14]
          Length = 177

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +T+++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLTKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|194429897|ref|ZP_03062408.1| phage lysozyme [Escherichia coli B171]
 gi|194412053|gb|EDX28364.1| phage lysozyme [Escherichia coli B171]
          Length = 177

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKSACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|170681309|ref|YP_001743244.1| phage lysozyme [Escherichia coli SMS-3-5]
 gi|170519027|gb|ACB17205.1| phage lysozyme [Escherichia coli SMS-3-5]
          Length = 177

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|300902582|ref|ZP_07120559.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|301019541|ref|ZP_07183705.1| phage lysozyme [Escherichia coli MS 196-1]
 gi|301301971|ref|ZP_07208104.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|299882168|gb|EFI90379.1| phage lysozyme [Escherichia coli MS 196-1]
 gi|300405395|gb|EFJ88933.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|300842523|gb|EFK70283.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|315253757|gb|EFU33725.1| phage lysozyme [Escherichia coli MS 85-1]
          Length = 177

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|254261522|ref|ZP_04952576.1| phage lysozyme [Burkholderia pseudomallei 1710a]
 gi|254220211|gb|EET09595.1| phage lysozyme [Burkholderia pseudomallei 1710a]
          Length = 145

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/140 (32%), Positives = 62/140 (44%), Gaps = 10/140 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           ++ ++  FEG  L A  D  G   T   G T  DV  G   T  E    L +   +    
Sbjct: 1   MLSIIPAFEGEVLVARPDPIG-IVTACNGDT-KDVYAGQRFTRDECRARLEQRLIEHAEP 58

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P L+  +   L A   F +N+G   Y  ST  +R +A DW  A            
Sbjct: 59  VLTCTPGLRGRTYQ-LAAAVSFAYNIGPRAYCGSTTARRFNAGDWRGACRAINESDNGRP 117

Query: 145 KWTKAGGKVLPGLVKRRDAE 164
           +W  AGG+VLPGLVKRR  E
Sbjct: 118 QWVTAGGRVLPGLVKRRATE 137


>gi|209901328|ref|NP_042321.2| lysin [Lactococcus phage bIL67]
 gi|169658396|gb|AAA74335.2| lysin [Lactococcus phage bIL67]
          Length = 226

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/142 (33%), Positives = 73/142 (51%), Gaps = 19/142 (13%)

Query: 33  IKMLKEFEGLRLTAYRDIGG-GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           + ++KEFEG RLTAY+ +     +TIG+GH G  VT G T T+ +A+  L  D +     
Sbjct: 8   LNLIKEFEGCRLTAYKPVPWEKMYTIGWGHYG--VTAGTTWTQAQADSQLEIDINNKYAP 65

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK-----AAEECKKW 146
           ++++    K+ ++N   A+    +N G      + F     A  W +      A    K+
Sbjct: 66  MVDAYVKGKA-NQNEFDALVSLAYNCG------NVFV----ADGWAEFSHAYCASMIPKY 114

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AGG+VL GLV+RR AE+ L 
Sbjct: 115 RNAGGQVLQGLVRRRQAELDLF 136


>gi|260855350|ref|YP_003229241.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257753999|dbj|BAI25501.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
          Length = 177

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +T+++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLTKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|193066793|ref|ZP_03047805.1| phage lysozyme [Escherichia coli E22]
 gi|192925560|gb|EDV80242.1| phage lysozyme [Escherichia coli E22]
          Length = 177

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       ++ +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVAKNIKV--PLTDPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|218529665|ref|YP_002420481.1| glycoside hydrolase family 24 [Methylobacterium chloromethanicum
           CM4]
 gi|218521968|gb|ACK82553.1| glycoside hydrolase family 24 [Methylobacterium chloromethanicum
           CM4]
          Length = 187

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           EG RL AYRD   G WTIG GHT +        G+ I   EA+    +D +  +  + E+
Sbjct: 15  EGRRLEAYRD-SVGVWTIGIGHTAAAGPPLPRAGLRIEAGEADAIFTRDVAAFVRTVAET 73

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P  +   ++   A+    FN+G   + +ST  +R+ A DW  A E    W +       
Sbjct: 74  VP--EPLPQHAFDALVSLCFNIGPAAFRRSTVLRRLRAGDWAGAGEAILMWNRPA----- 126

Query: 156 GLVKRRDAE 164
            ++ RR  E
Sbjct: 127 AIIPRRQGE 135


>gi|15834216|ref|NP_312989.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168761530|ref|ZP_02786537.1| putative endolysin [Escherichia coli O157:H7 str. EC4501]
 gi|217324908|ref|ZP_03440992.1| putative endolysin [Escherichia coli O157:H7 str. TW14588]
 gi|261226639|ref|ZP_05940920.1| putative endolysin [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258671|ref|ZP_05951204.1| putative endolysin [Escherichia coli O157:H7 str. FRIK966]
 gi|13364438|dbj|BAB38385.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|189368033|gb|EDU86449.1| putative endolysin [Escherichia coli O157:H7 str. EC4501]
 gi|217321129|gb|EEC29553.1| putative endolysin [Escherichia coli O157:H7 str. TW14588]
 gi|326348044|gb|EGD71754.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           O157:H7 str. 1044]
          Length = 166

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 63/126 (50%), Gaps = 3/126 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           +EG   + Y D  G   TI YGHTG DV  GMT+T++E  + L KD   +   +      
Sbjct: 33  WEGKENSTYIDPTGTP-TICYGHTGPDVKPGMTLTDEECLELLEKDMKWAFAAIDRRVQV 91

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
               +  + VA+A ++F  G  N+  ST  + ++A     + ++  +W  + G  LPGL 
Sbjct: 92  --PLTRGQTVALASWIFWAGETNFRNSTLLRLINAGQMPASCKQYIRWIYSKGVKLPGLE 149

Query: 159 KRRDAE 164
            RR A+
Sbjct: 150 ARRSAD 155


>gi|227330018|ref|ZP_03834042.1| putative phage lysozyme [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 132

 Score = 62.4 bits (150), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 45/137 (32%), Positives = 66/137 (48%), Gaps = 12/137 (8%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSP 97
           + EG RL+ Y+      WT G GHT + V  G TITE+EA   L+ D      L +E + 
Sbjct: 1   DLEGCRLSPYQ-CSANVWTNGIGHT-AGVVPGKTITEREAAVNLVADV-----LRVEKAL 53

Query: 98  ALKSTSENRLVAVAD----FVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
           A +  + N   AV D    F FN+G+G   +ST    ++   W  A  +  +W    G+V
Sbjct: 54  A-RCMAVNMPQAVYDAIVSFAFNVGVGAACRSTLAFFINKGQWSNACNQLLRWVYVNGQV 112

Query: 154 LPGLVKRRDAEVKLLLE 170
             G+  RR  E  + L+
Sbjct: 113 SRGIEIRRQRERAVCLK 129


>gi|227888067|ref|ZP_04005872.1| lysozyme [Escherichia coli 83972]
 gi|227834913|gb|EEJ45379.1| lysozyme [Escherichia coli 83972]
 gi|307552963|gb|ADN45738.1| putative phage lysozyme [Escherichia coli ABU 83972]
 gi|315295522|gb|EFU54848.1| phage lysozyme [Escherichia coli MS 153-1]
 gi|323956950|gb|EGB52679.1| phage lysozyme [Escherichia coli H263]
          Length = 177

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++ + +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKAKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|167574245|ref|ZP_02367119.1| gp24 [Burkholderia oklahomensis C6786]
          Length = 119

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 49/111 (44%), Gaps = 8/111 (7%)

Query: 65  DVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNK 124
           DV  G   +E E    L          +L  +P LK+    +L A   F +N+G   Y  
Sbjct: 6   DVVVGKAYSEAECRASLETQLIAHAQPVLRCTPGLKN-RPYQLAAAVSFAYNVGPNAYCN 64

Query: 125 STFKQRVDAQDWEKAAEEC-------KKWTKAGGKVLPGLVKRRDAEVKLL 168
           ST  +R  A DW  A            +W  AGG+VLPGLVKRR AE  L 
Sbjct: 65  STTAKRFSAGDWRGACRALNESDSGRPQWVTAGGRVLPGLVKRRAAERALC 115


>gi|295314792|gb|ADF97546.1| PlyM21 [uncultured phage]
          Length = 363

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 75/152 (49%), Gaps = 8/152 (5%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDF 80
           K+ V    + ++K +EG     Y D  G   TIGYG T    G+ V  G  I++ EA+  
Sbjct: 149 KMKVSKEGLDLIKFYEGFYDKTYLDPIGLP-TIGYGTTKWPNGNSVKMGEKISKVEADIL 207

Query: 81  LLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
           L +  ++    +          ++N+  ++A F +NLG G   K  +    ++ +DW  A
Sbjct: 208 LEQQVNEHAKTIFNYVKV--DLTQNQFDSLASFQYNLGSGILKKDPSIAAYINKKDWANA 265

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
               K + KAGGKVL GL KRR AE +L ++ 
Sbjct: 266 TRVMKLYNKAGGKVLAGLDKRRIAEAELFMKQ 297


>gi|193065458|ref|ZP_03046527.1| phage lysozyme [Escherichia coli E22]
 gi|192926863|gb|EDV81488.1| phage lysozyme [Escherichia coli E22]
          Length = 177

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++ +       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKAKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           + +K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERNKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|167619498|ref|ZP_02388129.1| gp24 [Burkholderia thailandensis Bt4]
 gi|257138654|ref|ZP_05586916.1| hypothetical protein BthaA_05521 [Burkholderia thailandensis E264]
          Length = 162

 Score = 62.0 bits (149), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 66/146 (45%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G T +E E    L          
Sbjct: 18  LTVIVPKFEGVKLAGYLDPVG-IPTKCMGDT-RDVIVGRTYSEAECRQSLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGRP 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 135 QWVTARGRVLPGLVKRR-AEERAICE 159


>gi|323160821|gb|EFZ46749.1| phage lysozyme family protein [Escherichia coli E128010]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++     + SE +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--ALSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|26249022|ref|NP_755062.1| lysozyme from lambdoid prophage Qin [Escherichia coli CFT073]
 gi|117626706|ref|YP_860029.1| Qin prophage; lysozyme [Escherichia coli APEC O1]
 gi|157161030|ref|YP_001458348.1| phage lysozyme [Escherichia coli HS]
 gi|218561573|ref|YP_002394486.1| membrane-associated lysozyme; Qin prophage [Escherichia coli S88]
 gi|254161614|ref|YP_003044722.1| putative lysozyme [Escherichia coli B str. REL606]
 gi|300925268|ref|ZP_07141163.1| phage lysozyme [Escherichia coli MS 182-1]
 gi|26109429|gb|AAN81632.1|AE016765_34 Probable lysozyme from lambdoid prophage Qin [Escherichia coli
           CFT073]
 gi|115515830|gb|ABJ03905.1| Qin prophage; predicted lysozyme [Escherichia coli APEC O1]
 gi|157066710|gb|ABV05965.1| phage lysozyme [Escherichia coli HS]
 gi|218368342|emb|CAR06161.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli S88]
 gi|253973515|gb|ACT39186.1| predicted lysozyme [Escherichia coli B str. REL606]
 gi|300418601|gb|EFK01912.1| phage lysozyme [Escherichia coli MS 182-1]
 gi|323190386|gb|EFZ75662.1| phage lysozyme family protein [Escherichia coli RN587/1]
 gi|323962250|gb|EGB57841.1| phage lysozyme [Escherichia coli H489]
 gi|324112030|gb|EGC06008.1| phage lysozyme [Escherichia fergusonii B253]
 gi|325499890|gb|EGC97749.1| lysozyme from lambdoid prophage Qin [Escherichia fergusonii ECD227]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|260844541|ref|YP_003222319.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|257759688|dbj|BAI31185.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGTTRVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDLKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|260844403|ref|YP_003222181.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|257759550|dbj|BAI31047.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGTTRVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDLKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|238754918|ref|ZP_04616268.1| Lysozyme [Yersinia ruckeri ATCC 29473]
 gi|238706929|gb|EEP99296.1| Lysozyme [Yersinia ruckeri ATCC 29473]
          Length = 145

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 71/146 (48%), Gaps = 22/146 (15%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
           FE L L +Y+D   G W IGY H+  +V +G  I E  A   L  D     + LN ++ +
Sbjct: 3   FESLSLESYQD-SNGIWNIGYSHS-DNVIQGQKIEELTAMSLLQSDIMICEECLNNIV-A 59

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYN-KSTFKQRVDAQ-----------DWEKAAEEC 143
            P     ++N+  A+  F+FN+G+G+   KS F+     Q           ++  AA+E 
Sbjct: 60  VP----LNQNQFDALVSFLFNVGVGHPGVKSGFQYLKSGQPSNMLININKGNFVDAADEF 115

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLL 169
             W   G    P LVKRR+ E+KL +
Sbjct: 116 SYWIYMGSIRSPSLVKRREKEMKLFM 141


>gi|123442579|ref|YP_001006556.1| putative phage lysozyme [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089540|emb|CAL12388.1| putative phage lysozyme [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 160

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/132 (31%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG +  AY D+     T+  GHTG D+      ++ E +  L KD +     +     A
Sbjct: 31  LEGRKYVAYYDVVN-VLTVCDGHTGKDIIPNKKYSDAECDALLQKDLAPVQRTV---DAA 86

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K   S+ +  A+  F +N+G   + KST  ++++  D + A +E ++WT AGGK   GL
Sbjct: 87  VKVPLSKYQKAALYSFTYNVGQSAFTKSTLLKKLNTGDIKGACDELRRWTYAGGKPWKGL 146

Query: 158 VKRRDAEVKLLL 169
             RR+ E +L L
Sbjct: 147 QNRREIERELCL 158


>gi|315619693|gb|EFV00214.1| phage lysozyme family protein [Escherichia coli 3431]
          Length = 166

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 62/126 (49%), Gaps = 3/126 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           +EG   T Y D  G   TI YGHTG DV  GMT T++E  + L KD   +   +      
Sbjct: 33  WEGKENTTYIDPTGTP-TICYGHTGPDVKPGMTKTDEECLELLEKDMKWAFAAIDRHVQV 91

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
               +  + VA+A ++F  G  N+  ST  + ++A     + ++  +W  + G  LPGL 
Sbjct: 92  --PLTRGQTVALASWIFWAGETNFRNSTLLRLINAGQMPASCKQYIRWIYSKGVKLPGLE 149

Query: 159 KRRDAE 164
            RR A+
Sbjct: 150 ARRSAD 155


>gi|323969487|gb|EGB64779.1| phage lysozyme [Escherichia coli TA007]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  ++L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDRALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKSACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|23009835|ref|ZP_00050737.1| COG3772: Phage-related lysozyme (muraminidase) [Magnetospirillum
           magnetotacticum MS-1]
          Length = 196

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 64/129 (49%), Gaps = 12/129 (9%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           EG RL AYRD   G WT+G GHT +        G+ + E+EA+   ++D ++ + ++  +
Sbjct: 27  EGRRLEAYRD-SAGIWTVGVGHTAASGPPIPRAGLRLDEQEADALFVRDVARFVRIVAGA 85

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P  ++  ++   A+    FN+G   + +ST  +R+ A D   AAE    W +       
Sbjct: 86  LP--EALPQHAFDALVSLCFNIGPAAFLRSTVLRRLRAGDRAGAAEAILLWDRPA----- 138

Query: 156 GLVKRRDAE 164
            L+ RR  E
Sbjct: 139 ALIPRRQGE 147


>gi|327253276|gb|EGE64925.1| phage lysozyme family protein [Escherichia coli STEC_7v]
          Length = 177

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 65/130 (50%), Gaps = 7/130 (5%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVAKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGK 152
            + W K GG+
Sbjct: 139 IRWWIKDGGR 148


>gi|83720685|ref|YP_442450.1| hypothetical protein BTH_I1920 [Burkholderia thailandensis E264]
 gi|134276990|ref|ZP_01763705.1| gp24 [Burkholderia pseudomallei 305]
 gi|83654510|gb|ABC38573.1| gp24 [Burkholderia thailandensis E264]
 gi|134250640|gb|EBA50719.1| gp24 [Burkholderia pseudomallei 305]
          Length = 165

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 66/146 (45%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D   G  T   G T  DV  G T +E E    L          
Sbjct: 21  LTVIVPKFEGVKLAGYLD-PVGIPTKCMGDT-RDVIVGRTYSEAECRQSLETQLIAHAEP 78

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 79  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGRP 137

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 138 QWVTARGRVLPGLVKRR-AEERAICE 162


>gi|193066607|ref|ZP_03047644.1| phage lysozyme [Escherichia coli E22]
 gi|192925735|gb|EDV80392.1| phage lysozyme [Escherichia coli E22]
          Length = 177

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|194430038|ref|ZP_03062544.1| lysozyme [Escherichia coli B171]
 gi|194411913|gb|EDX28229.1| lysozyme [Escherichia coli B171]
 gi|284921105|emb|CBG34171.1| putative phage lysozyme [Escherichia coli 042]
          Length = 177

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|91210513|ref|YP_540499.1| putative phage lysozyme [Escherichia coli UTI89]
 gi|237705253|ref|ZP_04535734.1| lysozyme protein R [Escherichia sp. 3_2_53FAA]
 gi|91072087|gb|ABE06968.1| putative phage lysozyme [Escherichia coli UTI89]
 gi|226900010|gb|EEH86269.1| lysozyme protein R [Escherichia sp. 3_2_53FAA]
 gi|294490103|gb|ADE88859.1| phage lysozyme [Escherichia coli IHE3034]
 gi|307627199|gb|ADN71503.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli UM146]
 gi|315288682|gb|EFU48080.1| phage lysozyme [Escherichia coli MS 110-3]
 gi|323953730|gb|EGB49548.1| phage lysozyme [Escherichia coli H263]
          Length = 177

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGNWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|215486520|ref|YP_002328951.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|312966532|ref|ZP_07780753.1| phage lysozyme family protein [Escherichia coli 2362-75]
 gi|215264592|emb|CAS08960.1| predicted endolysin [Escherichia coli O127:H6 str. E2348/69]
 gi|312288807|gb|EFR16706.1| phage lysozyme family protein [Escherichia coli 2362-75]
          Length = 177

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVFRRDQESAL 170


>gi|323977140|gb|EGB72227.1| phage lysozyme [Escherichia coli TW10509]
          Length = 177

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|302881366|ref|XP_003039598.1| hypothetical protein NECHADRAFT_55896 [Nectria haematococca mpVI
           77-13-4]
 gi|256720456|gb|EEU33885.1| hypothetical protein NECHADRAFT_55896 [Nectria haematococca mpVI
           77-13-4]
          Length = 259

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 70/145 (48%), Gaps = 8/145 (5%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-----DVTEGMTITEKEAEDFLLKD 84
            A + ++ EFEG     Y+D  G   T+GYGH  S     DV   + +++   +  L  D
Sbjct: 102 QATVDLIGEFEGFVPHIYKDAAGYP-TVGYGHLCSNSKCTDVKYPIPLSKTNGKKLLADD 160

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA--AEE 142
             K    + +   +  + ++N   A+  + FN+G G    S   +R++  +      + E
Sbjct: 161 MRKFEKCIAKMVSSKVTLNKNEFGALVSWSFNVGCGAAEGSQLIKRLNKGEKPNTVISGE 220

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKL 167
             KW  AG + LPGLV+RR+AE+ L
Sbjct: 221 LPKWVYAGKRKLPGLVRRRNAEIAL 245


>gi|167814857|ref|ZP_02446537.1| gp24 [Burkholderia pseudomallei 91]
 gi|167911598|ref|ZP_02498689.1| gp24 [Burkholderia pseudomallei 112]
          Length = 162

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 66/146 (45%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G T +E E    L          
Sbjct: 18  LAVVVPKFEGVKLAGYLDPVG-IPTKCMGDT-RDVIVGRTYSEAECRQSLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGRP 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 135 QWVTARGRVLPGLVKRR-AEERAICE 159


>gi|327395311|dbj|BAK12733.1| lysozyme NucD3 [Pantoea ananatis AJ13355]
          Length = 169

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 4/147 (2%)

Query: 24  NKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLK 83
           N +    A +K++ + EG R + Y+    G WT G GHT   VT    + E++A   L+ 
Sbjct: 24  NMLKTSEAGLKLIADAEGCRTSPYQ-CSAGVWTNGIGHT-QGVTPTSVVNERQAAVNLVY 81

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           D  +    + +  P  +        AV  F FN+G+    +ST    +++  W  A  + 
Sbjct: 82  DVMRVERGIDQCMP--REMPYQVYDAVVSFGFNVGVHAACQSTLAGLINSGRWHDACLQL 139

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           K+W    G   PGL  RR  E+   L+
Sbjct: 140 KRWVYVKGTYNPGLDNRRQREMAWCLK 166


>gi|157166033|ref|YP_001449285.1| putative R protein [Phage BP-4795]
 gi|260854755|ref|YP_003228646.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|49523631|emb|CAD88849.1| putative R protein [Enterobacteria phage BP-4795]
 gi|257753404|dbj|BAI24906.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|323157440|gb|EFZ43552.1| phage lysozyme family protein [Escherichia coli EPECa14]
          Length = 177

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GTGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G + RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQISRRDQESAL 170


>gi|300715678|ref|YP_003740481.1| phage lysozyme [Erwinia billingiae Eb661]
 gi|299061514|emb|CAX58628.1| Phage lysozyme [Erwinia billingiae Eb661]
          Length = 158

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 64/138 (46%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ ++EG RL+ Y+    G WT G G+T   V  G TITE++A    + +  +    L
Sbjct: 21  MRLIADYEGCRLSPYQ-CSAGVWTDGIGNT-HGVVLGRTITERQAAGNFITNVLRVETAL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
                 +    +    AV  F FN+G GN   ST  + + A+ W  A  +  +W    G 
Sbjct: 79  ARCVGVV--MPQKVYDAVVSFAFNVGTGNACTSTMVKLLKAERWRDACNQLPRWVYVKGV 136

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 137 FNQGLDNRRGRELAWCLK 154


>gi|320200911|gb|EFW75496.1| Phage endolysin [Escherichia coli EC4100B]
          Length = 177

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|330911319|gb|EGH39829.1| putative lysozyme from lambdoid prophage DLP12 [Escherichia coli
           AA86]
          Length = 166

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 62/126 (49%), Gaps = 3/126 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           +EG   T Y D  G   TI YGHTG DV  GMT T++E  + L KD   +   +      
Sbjct: 33  WEGKENTTYIDPTGTP-TICYGHTGPDVKPGMTKTDEECLELLEKDMKWAFVAIDRHVQV 91

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
               +  + VA+A ++F  G  N+  ST  + ++A     + ++  +W  + G  LPGL 
Sbjct: 92  --PLTRGQTVALASWIFWAGGTNFRNSTLLRLINAGQMPASCKQYIRWIYSKGVKLPGLE 149

Query: 159 KRRDAE 164
            RR A+
Sbjct: 150 ARRSAD 155


>gi|9630497|ref|NP_046950.1| gp54 [Enterobacteria phage N15]
 gi|9910761|sp|O64362|LYS_BPN15 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase; AltName:
           Full=Protein gp54
 gi|3192716|gb|AAC19069.1| gp54 [Enterobacteria phage N15]
          Length = 178

 Score = 61.2 bits (147), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 50/154 (32%), Positives = 72/154 (46%), Gaps = 17/154 (11%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG  LTAY+D G G WTI  G T   G  V +GM +T+ +       +
Sbjct: 21  APQILDQFLDEKEGNSLTAYKD-GSGIWTICRGATMVDGKPVMQGMKLTQAKCNQVNAIE 79

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
            +K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 80  RNKALAWVDRNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRHGACEAI 137

Query: 144 KKWTKAGGKVLP----------GLVKRRDAEVKL 167
           + W K GG+             G V+RRD E  L
Sbjct: 138 RWWIKDGGRDCRLTKGQKNGCYGQVERRDQESAL 171


>gi|323176694|gb|EFZ62284.1| phage lysozyme family protein [Escherichia coli 1180]
          Length = 177

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVAKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|194430407|ref|ZP_03062892.1| lysozyme [Escherichia coli B171]
 gi|194411545|gb|EDX27882.1| lysozyme [Escherichia coli B171]
          Length = 177

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|213608010|ref|ZP_03368836.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Typhi
           str. E98-2068]
          Length = 146

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 59/114 (51%), Gaps = 4/114 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A   L+ +  + +   
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVVPGKTITERQAAQGLITNVLR-VERA 90

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
           LE    ++   +    AV  F FN+G GN   ST  + ++ + W  A  +  +W
Sbjct: 91  LEKC-VVQPMPQKVYDAVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRW 143


>gi|331650018|ref|ZP_08351091.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M605]
 gi|331040963|gb|EGI13120.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M605]
          Length = 179

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +T+++ +     +
Sbjct: 25  APQILDQFLNEKEGNHTTAYRD-GSGIWTICRGTTMVDGKPVIPGMKLTKEKCDQVNAIE 83

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 84  RDKALAWVEKNIKV--PLTEPQKAGIASFCSYNIGPGKCFPSTFYKRLNAGDRKGACEAI 141

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 142 RWWIKDGGRDCRIRSNNCYGQVVRRDQESAL 172


>gi|84391267|ref|ZP_00991598.1| putative phage lysozyme [Vibrio splendidus 12B01]
 gi|84376556|gb|EAP93434.1| putative phage lysozyme [Vibrio splendidus 12B01]
          Length = 175

 Score = 61.2 bits (147), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 68/144 (47%), Gaps = 17/144 (11%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE-AEDFL--LKDASKSLNLL 92
           +   EG R  AY+      WT G GHT + V +G  ++E+  A +F+  +K A KS+N  
Sbjct: 36  IANLEGCRTKAYQ-CSAHVWTNGLGHT-TGVKQGDVVSEEHIARNFIADIKTAEKSVNQH 93

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           L         ++ +   +  FVFNLG GN+ +ST  +  +     KA  E  +W    GK
Sbjct: 94  LTVD-----VTQAQFDVLVSFVFNLGTGNFKRSTMLKLFNQNQPSKACLELSRWVYVNGK 148

Query: 153 -------VLPGLVKRRDAEVKLLL 169
                     G+VKRR+ E +  L
Sbjct: 149 NCRGPDSQCSGVVKRRELEQQACL 172


>gi|320198532|gb|EFW73132.1| Phage lysin [Escherichia coli EC4100B]
          Length = 177

 Score = 60.8 bits (146), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G    D   V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDSKPVVPGMKLSKEKCDRVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       SE +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVEKN--IRVPLSEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|331680507|ref|ZP_08381166.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H591]
 gi|331071970|gb|EGI43306.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H591]
          Length = 177

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 50/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GFGIWTICRGATMVDGKPVIPGMKLSKEKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|168763628|ref|ZP_02788635.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|217329162|ref|ZP_03445242.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|189366277|gb|EDU84693.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|217317601|gb|EEC26029.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
          Length = 177

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|291618967|ref|YP_003521709.1| NucD2 [Pantoea ananatis LMG 20103]
 gi|291153997|gb|ADD78581.1| NucD2 [Pantoea ananatis LMG 20103]
          Length = 169

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 66/147 (44%), Gaps = 4/147 (2%)

Query: 24  NKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLK 83
           N +    A +K++ + EG R + Y+    G WT G GHT   VT    + E++A   L+ 
Sbjct: 24  NMLKTSEAGLKLIADAEGCRTSPYQ-CSAGVWTNGIGHT-QGVTPTSVVNERQAAVNLVY 81

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           D  +    + +  P  +        AV  F FN+G+    +ST    +++  W  A  + 
Sbjct: 82  DVMRVERGIDQCMP--REMPFQVYDAVVSFGFNVGVHAACQSTLAGLINSGRWHDACLQL 139

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           K+W    G   PGL  RR  E+   L+
Sbjct: 140 KRWVYVKGTYNPGLDNRRQREMAWCLK 166


>gi|323169503|gb|EFZ55176.1| phage lysozyme family protein [Shigella sonnei 53G]
          Length = 166

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 61/126 (48%), Gaps = 3/126 (2%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
           +EG   T Y D  G   TI YGHTG DV  GMT T++E  + L KD   +   +      
Sbjct: 33  WEGKENTTYIDPTGTP-TICYGHTGPDVKPGMTKTDEECLELLEKDMKWAFAAIDRHVQV 91

Query: 99  LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
               +  + VA+A ++F  G  N+  ST    ++A     + ++  +W  + G  LPGL 
Sbjct: 92  --PLTRGQTVALASWIFWAGETNFRNSTLLCLINAGQMPASCKQYIRWIYSKGVKLPGLE 149

Query: 159 KRRDAE 164
            RR A+
Sbjct: 150 ARRSAD 155


>gi|9632511|ref|NP_049505.1| endolysin [Enterobacteria phage 933W]
 gi|9633441|ref|NP_050544.1| R [Enterobacteria phage VT2-Sakai]
 gi|15800965|ref|NP_286981.1| putative lysozyme protein R of bacteriophage BP-933W [Escherichia
           coli O157:H7 EDL933]
 gi|15802641|ref|NP_288668.1| putative endolysin R of prophage CP-933V [Escherichia coli O157:H7
           EDL933]
 gi|15830467|ref|NP_309240.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|15832222|ref|NP_310995.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168752867|ref|ZP_02777889.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168756440|ref|ZP_02781447.1| lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168764165|ref|ZP_02789172.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168764782|ref|ZP_02789789.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168771787|ref|ZP_02796794.1| lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168778149|ref|ZP_02803156.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           O157:H7 str. EC4196]
 gi|168783650|ref|ZP_02808657.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|170783656|ref|YP_001648938.1| endolysin [Enterobacteria phage Min27]
 gi|195937938|ref|ZP_03083320.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208809601|ref|ZP_03251938.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208814445|ref|ZP_03255774.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208820398|ref|ZP_03260718.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209397513|ref|YP_002271434.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217327572|ref|ZP_03443655.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|217328165|ref|ZP_03444247.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254793980|ref|YP_003078817.1| putative endolysin R of prophage CP-933V [Escherichia coli O157:H7
           str. TW14359]
 gi|302393165|ref|YP_003828995.1| endolysin [Stx2 converting phage II]
 gi|302861200|ref|YP_003848901.1| endolysin [Stx1 converting phage]
 gi|59799807|sp|P68920|LYS_BP933 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|59799808|sp|P68921|LYS_BPVT2 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|4585422|gb|AAD25450.1|AF125520_45 endolysin [Enterobacteria phage 933W]
 gi|12514324|gb|AAG55592.1|AE005297_2 putative lysozyme protein R of bacteriophage BP-933W [Escherichia
           coli O157:H7 str. EDL933]
 gi|12516390|gb|AAG57223.1|AE005442_5 putative endolysin R of prophage CP-933V [Escherichia coli O157:H7
           str. EDL933]
 gi|5881637|dbj|BAA84328.1| R [Enterobacteria phage VT2-Sakai]
 gi|7649872|dbj|BAA94150.1| endolysin [Enterobacteria phage VT2-Sakai]
 gi|11875105|dbj|BAB19584.1| endolysin [Enterobacteria phage VT1-Sakai]
 gi|13360673|dbj|BAB34636.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|13362437|dbj|BAB36391.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|32128167|dbj|BAC77971.1| endolysin [Stx1 converting phage]
 gi|32128339|dbj|BAC78142.1| endolysin [Stx2 converting phage II]
 gi|163955750|gb|ABY49900.1| endolysin [Enterobacteria phage Min27]
 gi|187766805|gb|EDU30649.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           O157:H7 str. EC4196]
 gi|188013495|gb|EDU51617.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|188998993|gb|EDU67979.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189356529|gb|EDU74948.1| lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189359524|gb|EDU77943.1| lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189365276|gb|EDU83692.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|189365757|gb|EDU84173.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|208729402|gb|EDZ79003.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208735722|gb|EDZ84409.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208740521|gb|EDZ88203.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209158913|gb|ACI36346.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217318592|gb|EEC27018.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|217319939|gb|EEC28364.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254593380|gb|ACT72741.1| putative endolysin R of prophage CP-933V [Escherichia coli O157:H7
           str. TW14359]
 gi|320189867|gb|EFW64519.1| Phage endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|320192293|gb|EFW66938.1| Phage endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|326339434|gb|EGD63245.1| Phage endolysin [Escherichia coli O157:H7 str. 1125]
 gi|326343891|gb|EGD67652.1| Phage endolysin [Escherichia coli O157:H7 str. 1044]
          Length = 177

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|82544398|ref|YP_408345.1| lysozyme [Shigella boydii Sb227]
 gi|187733126|ref|YP_001879903.1| phage lysozyme [Shigella boydii CDC 3083-94]
 gi|81245809|gb|ABB66517.1| putative lysozyme [Shigella boydii Sb227]
 gi|187430118|gb|ACD09392.1| phage lysozyme [Shigella boydii CDC 3083-94]
 gi|320183751|gb|EFW58586.1| Phage lysin [Shigella flexneri CDC 796-83]
 gi|332094458|gb|EGI99507.1| phage lysozyme family protein [Shigella boydii 3594-74]
          Length = 177

 Score = 60.8 bits (146), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 70/152 (46%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLK 83
           P P  L + L E EG   TAYRD G G WTI  G    D   V  GM +++++ +     
Sbjct: 22  PAPEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDSKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|320646063|gb|EFX15029.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H-
           str. 493-89]
 gi|320651361|gb|EFX19783.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H-
           str. H 2687]
          Length = 177

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L   +E +  +  T E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKAL-AWVEKNIRVPLT-EPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|294676544|ref|YP_003577159.1| lysozyme [Rhodobacter capsulatus SB 1003]
 gi|294475364|gb|ADE84752.1| lysozyme [Rhodobacter capsulatus SB 1003]
          Length = 309

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 52/145 (35%), Positives = 76/145 (52%), Gaps = 12/145 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD--VTE--GMTITEKEAEDFLLKDASKS 88
           ++ L+  EG  L AYR    G WTIG G T +   +T   GM IT +++ D       K+
Sbjct: 8   VEALELEEGNVLRAYR-CPAGKWTIGPGLTAASGVITPKAGMVITAQQSRDL----TKKA 62

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA--EECKKW 146
           L    E   AL  T   +    A  +F+   G   K+++   + A+   KAA  E+ + W
Sbjct: 63  LAAKYEPRVALVMTGAKQHEFDAGVLFDWNTGAIQKASWVP-LWARKAGKAAISEKFRLW 121

Query: 147 TKAGGKVLPGLVKRRDAEVKLLLES 171
            K GGKVLPGLVKRRD E+++L ++
Sbjct: 122 NKGGGKVLPGLVKRRDRELRILFDA 146


>gi|15830786|ref|NP_309559.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|15831440|ref|NP_310213.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168751297|ref|ZP_02776319.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168757867|ref|ZP_02782874.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168764626|ref|ZP_02789633.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168771378|ref|ZP_02796385.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168783522|ref|ZP_02808529.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168802065|ref|ZP_02827072.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|195938909|ref|ZP_03084291.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208809229|ref|ZP_03251566.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208816257|ref|ZP_03257436.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208822327|ref|ZP_03262646.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209396756|ref|YP_002269993.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217328312|ref|ZP_03444394.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254792533|ref|YP_003077370.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H7
           str. TW14359]
 gi|13360996|dbj|BAB34955.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|13361652|dbj|BAB35609.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|188014614|gb|EDU52736.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|188999132|gb|EDU68118.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189355272|gb|EDU73691.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189359827|gb|EDU78246.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189365432|gb|EDU83848.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|189375898|gb|EDU94314.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|208729030|gb|EDZ78631.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208732905|gb|EDZ81593.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208737812|gb|EDZ85495.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209158156|gb|ACI35589.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217318739|gb|EEC27165.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254591933|gb|ACT71294.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H7
           str. TW14359]
 gi|320188159|gb|EFW62824.1| Phage endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|320636829|gb|EFX06721.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H7
           str. G5101]
 gi|320640724|gb|EFX10238.1| putative endolysin of prophage CP-933N [Escherichia coli O157:H7
           str. G5101]
 gi|326338672|gb|EGD62495.1| Phage endolysin [Escherichia coli O157:H7 str. 1125]
 gi|326341744|gb|EGD65529.1| Phage endolysin [Escherichia coli O157:H7 str. 1125]
 gi|326347991|gb|EGD71702.1| Phage endolysin [Escherichia coli O157:H7 str. 1044]
          Length = 177

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|15802437|ref|NP_288463.1| putative endolysin of prophage CP-933U [Escherichia coli O157:H7
           EDL933]
 gi|12516121|gb|AAG57017.1|AE005421_5 putative endolysin of prophage CP-933U [Escherichia coli O157:H7
           str. EDL933]
          Length = 177

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRXDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|194430088|ref|ZP_03062592.1| lysozyme [Escherichia coli B171]
 gi|194411859|gb|EDX28177.1| lysozyme [Escherichia coli B171]
          Length = 172

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 69/137 (50%), Gaps = 14/137 (10%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLL 92
           L   E +    YRDIGG   ++  GHTG D+ E    +  E    L   LK    +++ L
Sbjct: 34  LIHLENIAYMPYRDIGG-VLSVCVGHTGPDI-EMRRYSHAECMALLDSDLKPVYAAIDRL 91

Query: 93  LES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +    +P  K+       A+A F+FN G+  ++KST  ++++A D+  A ++  +W  A 
Sbjct: 92  VRVPLTPYQKT-------ALATFIFNTGVTAFSKSTLLKKLNAGDYAGARDQMARWVFAA 144

Query: 151 GKVLPGLVKRRDAEVKL 167
           G    GL+ RR+ E+ +
Sbjct: 145 GHKWKGLMNRREVEMAI 161


>gi|15801967|ref|NP_287988.1| putative endolysin encoded by cryptic prophage CP-933P [Escherichia
           coli O157:H7 EDL933]
 gi|15831038|ref|NP_309811.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|15831218|ref|NP_309991.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|15831513|ref|NP_310286.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168751486|ref|ZP_02776508.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168758728|ref|ZP_02783735.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168759174|ref|ZP_02784181.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168764748|ref|ZP_02789755.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168771997|ref|ZP_02797004.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168776753|ref|ZP_02801760.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|168784209|ref|ZP_02809216.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168790134|ref|ZP_02815141.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168790518|ref|ZP_02815525.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168790741|ref|ZP_02815748.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|195939956|ref|ZP_03085338.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208810739|ref|ZP_03252615.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208810847|ref|ZP_03252680.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208815673|ref|ZP_03256852.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208817035|ref|ZP_03258155.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208820219|ref|ZP_03260539.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|208820758|ref|ZP_03261078.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209398091|ref|YP_002270626.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209400175|ref|YP_002270212.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209427769|ref|YP_002274181.1| putative endolysin [Enterobacteria phage YYZ-2008]
 gi|217329784|ref|ZP_03445861.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254792752|ref|YP_003077589.1| putative endolysin encoded by cryptic prophage CP-933P [Escherichia
           coli O157:H7 str. TW14359]
 gi|254793168|ref|YP_003078005.1| putative endolysin encoded by cryptic prophage CP-933P [Escherichia
           coli O157:H7 str. TW14359]
 gi|13259598|gb|AAK16967.1|AE006460_5 putative endolysin encoded by cryptic prophage CP-933P [Escherichia
           coli O157:H7 str. EDL933]
 gi|13361249|dbj|BAB35207.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|13361429|dbj|BAB35387.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|13361725|dbj|BAB35682.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|187767860|gb|EDU31704.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|188014453|gb|EDU52575.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|188998581|gb|EDU67567.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189354228|gb|EDU72647.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189354493|gb|EDU72912.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189359422|gb|EDU77841.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189365298|gb|EDU83714.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|189369952|gb|EDU88368.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189370023|gb|EDU88439.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189370351|gb|EDU88767.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|208724353|gb|EDZ74061.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208725255|gb|EDZ74962.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208731378|gb|EDZ80067.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208732321|gb|EDZ81009.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208740342|gb|EDZ88024.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|208740881|gb|EDZ88563.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|208970837|gb|ACI32381.1| putative endolysin [Escherichia coli]
 gi|209159491|gb|ACI36924.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209161575|gb|ACI39008.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217317203|gb|EEC25634.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254592152|gb|ACT71513.1| putative endolysin encoded by cryptic prophage CP-933P [Escherichia
           coli O157:H7 str. TW14359]
 gi|254592568|gb|ACT71929.1| putative endolysin encoded by cryptic prophage CP-933P [Escherichia
           coli O157:H7 str. TW14359]
 gi|320188080|gb|EFW62747.1| putative endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|320189854|gb|EFW64507.1| Phage endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|326337976|gb|EGD61809.1| Phage endolysin [Escherichia coli O157:H7 str. 1044]
 gi|326338008|gb|EGD61839.1| putative endolysin [Escherichia coli O157:H7 str. 1125]
 gi|326340106|gb|EGD63911.1| putative endolysin [Escherichia coli O157:H7 str. 1044]
 gi|326340805|gb|EGD64599.1| Phage endolysin [Escherichia coli O157:H7 str. 1125]
          Length = 177

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRGDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L   +E +  +  T E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKAL-AWVEKNIRVPLT-EPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|238788379|ref|ZP_04632173.1| Lysozyme [Yersinia frederiksenii ATCC 33641]
 gi|238723625|gb|EEQ15271.1| Lysozyme [Yersinia frederiksenii ATCC 33641]
          Length = 158

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 57/132 (43%), Gaps = 4/132 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + +L + EG RL  Y+    G WT G GHT   V     ITE++A + L+ D       L
Sbjct: 22  LTLLADLEGCRLRPYQ-CSAGVWTSGIGHTAG-VVPKRDITERDAAENLVADVLHVEQQL 79

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P      +    A+  F FN+G     +ST    +  + WE+A ++  +W    G 
Sbjct: 80  ATCVPV--DMPQPVYDALVSFSFNVGTAAACRSTLVSYLKRRQWEQACDQLSRWVYVNGV 137

Query: 153 VLPGLVKRRDAE 164
              GL  RR  E
Sbjct: 138 KSKGLENRRQRE 149


>gi|126442619|ref|YP_001063329.1| Phage-like lysozyme [Burkholderia pseudomallei 668]
 gi|126222110|gb|ABN85615.1| phage-related lysozyme [Burkholderia pseudomallei 668]
          Length = 270

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 62/141 (43%), Gaps = 19/141 (13%)

Query: 46  AYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSEN 105
           A R + G  WT G+G TG DV EG   T+  A+     DA+      L    A    S  
Sbjct: 125 ALRALSGAPWTCGWGSTGPDVREGTVWTQATAD--ARHDANLRAAAALIDQAARVQLSAQ 182

Query: 106 RLVAVADFVFNLGIGNYNK-----------------STFKQRVDAQDWEKAAEECKKWTK 148
           +  A+   V N+G G   +                 ST  + ++  D+  AA++   W +
Sbjct: 183 QKAAMTSIVNNVGAGRARRAGDPGRDGIITLASGQPSTLLRHLNIGDFAGAADQFPAWNR 242

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           AGG V PGLV+RR AE  L L
Sbjct: 243 AGGVVQPGLVRRRAAERDLFL 263


>gi|300925431|ref|ZP_07141313.1| phage lysozyme [Escherichia coli MS 182-1]
 gi|300418455|gb|EFK01766.1| phage lysozyme [Escherichia coli MS 182-1]
          Length = 135

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 57/105 (54%), Gaps = 5/105 (4%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +K    E    A+  FV+N+G GN+  ST  ++++  D + A ++
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQ 134


>gi|218510947|ref|ZP_03508825.1| putative phage-related protein [Rhizobium etli Brasil 5]
          Length = 150

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 62/138 (44%), Gaps = 5/138 (3%)

Query: 35  MLKEFEGLRLTAYRDIG--GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++  FEGLR  AY D    G  WTI YG T + V  G   T  + +  L  +  K    +
Sbjct: 14  LVGSFEGLRQNAYPDPATQGQPWTICYGST-NGVKPGDYKTVAQCKALLSLELQKYAAGI 72

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
            +         + R VA+  F +N+G+    KS+    ++     +  E   KW +A G 
Sbjct: 73  EQC--VTVPLPDPRFVALTSFAYNVGVKAACKSSAVTLINQGKTAEGCEALLKWNRAAGV 130

Query: 153 VLPGLVKRRDAEVKLLLE 170
           V PGL +RR  E +  LE
Sbjct: 131 VFPGLTRRRQKERQFCLE 148


>gi|322706508|gb|EFY98088.1| glycoside hydrolase family 24 protein [Metarhizium anisopliae ARSEF
           23]
          Length = 271

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 43/126 (34%), Positives = 65/126 (51%), Gaps = 12/126 (9%)

Query: 53  GAWTIGYGH-----TGSDVTEGMTITEKEAEDFL---LKDASKSLNLLLESSPALKSTSE 104
           G  T+GYGH     + ++V     +T+  A   L   L   +K L  +L++       +E
Sbjct: 135 GLPTVGYGHLCQKKSCAEVKYTFPLTKATALQLLNDDLPSYTKCLGKVLDAGKV--KLNE 192

Query: 105 NRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK--AAEECKKWTKAGGKVLPGLVKRRD 162
           N+  A+  +VFN+G G    S+  +R++  +     A+EE  KW   GG+VLPGLVKRR 
Sbjct: 193 NQWAALTSWVFNVGCGAAQSSSLVKRLNRGENANTVASEELPKWKMGGGRVLPGLVKRRA 252

Query: 163 AEVKLL 168
            EV L 
Sbjct: 253 DEVALF 258


>gi|193064790|ref|ZP_03045867.1| lysozyme [Escherichia coli E22]
 gi|192927475|gb|EDV82092.1| lysozyme [Escherichia coli E22]
          Length = 177

 Score = 60.5 bits (145), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 50/155 (32%), Positives = 73/155 (47%), Gaps = 17/155 (10%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P    L + L E EG  LTAY+D G G WTI  G T   G  VT GM ++ ++       
Sbjct: 20  PASVILDQFLNEKEGNSLTAYKD-GSGIWTICRGATTVDGKPVTPGMRLSPEKCNQVNAS 78

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           + +K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 79  ELNKALAWVDRNIQV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEA 136

Query: 143 CKKWTKAGGKVLP----------GLVKRRDAEVKL 167
            + W K GG+             G V+RRD E  L
Sbjct: 137 IRWWIKDGGRDCRLTKGQKNGCYGQVERRDQESAL 171


>gi|293607812|ref|ZP_06690136.1| lysozyme [Achromobacter piechaudii ATCC 43553]
 gi|292813790|gb|EFF72947.1| lysozyme [Achromobacter piechaudii ATCC 43553]
          Length = 164

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 66/125 (52%), Gaps = 12/125 (9%)

Query: 53  GAWTIGYGHTGSDVTEGMTITEKEAE---DFLLKDASKSLNLLLESSPALKSTSENRLVA 109
           G  T+  GHTGSD+      T+ E +   D  L  A +++  L+         ++ +  A
Sbjct: 44  GVLTVCDGHTGSDIDPKRIYTDAECDAWRDADLAIADRAVRRLITVP-----LNDWQRAA 98

Query: 110 VADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--GGKV--LPGLVKRRDAEV 165
           + DF +NLG GN  +ST +++ +A D++    E ++W K   GG +  LPGLV RR+A  
Sbjct: 99  LIDFTYNLGAGNLAESTMRRKFNAGDYDGGCAELERWVKGRKGGVLVTLPGLVTRREANT 158

Query: 166 KLLLE 170
            + L+
Sbjct: 159 WVCLQ 163


>gi|167907332|ref|ZP_02494537.1| Phage-related lysozyme [Burkholderia pseudomallei NCTC 13177]
          Length = 270

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 62/141 (43%), Gaps = 19/141 (13%)

Query: 46  AYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSEN 105
           A R + G  WT G+G TG DV EG   T+  A+     DA+      L    A    S  
Sbjct: 125 ALRALSGAPWTCGWGSTGPDVLEGTVWTQATAD--ARHDANLRAAAALIDQAARVQLSAQ 182

Query: 106 RLVAVADFVFNLGIGNYNK-----------------STFKQRVDAQDWEKAAEECKKWTK 148
           +  A+   V N+G G   +                 ST  + ++  D+  AA++   W +
Sbjct: 183 QKAAMTSIVNNVGAGRARRAGDPGRDGIITLASGQPSTLLRHLNIGDFAGAADQFPAWNR 242

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           AGG V PGLV+RR AE  L L
Sbjct: 243 AGGVVQPGLVRRRAAERDLFL 263


>gi|187730788|ref|YP_001879627.1| phage lysozyme [Shigella boydii CDC 3083-94]
 gi|187427780|gb|ACD07054.1| phage lysozyme [Shigella boydii CDC 3083-94]
 gi|320177471|gb|EFW52469.1| Phage endolysin [Shigella dysenteriae CDC 74-1112]
          Length = 177

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  + ++       +E +   +A F  +N+G G    STF ++++A D + A  E
Sbjct: 81  ERDKALAWVEKNIKV--PLTEPQKSGIASFCPYNIGPGKCFSSTFYRKLNAGDRKGACAE 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            ++W   GG+          G V RRD E  L
Sbjct: 139 IRRWIYDGGRDCRNRSNNCYGQVSRRDQESAL 170


>gi|254419040|ref|ZP_05032764.1| phage lysozyme, putative [Brevundimonas sp. BAL3]
 gi|196185217|gb|EDX80193.1| phage lysozyme, putative [Brevundimonas sp. BAL3]
          Length = 526

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 42/135 (31%), Positives = 68/135 (50%), Gaps = 7/135 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++K FEG R  A +    G WTIGYGHT S   EG++++E +AE  L  D    +  +  
Sbjct: 17  LIKSFEGFRPRAVQR-ADGRWTIGYGHTRS-AREGLSVSESDAELLLQYDLIPVVRAIGS 74

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
               L   ++++  A+A F F++G+  +  S    R++A   ++AAE    W+       
Sbjct: 75  VQAPL---NQHQFDALASFAFSVGVDRFTTSDVLARLNAGAPDEAAEALGGWSDDTEIAT 131

Query: 155 PGLVKRRDAEVKLLL 169
           P   +RR AE  L +
Sbjct: 132 PP--RRRAAERALFV 144


>gi|237812933|ref|YP_002897384.1| gp24 [Burkholderia pseudomallei MSHR346]
 gi|237503707|gb|ACQ96025.1| gp24 [Burkholderia pseudomallei MSHR346]
          Length = 165

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 64/145 (44%), Gaps = 20/145 (13%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D   G  T   G T  DV  G   +E E        AS  + L
Sbjct: 21  LTVIVPKFEGVKLAGYLD-PVGIPTKCMGDT-RDVIVGRAYSEAECR------ASLEMQL 72

Query: 92  LLESSPALKSTS-----ENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC--- 143
           +  + P L+ T        +L A   F +N+G   Y  ST  +R +A D   A       
Sbjct: 73  IAHAEPVLRCTPGLKDRPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEA 132

Query: 144 ----KKWTKAGGKVLPGLVKRRDAE 164
                +W  A G+VLPGLVKRR  E
Sbjct: 133 DDGRPQWVTARGRVLPGLVKRRAEE 157


>gi|238788595|ref|ZP_04632387.1| Phage lysozyme [Yersinia frederiksenii ATCC 33641]
 gi|238723190|gb|EEQ14838.1| Phage lysozyme [Yersinia frederiksenii ATCC 33641]
          Length = 171

 Score = 60.1 bits (144), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 66/131 (50%), Gaps = 5/131 (3%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG    AY D+ G   T+  GHTGSD+      +++E +  L +D    L +      A+
Sbjct: 32  EGREYRAYYDVAG-VLTVCDGHTGSDIIRHKQYSDQECDALLQQDL---LPIKARVDRAV 87

Query: 100 K-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
           +    +    A+  F +N+G   +  ST  +++++ D   A +E ++W  AGGK   GL+
Sbjct: 88  QVPVGDYTRAALYSFTYNIGQTAFINSTLLKKLNSGDIAAACDELRRWIMAGGKRWQGLI 147

Query: 159 KRRDAEVKLLL 169
            RR+ E +L +
Sbjct: 148 NRREIERELCM 158


>gi|56682769|gb|AAW21764.1| R [Stx1-converting phage phi-O153]
          Length = 177

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++ + +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKGKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQERAL 170


>gi|319403698|emb|CBI77283.1| putative Lysozyme [Bartonella rochalimae ATCC BAA-1498]
          Length = 142

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 2/96 (2%)

Query: 72  ITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV 131
           + E+ AE  LL D  +    L          S+ +  A+  F +N+GI  +  ST  +++
Sbjct: 38  LYERRAETMLLTDLRQYERAL--EKAVYVDLSDEQFGALVSFCYNIGITAFQNSTLLKKL 95

Query: 132 DAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +  D+E    E +KWTKAGGK L GLV RR AE  L
Sbjct: 96  NKGDYESVPIELQKWTKAGGKRLKGLVHRRAAEAGL 131


>gi|284008131|emb|CBA74358.1| phage lysin protein; endolysin [Arsenophonus nasoniae]
          Length = 123

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 7/100 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           M+  FEGLR   Y D GGG  ++ YGHTG+D+    T T+K+ + +L  D    L  +  
Sbjct: 29  MITHFEGLRFKPYFD-GGGILSVCYGHTGNDIERNRTYTQKDCDKWLDDD----LRAVKR 83

Query: 95  SSPALKSTSENRLV--AVADFVFNLGIGNYNKSTFKQRVD 132
               L   + N L   A+  F +N+G+GN+ KST  ++++
Sbjct: 84  YVDPLVKVNINTLTQAALYSFAYNVGVGNFAKSTLLKKLN 123


>gi|320668221|gb|EFX35072.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. LSU-61]
          Length = 181

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 27  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 85

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 86  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 143

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 144 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 174


>gi|217327595|ref|ZP_03443678.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|217319962|gb|EEC28387.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
          Length = 250

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 96  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 154

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 155 RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 212

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 213 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 243


>gi|20065952|ref|NP_613035.1| endolysin [Stx2 converting phage I]
 gi|168748241|ref|ZP_02773263.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168755143|ref|ZP_02780150.1| lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168768017|ref|ZP_02793024.1| lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168772881|ref|ZP_02797888.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           O157:H7 str. EC4196]
 gi|168780248|ref|ZP_02805255.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|195935763|ref|ZP_03081145.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208809515|ref|ZP_03251852.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208811871|ref|ZP_03253200.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208821220|ref|ZP_03261540.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209397830|ref|YP_002271790.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|254794267|ref|YP_003079104.1| putative endolysin R [Escherichia coli O157:H7 str. TW14359]
 gi|260867250|ref|YP_003233652.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|10799916|emb|CAC12892.1| R protein [Shigella phage 7888]
 gi|19911744|dbj|BAB88004.1| endolysin [Stx2 converting phage I]
 gi|187771043|gb|EDU34887.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           O157:H7 str. EC4196]
 gi|188017195|gb|EDU55317.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|189002117|gb|EDU71103.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189357706|gb|EDU76125.1| lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189362908|gb|EDU81327.1| lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|208729316|gb|EDZ78917.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208733148|gb|EDZ81835.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208741343|gb|EDZ89025.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209159230|gb|ACI36663.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|254593667|gb|ACT73028.1| putative endolysin R [Escherichia coli O157:H7 str. TW14359]
 gi|257763606|dbj|BAI35101.1| putative endolysin [Escherichia coli O111:H- str. 11128]
          Length = 177

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GVGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVAKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|17975186|ref|NP_536381.1| putative lysozyme [Burkholderia phage phiE125]
 gi|17484047|gb|AAL40298.1|AF447491_25 gp25 [Burkholderia phage phiE125]
          Length = 134

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/107 (33%), Positives = 48/107 (44%), Gaps = 8/107 (7%)

Query: 65  DVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNK 124
           DV  G   T  E    L +   +    +L  +P L+  +   L A   F +N+G   Y  
Sbjct: 21  DVYAGQRFTRDECRARLEQRLIEHAEPVLTCTPGLRGRTYQ-LAAAVSFAYNIGPRAYCG 79

Query: 125 STFKQRVDAQDWEKAAEEC-------KKWTKAGGKVLPGLVKRRDAE 164
           ST  +R +A DW  A            +W  AGG+VLPGLVKRR  E
Sbjct: 80  STTARRFNAGDWRGACRAINESDNGRPQWVTAGGRVLPGLVKRRATE 126


>gi|149190521|ref|ZP_01868791.1| putative lysozyme protein R of prophage CP-933K [Vibrio shilonii
           AK1]
 gi|148835645|gb|EDL52612.1| putative lysozyme protein R of prophage CP-933K [Vibrio shilonii
           AK1]
          Length = 181

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 40/147 (27%), Positives = 67/147 (45%), Gaps = 17/147 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           ++ +   EG RL  Y+      WT G GHT S + +   +TE++  +  +KD   A + +
Sbjct: 36  LRHIANEEGCRLKPYQ-CSADVWTAGLGHTQS-INQDTKLTEQQVAELFVKDIAVAERVV 93

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           N  +  +P     ++     +  FVFNLG GN+ +ST  ++ +  D + A  E  +W   
Sbjct: 94  NKHITQTP-----TQGEYDMMVSFVFNLGAGNFTRSTLLKKFNQGDHQGACNEYPRWVFV 148

Query: 150 GGK-------VLPGLVKRRDAEVKLLL 169
             K          G+ KRR  E  + L
Sbjct: 149 NSKDCRLAESNCAGIPKRRSKERDVCL 175


>gi|284921926|emb|CBG35001.1| prophage lysozyme [Escherichia coli 042]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W   GG+          G V RRD E  L
Sbjct: 139 IRWWIIDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|260867679|ref|YP_003234081.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|257764035|dbj|BAI35530.1| putative endolysin [Escherichia coli O111:H- str. 11128]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++ + +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKGKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|323179208|gb|EFZ64778.1| phage lysozyme family protein [Escherichia coli 1180]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P+ L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APDILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|315059512|gb|ADT73839.1| lysozyme [Escherichia coli W]
          Length = 172

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 14/137 (10%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLL 92
           L   E +    YRDI G   T+  GHTG D+ E    +  E    L   LK    +++ L
Sbjct: 34  LIHLENIAYMPYRDIAG-VLTVCVGHTGPDI-EMRRYSHAECMALLDSDLKPVYAAIDRL 91

Query: 93  LES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +    +P  K+       A+A F+FN G+  ++KST  ++++A D+  A ++  +W  A 
Sbjct: 92  VRVPLTPYQKT-------ALATFIFNTGVTAFSKSTLLKKLNAGDYAGARDQMARWVFAA 144

Query: 151 GKVLPGLVKRRDAEVKL 167
           G    GL+ RR+ E+ +
Sbjct: 145 GHKWKGLMNRREVEMAI 161


>gi|168751113|ref|ZP_02776135.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168775033|ref|ZP_02800040.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|168783728|ref|ZP_02808735.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168801573|ref|ZP_02826580.1| lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|195939160|ref|ZP_03084542.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208810920|ref|ZP_03252753.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208815930|ref|ZP_03257109.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208821236|ref|ZP_03261556.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209395700|ref|YP_002270283.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209399434|ref|YP_002271494.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|254792819|ref|YP_003077656.1| endolysin [Escherichia coli O157:H7 str. TW14359]
 gi|261254712|ref|ZP_05947245.1| endolysin [Escherichia coli O157:H7 str. FRIK966]
 gi|187769335|gb|EDU33179.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|188014769|gb|EDU52891.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|188998929|gb|EDU67915.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189376265|gb|EDU94681.1| lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|208724426|gb|EDZ74134.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208732578|gb|EDZ81266.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208741359|gb|EDZ89041.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209157100|gb|ACI34533.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|209160834|gb|ACI38267.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|254592219|gb|ACT71580.1| endolysin [Escherichia coli O157:H7 str. TW14359]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++ + +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKGKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|320641502|gb|EFX10920.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. G5101]
          Length = 166

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 12  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 70

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 71  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 128

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 129 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 159


>gi|9633512|ref|NP_050626.1| Lys [Enterobacteria phage Mu]
 gi|188496115|ref|ZP_03003385.1| lysozyme [Escherichia coli 53638]
 gi|307313549|ref|ZP_07593170.1| Lysozyme [Escherichia coli W]
 gi|9910751|sp|Q9T1X2|LYS_BPMU RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|6010396|gb|AAF01099.1|AF083977_18 Lys [Enterobacteria phage Mu]
 gi|57904713|gb|AAW58958.1| Lys [Cloning vector MuNXKan]
 gi|188491314|gb|EDU66417.1| lysozyme [Escherichia coli 53638]
 gi|306906717|gb|EFN37228.1| Lysozyme [Escherichia coli W]
 gi|323379929|gb|ADX52197.1| Lysozyme [Escherichia coli KO11]
 gi|332095804|gb|EGJ00813.1| lysozyme [Shigella boydii 5216-82]
          Length = 171

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 14/137 (10%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLL 92
           L   E +    YRDI G   T+  GHTG D+ E    +  E    L   LK    +++ L
Sbjct: 33  LIHLENIAYMPYRDIAG-VLTVCVGHTGPDI-EMRRYSHAECMALLDSDLKPVYAAIDRL 90

Query: 93  LES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +    +P  K+       A+A F+FN G+  ++KST  ++++A D+  A ++  +W  A 
Sbjct: 91  VRVPLTPYQKT-------ALATFIFNTGVTAFSKSTLLKKLNAGDYAGARDQMARWVFAA 143

Query: 151 GKVLPGLVKRRDAEVKL 167
           G    GL+ RR+ E+ +
Sbjct: 144 GHKWKGLMNRREVEMAI 160


>gi|18310114|ref|NP_562048.1| hypothetical protein CPE1132 [Clostridium perfringens str. 13]
 gi|18144793|dbj|BAB80838.1| hypothetical protein [Clostridium perfringens str. 13]
          Length = 983

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 73/146 (50%), Gaps = 12/146 (8%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKDASK--- 87
           +I  +K  EG     Y D   G  T+GYG TGS+++   + ++E  A  +L+ + ++   
Sbjct: 800 IIYYVKGIEGYAPYHYYD-SVGVKTLGYGMTGSELSGVSVPLSETSATHYLVDNFNRLYY 858

Query: 88  --SLNLLLESSPALKSTSENRLVAVADFVFNLGI---GNYNKSTFKQRVDAQDWEKAAEE 142
              LN+L   +    +  +  + A+A F +N G+   G       K+ V  +  E    E
Sbjct: 859 TPVLNML--KARGATNMLQREVDALASFAYNCGLDSNGLGGSQLLKKYVAGERGESIHNE 916

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLL 168
            KKW   GG+VLPGLV+RR+ E K+ 
Sbjct: 917 FKKWVHGGGQVLPGLVRRREEEWKIF 942


>gi|226198853|ref|ZP_03794416.1| gp24 [Burkholderia pseudomallei Pakistan 9]
 gi|225928953|gb|EEH24977.1| gp24 [Burkholderia pseudomallei Pakistan 9]
          Length = 165

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D   G  T   G T  DV  G   +E E    L          
Sbjct: 21  LTVIVPKFEGVKLAGYLD-PVGIPTKCMGDT-RDVIVGRAYSEAECRASLETQLIAHAEP 78

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE-------CK 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 79  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGSP 137

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 138 QWVTARGRVLPGLVKRR-AEERAICE 162


>gi|167824863|ref|ZP_02456334.1| gp24 [Burkholderia pseudomallei 9]
          Length = 162

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G   +E E    L          
Sbjct: 18  LTVIVPKFEGVKLAGYLDPVG-IPTKCMGDT-RDVIVGRAYSEAECRASLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE-------CK 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGSP 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 135 QWVTARGRVLPGLVKRR-AEERAICE 159


>gi|15801785|ref|NP_287803.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           EDL933]
 gi|15831995|ref|NP_310768.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168751942|ref|ZP_02776964.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168757636|ref|ZP_02782643.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168763878|ref|ZP_02788885.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168770257|ref|ZP_02795264.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168777483|ref|ZP_02802490.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|168784176|ref|ZP_02809183.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168789366|ref|ZP_02814373.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168802144|ref|ZP_02827151.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|195939774|ref|ZP_03085156.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208810246|ref|ZP_03252122.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208816671|ref|ZP_03257791.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208821957|ref|ZP_03262277.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209396957|ref|YP_002271117.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217329569|ref|ZP_03445648.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254793654|ref|YP_003078491.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. TW14359]
 gi|12515366|gb|AAG56417.1|AE005369_6 putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. EDL933]
 gi|13362209|dbj|BAB36164.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|187767308|gb|EDU31152.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|188014110|gb|EDU52232.1| phage lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|188998610|gb|EDU67596.1| phage lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189355443|gb|EDU73862.1| phage lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189360811|gb|EDU79230.1| phage lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189366026|gb|EDU84442.1| phage lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|189370990|gb|EDU89406.1| phage lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189375831|gb|EDU94247.1| phage lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|208724762|gb|EDZ74469.1| phage lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208731014|gb|EDZ79703.1| phage lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208742080|gb|EDZ89762.1| phage lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209158357|gb|ACI35790.1| phage lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217317337|gb|EEC25766.1| phage lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254593054|gb|ACT72415.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. TW14359]
 gi|315614764|gb|EFU95403.1| phage lysozyme family protein [Escherichia coli 3431]
 gi|320188093|gb|EFW62759.1| putative endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|326337998|gb|EGD61830.1| putative endolysin [Escherichia coli O157:H7 str. 1125]
 gi|326347985|gb|EGD71697.1| putative endolysin [Escherichia coli O157:H7 str. 1044]
          Length = 177

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|240137972|ref|YP_002962444.1| hypothetical protein MexAM1_META1p1303 [Methylobacterium extorquens
           AM1]
 gi|240007941|gb|ACS39167.1| hypothetical protein; putative Lysozyme-like domain
           [Methylobacterium extorquens AM1]
          Length = 187

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHT---GSDVTE-GMTITEKEAEDFLLKDASKSLNLLLES 95
           EG RL AYRD   G WTIG GHT   G  V   G+ I   EA+    +D +  +  + E+
Sbjct: 15  EGRRLEAYRD-SVGVWTIGIGHTAAAGPPVPRAGLRIEAGEADAIFTRDVAAFVRTVAET 73

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P  K   ++   A+    FN+G   + +ST  +R+ A D   A E    W +       
Sbjct: 74  VP--KPLPQHAFDALVSLCFNIGPAAFRRSTVLRRLRAGDRAGAGEAILMWNRPA----- 126

Query: 156 GLVKRRDAE 164
            ++ RR  E
Sbjct: 127 AIIPRRQGE 135


>gi|300937920|ref|ZP_07152709.1| phage lysozyme [Escherichia coli MS 21-1]
 gi|294490493|gb|ADE89249.1| phage lysozyme [Escherichia coli IHE3034]
 gi|300457084|gb|EFK20577.1| phage lysozyme [Escherichia coli MS 21-1]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 51/151 (33%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GAGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L   +E +  +  T E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKAL-AWVERNIKVPMT-EPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|168790026|ref|ZP_02815033.1| lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168798562|ref|ZP_02823569.1| lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|260843577|ref|YP_003221355.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|189370438|gb|EDU88854.1| lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189378943|gb|EDU97359.1| lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|257758724|dbj|BAI30221.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|315274315|gb|ADU03723.1| lysozyme [Enterobacteria phage VT2phi_272]
 gi|326340110|gb|EGD63914.1| Phage endolysin [Escherichia coli O157:H7 str. 1125]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|83310624|ref|YP_420888.1| Phage-related lysozyme [Magnetospirillum magneticum AMB-1]
 gi|82945465|dbj|BAE50329.1| Phage-related lysozyme [Magnetospirillum magneticum AMB-1]
          Length = 162

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 67/139 (48%), Gaps = 10/139 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNL 91
           ++   EGLR  AY+D  G   TI +G T   V  G T T ++    L   L + S +++ 
Sbjct: 18  LISGAEGLRTQAYKDPVG-IPTICFGET-RGVKIGDTATREQCRAMLDGRLVEISAAIDR 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
            L     + +  +    A+    +N+G G +  ST  ++ +A D   A EE  +W KAGG
Sbjct: 76  CL-----VTAVPDMSYAALLSLAYNIGSGAFCASTLVKKANAGDVAGACEEILRWDKAGG 130

Query: 152 KVLPGLVKRRDAEVKLLLE 170
             LPGL +RR  E  L  +
Sbjct: 131 VALPGLTRRRGDEHDLCRQ 149


>gi|281199665|ref|YP_003335769.1| Lys [Escherichia phage D108]
 gi|257781161|gb|ACV50280.1| Lys [Escherichia phage D108]
          Length = 171

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 14/137 (10%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLL 92
           L   E +    YRDI G   T+  GHTG D+ E    +  E    L   LK    +++ L
Sbjct: 33  LIHLENIAYMPYRDIAG-VLTVCVGHTGPDI-EMRRYSHAECMALLDSDLKPVYAAIDRL 90

Query: 93  LES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +    +P  K+       A+A F+FN G+  ++KST  ++++A D+  A ++  +W  A 
Sbjct: 91  VRVPLTPYQKT-------ALATFIFNTGVTAFSKSTLLKKLNAGDYAGARDQMARWVFAA 143

Query: 151 GKVLPGLVKRRDAEVKL 167
           G    GL+ RR+ E+ +
Sbjct: 144 GHKWKGLMNRREVEMAI 160


>gi|331650514|ref|ZP_08351586.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M605]
 gi|331040908|gb|EGI13066.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           M605]
          Length = 172

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 68/137 (49%), Gaps = 14/137 (10%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNLL 92
           L   E +    YRDI G   T+  GHTG D+ E    +  E    L   LK    +++ L
Sbjct: 34  LIHLENIAYLPYRDIAG-VLTVCVGHTGPDI-EMRRYSHAECMALLASDLKPVYAAIDRL 91

Query: 93  LES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +    +P  K+       A+A F+FN G+  ++KST  ++++A D+  A ++  +W  A 
Sbjct: 92  VRVPLTPYQKT-------ALATFIFNTGVTAFSKSTLLKKLNAGDYAGARDQMARWVFAA 144

Query: 151 GKVLPGLVKRRDAEVKL 167
           G    GL+ RR+ E+ +
Sbjct: 145 GHKWKGLMNRREVEMAI 161


>gi|85709003|ref|ZP_01040069.1| probable phage-related lysozyme [Erythrobacter sp. NAP1]
 gi|85690537|gb|EAQ30540.1| probable phage-related lysozyme [Erythrobacter sp. NAP1]
          Length = 332

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/156 (31%), Positives = 74/156 (47%), Gaps = 15/156 (9%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFL 81
           K+ V + LI  + E EG+R   YRD+  G  T+G GH       +  G TI+ + A  FL
Sbjct: 175 KLSVSDRLIDAMIEEEGVRYDVYRDV-AGYPTVGVGHLVLPKDRLKVGDTISHRRALAFL 233

Query: 82  LKD---ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNY---NKSTFKQRVDAQD 135
            KD   A K +  ++   P     ++N   A+ D VFN+GIG             ++A D
Sbjct: 234 EKDLAKAEKGVRKIVGDLP----LNQNEFDALVDLVFNVGIGTVGPEKSPKLNAAIEAGD 289

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           +E  AEE  ++  A  +V  GLV R +    + L +
Sbjct: 290 YEGIAEEL-EYHHAASRVAKGLVYRSERRTNIFLNA 324


>gi|218695116|ref|YP_002402783.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli 55989]
 gi|218351848|emb|CAU97567.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli 55989]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       SE +   +A F  +N+G      STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPSKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|251778179|ref|ZP_04821099.1| putative phage lysozyme [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243082494|gb|EES48384.1| phage lysozyme [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 260

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 44/148 (29%), Positives = 69/148 (46%), Gaps = 5/148 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A I  +K +EG     Y D+ G   T+GYG TG ++    +ITE +A D L    + 
Sbjct: 108 VSEACINFIKSWEGFFAKPYYDMVG-VLTLGYGMTGDEIKGLSSITESKASDMLKDLINN 166

Query: 88  SLNLLLESSPALKSTS--ENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QDWEKAAEEC 143
               +++ S   K+ S  +N   A+  F +N G      ST  + + A  +D        
Sbjct: 167 KYAQIIKKSLDDKNISLKQNEFDALVSFAYNCGTAGLLGSTLYKNIVAGIRDKNTIISNF 226

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           + W+  GGK + GL +RR  E  + L+S
Sbjct: 227 QAWSNGGGKRIEGLYRRRMKEAAMFLDS 254


>gi|170770026|ref|ZP_02904479.1| phage lysozyme [Escherichia albertii TW07627]
 gi|170770166|ref|ZP_02904619.1| phage lysozyme [Escherichia albertii TW07627]
 gi|170120967|gb|EDS89898.1| phage lysozyme [Escherichia albertii TW07627]
 gi|170121092|gb|EDS90023.1| phage lysozyme [Escherichia albertii TW07627]
 gi|313646712|gb|EFS11171.1| phage lysozyme family protein [Shigella flexneri 2a str. 2457T]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|320086850|emb|CBY96622.1| phage related lysozyme [Salmonella enterica subsp. enterica serovar
           Weltevreden str. 2007-60-3289-1]
          Length = 145

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG    + V  GMTIT +++ + L +D    
Sbjct: 8   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGNPVVSGMTITSEKSSELLKEDLQWV 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS    + ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 67  EDAI--SSLVRVTLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 124

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 125 A-GKDPDILLPRRRRERSLFL 144


>gi|167725610|ref|ZP_02408846.1| gp24 [Burkholderia pseudomallei DM98]
          Length = 162

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D   G  T   G T  DV  G   +E E    L          
Sbjct: 18  LTVIVPKFEGVKLAGYLD-PVGIPTKCMGDT-RDVIVGRAYSEAECRASLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGRP 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 135 QWITARGRVLPGLVKRR-AEERAICE 159


>gi|149184364|ref|ZP_01862682.1| hypothetical protein ED21_26638 [Erythrobacter sp. SD-21]
 gi|148831684|gb|EDL50117.1| hypothetical protein ED21_26638 [Erythrobacter sp. SD-21]
          Length = 208

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/159 (30%), Positives = 78/159 (49%), Gaps = 22/159 (13%)

Query: 29  PNALIKMLKEF-------EGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAE 78
           P AL+    EF       EG+R T YRD+  G  T+G GH      ++  G  I++++  
Sbjct: 40  PAALLNASDEFKQALIEEEGVRYTVYRDV-AGYPTVGVGHLIRPADNLRVGDRISDEQVL 98

Query: 79  DFLLKD---ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNK---STFKQRVD 132
           +FL +D   A + + +L+   P  +    +   A+ D V+N+G+GN ++       Q + 
Sbjct: 99  EFLEQDLEVAERGVRILVGDLPLYQ----HEFDALLDLVYNVGLGNVSERESPRLNQAIA 154

Query: 133 AQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
             D+E  A E   +T A GKV  GL  R +   K+ LE+
Sbjct: 155 DGDYEAIAGEL-NYTHAAGKVARGLEFRSERRAKIFLEA 192


>gi|218689838|ref|YP_002398050.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218427402|emb|CAR08299.2| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVFRRDQESAL 170


>gi|195940616|ref|ZP_03085998.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRGDGKPVILGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|261189259|ref|XP_002621041.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081]
 gi|239591826|gb|EEQ74407.1| conserved hypothetical protein [Ajellomyces dermatitidis SLH14081]
 gi|239614744|gb|EEQ91731.1| conserved hypothetical protein [Ajellomyces dermatitidis ER-3]
 gi|327354104|gb|EGE82961.1| glycoside hydrolase family 24 [Ajellomyces dermatitidis ATCC 18188]
          Length = 190

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 71/144 (49%), Gaps = 10/144 (6%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG-----MTITEKEAEDFLLKDA 85
           A + ++KEFEG       D   G  T+GYGH     T+G       +T+K A   L KD 
Sbjct: 36  ATLALIKEFEGFVPRPAPD-PIGLPTVGYGHLCK--TKGCKEVKFPLTKKTATALLKKDL 92

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA-AEEC 143
                 +  S+      + N+  A+  + +N+G      S+  +R++  ++  K  A+E 
Sbjct: 93  RSFQQAITLSTKKAVKLNANQYGALVSWAYNVGPNAARSSSLIRRLNRGENPNKVIAQEL 152

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKL 167
            KW  AGGKV  GLV+RR AEVKL
Sbjct: 153 PKWRLAGGKVFKGLVRRRKAEVKL 176


>gi|167893347|ref|ZP_02480749.1| gp24 [Burkholderia pseudomallei 7894]
          Length = 162

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G   +E E    L          
Sbjct: 18  LAVVVPKFEGVKLVGYLDPVG-IPTKCMGDT-RDVVVGKAYSEAECRASLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGTNAYCDSTTAKRFNAGDLRGACRAINEADDGRP 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VLPGLVKRR AE + + E
Sbjct: 135 QWVTARGRVLPGLVKRR-AEERAICE 159


>gi|331681950|ref|ZP_08382583.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H299]
 gi|294493822|gb|ADE92578.1| phage lysozyme [Escherichia coli IHE3034]
 gi|331081152|gb|EGI52317.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H299]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACESI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRTRSNNCYGQVIRRDQESAL 170


>gi|330445066|ref|ZP_08308719.1| phage lysozyme family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
 gi|328489257|dbj|GAA03216.1| phage lysozyme family protein [Photobacterium leiognathi subsp.
           mandapamensis svers.1.1.]
          Length = 197

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 76/148 (51%), Gaps = 10/148 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A + ++   EG R   Y+    G  T G G+T     E ++I E+ ++D++  +  +
Sbjct: 47  VSPAALSLIGNAEGCRRDPYK-CPAGLVTNGIGNTHGVPNEPISI-EQVSKDWVF-NIQQ 103

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST------FKQRVDAQDWEKAAE 141
           +   L+ S+P L  T + ++ A   F+FN G   + K++        +++ A  ++ A +
Sbjct: 104 AERCLVASAPDLPMT-QGQIDAFTSFIFNTGCTRFRKNSDGSETRIYKKISAGRYDSACD 162

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           E K W   GGK L GLV RR +E++L L
Sbjct: 163 ELKYWVYGGGKKLNGLVNRRQSEMELCL 190


>gi|193066439|ref|ZP_03047485.1| lysozyme [Escherichia coli E22]
 gi|192925910|gb|EDV80558.1| lysozyme [Escherichia coli E22]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++ + +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKGKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRTRSNNCYGQVIRRDQESAL 170


>gi|188494388|ref|ZP_03001658.1| phage lysozyme [Escherichia coli 53638]
 gi|188489587|gb|EDU64690.1| phage lysozyme [Escherichia coli 53638]
 gi|323170934|gb|EFZ56584.1| phage lysozyme family protein [Escherichia coli LT-68]
 gi|323174525|gb|EFZ60148.1| phage lysozyme family protein [Escherichia coli LT-68]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K  G+          G V RRD E  L
Sbjct: 139 IRWWIKDVGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|260868056|ref|YP_003234458.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|312968759|ref|ZP_07782967.1| phage lysozyme family protein [Escherichia coli 2362-75]
 gi|257764412|dbj|BAI35907.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|312286612|gb|EFR14524.1| phage lysozyme family protein [Escherichia coli 2362-75]
          Length = 177

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|56414515|ref|YP_151590.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197363446|ref|YP_002143083.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|198245383|ref|YP_002214534.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|56128772|gb|AAV78278.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. ATCC 9150]
 gi|197094923|emb|CAR60460.1| lysozyme [Salmonella enterica subsp. enterica serovar Paratyphi A
           str. AKU_12601]
 gi|197939899|gb|ACH77232.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. CT_02021853]
 gi|326622286|gb|EGE28631.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Dublin
           str. 3246]
          Length = 145

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 74/141 (52%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG    + V  GMTIT +++ + L +D    
Sbjct: 8   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGNPVVSGMTITSEKSSELLKEDLQWV 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS    + ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 67  EDAI--SSLVRVTLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 124

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 125 A-GKDPDILLPRRRRERALFL 144


>gi|209548355|ref|YP_002280272.1| glycoside hydrolase family 24 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209534111|gb|ACI54046.1| glycoside hydrolase family 24 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 198

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 65/142 (45%), Gaps = 8/142 (5%)

Query: 29  PNALI----KMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFL 81
           P A+I     ++  +EG+ L A+ D     + I +G T   G  + +GM  T +E EDFL
Sbjct: 40  PPAVILAKDALISTWEGIVLEAHYDPYAKIYDICFGKTRLNGKPIRKGMKFTREECEDFL 99

Query: 82  LKDASKSLNL-LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
             D      L L +  P   +   +   A     +N G+G    S       A  W +A 
Sbjct: 100 ETDLFNEYYLPLTKQVPQYVNFPLSVQAAQLSGAYNFGVGGMVLSKAMDAAKAGKWREAC 159

Query: 141 EECKKWTKAGGKVLPGLVKRRD 162
           E+   W +AGG+V+ GLV RR+
Sbjct: 160 EKQTAWNRAGGQVVRGLVLRRE 181


>gi|62327332|ref|YP_224045.1| hypothetical protein BPKS7gp25 [Salmonella phage SS3e]
 gi|57472366|gb|AAW51228.1| hypothetical protein [Salmonella phage SS3e]
          Length = 162

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 67/144 (46%), Gaps = 6/144 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLKD-A 85
           + N  IK    FEG R TAYR      + TIGYGH G+DV EG  ITE +    L KD A
Sbjct: 6   ISNNGIKFTAAFEGFRGTAYRATKNEKYLTIGYGHYGADVKEGQKITEGQGLLLLHKDMA 65

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEECK 144
                +   + P+L   ++++  A+ D V+N G G    ST   Q +   D      +  
Sbjct: 66  KAVAAVDAVAHPSL---NQSQFDAMCDLVYNAGAGVIAASTGTGQALRKGDVATLRNKLS 122

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLL 168
           ++    GK L GL +R    V L 
Sbjct: 123 QFHYQNGKSLLGLRRRAAGRVALF 146


>gi|260844963|ref|YP_003222741.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|257760110|dbj|BAI31607.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 177

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G + RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQISRRDQESAL 170


>gi|257093491|ref|YP_003167132.1| glycoside hydrolase family 24 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
 gi|257046015|gb|ACV35203.1| glycoside hydrolase family 24 [Candidatus Accumulibacter phosphatis
           clade IIA str. UW-1]
          Length = 427

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 45/154 (29%), Positives = 71/154 (46%), Gaps = 15/154 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------TGSDVTEGMTITEKEAE 78
           PVP+  I + K  EG     Y D G    +IGYGH        T   V     I+E +  
Sbjct: 256 PVPDKGIALAKVSEGFVPRLYND-GSRFCSIGYGHVVKKAPCDTNEPVALRRGISELQGA 314

Query: 79  DFLLKDASKSLNLLLESSPALKST--SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW 136
             L++D  ++   +L     L  T  ++ +  A+ DF +N+G      ST  + ++A + 
Sbjct: 315 VLLVEDMRRAQRAVL----GLVKTDLTDGQYAALCDFTYNVGARKLQNSTLLKAINAGEH 370

Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           E+   + ++WT A GK   GL  RR+ E+ L  E
Sbjct: 371 ERVPAQLRRWTLADGKDYRGLKTRREREIGLYFE 404


>gi|157146120|ref|YP_001453439.1| hypothetical protein CKO_01876 [Citrobacter koseri ATCC BAA-895]
 gi|157083325|gb|ABV13003.1| hypothetical protein CKO_01876 [Citrobacter koseri ATCC BAA-895]
          Length = 176

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P    L + L E EG  LTAY+D GGG WTI  G T   G  V +GM +T+ + +     
Sbjct: 21  PASVILDQFLNEKEGNSLTAYKD-GGGIWTICRGATMVDGKPVVQGMKLTQAKCDQVNAI 79

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    S F ++++A D + A  E
Sbjct: 80  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGSGKCLPSGFFRKLNAGDRKGACAE 137

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            ++W   GGK          G V RRD E  L
Sbjct: 138 IRRWIFDGGKDCRIRSNNCFGQVSRRDQESAL 169


>gi|225561137|gb|EEH09418.1| conserved hypothetical protein [Ajellomyces capsulatus G186AR]
          Length = 370

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 50/143 (34%), Positives = 70/143 (48%), Gaps = 8/143 (5%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD--VTEGMTITEKEAEDFLLKDASKS 88
           A + ++KEFEG       D   G  T+GYGH        E      KE    LLK   +S
Sbjct: 36  ATLDLIKEFEGFVPRPEPD-PIGLPTVGYGHLCKTKGCKEVKFPLSKETATTLLKKDLRS 94

Query: 89  LN--LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA-AEECK 144
               + L +  A+K  + N+  A+  + +N+G      S+   R++  +D  K  A+E  
Sbjct: 95  FQQAITLSTKTAVKLNA-NQYGALVSWAYNVGPNAARSSSLISRLNKGEDPNKVIAQELP 153

Query: 145 KWTKAGGKVLPGLVKRRDAEVKL 167
           KW  AGGKV  GLV+RR AEVKL
Sbjct: 154 KWRLAGGKVFKGLVRRRKAEVKL 176


>gi|312969566|ref|ZP_07783749.1| phage lysozyme family protein [Escherichia coli 1827-70]
 gi|310337851|gb|EFQ02940.1| phage lysozyme family protein [Escherichia coli 1827-70]
          Length = 177

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 71/152 (46%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V   M +++++       
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPEMKLSKEKCAQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E 
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K GG+          G V RRD E  L
Sbjct: 139 IRWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|261258645|ref|ZP_05951178.1| putative endolysin [Escherichia coli O157:H7 str. FRIK966]
          Length = 177

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|193071375|ref|ZP_03052291.1| phage lysozyme [Escherichia coli E110019]
 gi|192955291|gb|EDV85778.1| phage lysozyme [Escherichia coli E110019]
 gi|315617968|gb|EFU98562.1| phage lysozyme family protein [Escherichia coli 3431]
          Length = 177

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|134288584|ref|YP_001110823.1| lysozyme [Salmonella phage SETP3]
 gi|125631949|gb|ABN47352.1| lysozyme [Salmonella phage SETP3]
 gi|126015312|gb|ABN70687.1| lysozyme [Salmonella phage SETP5]
 gi|126015314|gb|ABN70688.1| lysozyme [Salmonella phage SETP12]
          Length = 162

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/144 (34%), Positives = 67/144 (46%), Gaps = 6/144 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLKD-A 85
           + N  IK    FEG R TAY+      + TIGYGH G+DV EG  ITE +    L KD A
Sbjct: 6   ISNNGIKFTAAFEGFRGTAYKATKNEKYFTIGYGHYGADVKEGQKITEGQGLLLLHKDMA 65

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEECK 144
                +   + P+L   ++++  AV D V+N G G    ST   Q +   D      +  
Sbjct: 66  KAVAAVDAVAHPSL---NQSQFDAVCDLVYNAGAGVIAASTGTGQALRKGDASTLRNKLT 122

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLL 168
           ++    GK L GL +R    V L 
Sbjct: 123 QFHYQNGKSLLGLRRRAAGRVALF 146


>gi|260867519|ref|YP_003233921.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|260868435|ref|YP_003234837.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|257763875|dbj|BAI35370.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|257764791|dbj|BAI36286.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|320653160|gb|EFX21330.1| putative endolysin [Escherichia coli O55:H7 str. 3256-97 TW 07815]
 gi|320663664|gb|EFX30927.1| putative endolysin [Escherichia coli O157:H7 str. LSU-61]
 gi|323178055|gb|EFZ63635.1| phage lysozyme family protein [Escherichia coli 1180]
          Length = 177

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GTGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|153835192|ref|ZP_01987859.1| phage lysozyme lysis protein [Vibrio harveyi HY01]
 gi|148868302|gb|EDL67430.1| phage lysozyme lysis protein [Vibrio harveyi HY01]
          Length = 218

 Score = 58.9 bits (141), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 53/149 (35%), Positives = 75/149 (50%), Gaps = 11/149 (7%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           I  P AL +++   EG R + Y     G  T G G+T   VT+G+   E+ A D+  ++ 
Sbjct: 69  IVSPKAL-EVIGNAEGCRRSPYT-CPAGLKTDGIGNT-HGVTDGIKSDEQIAIDWT-RNI 124

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNY--NKSTFKQRVDA---QDW-EKA 139
             + N L  SS  + S S+ ++ A   F+FN G   +  N+   + R+     Q W   A
Sbjct: 125 IAAQNCL-ASSGDVASMSQGQVDAFTSFIFNTGCTRFKHNRDGSETRIYHKIKQGWFTGA 183

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
             E K W K GGKVLPGLVKRR+ E  L 
Sbjct: 184 CNELKYWRKGGGKVLPGLVKRRELEANLC 212


>gi|293433594|ref|ZP_06662022.1| lysozyme [Escherichia coli B088]
 gi|291324413|gb|EFE63835.1| lysozyme [Escherichia coli B088]
          Length = 177

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG  LTAYRD G G WTI  G T   G  V  GM +T+++       +
Sbjct: 23  APEILDQFLDEKEGNHLTAYRD-GAGIWTICRGATRVDGRPVVPGMKLTKEKCAQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             ++L  + ++       +E +   +A F  +N+G      STF ++++A D + A  E 
Sbjct: 82  RDRALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPSKCFTSTFYRKLNAGDRKGACAEI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           ++W   GGK          G V RRD E  L
Sbjct: 140 RRWIYDGGKDCRNHSNNCYGQVSRRDQESAL 170


>gi|194433664|ref|ZP_03065940.1| phage lysozyme [Shigella dysenteriae 1012]
 gi|194418093|gb|EDX34186.1| phage lysozyme [Shigella dysenteriae 1012]
 gi|332092902|gb|EGI97970.1| phage lysozyme family protein [Shigella dysenteriae 155-74]
          Length = 174

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVVPGMKLSKEKCAQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|310765235|gb|ADP10185.1| Phage lysozyme [Erwinia sp. Ejp617]
          Length = 169

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 42/139 (30%), Positives = 71/139 (51%), Gaps = 8/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K+L ++EG RL  Y+    G WT G G+T   V  G +IT ++A   L+ +  +  + L
Sbjct: 34  LKLLADYEGCRLMPYQ-CSAGIWTDGIGNT-EGVVPGRSITGQQAAGNLITNVLRVESAL 91

Query: 93  LE--SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            +  + P  +S  ++ LV++A   FN+G      ST  + ++ + W  A ++  +W    
Sbjct: 92  AQCVTEPVPQSVYDS-LVSLA---FNVGTTKTCGSTMVKLLNEKRWRDACQQLPRWIYVK 147

Query: 151 GKVLPGLVKRRDAEVKLLL 169
           G   PGL KRR  E+   L
Sbjct: 148 GVFNPGLKKRRAREMAWCL 166


>gi|260843391|ref|YP_003221169.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|260854638|ref|YP_003228529.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257753287|dbj|BAI24789.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257758538|dbj|BAI30035.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 177

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|238765018|ref|ZP_04625955.1| Lysozyme [Yersinia kristensenii ATCC 33638]
 gi|238696787|gb|EEP89567.1| Lysozyme [Yersinia kristensenii ATCC 33638]
          Length = 157

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/132 (28%), Positives = 57/132 (43%), Gaps = 4/132 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           + ++ + EG RL  Y+    G WT G GHT + V     ITE++A + L+ D       L
Sbjct: 21  LALIADLEGCRLRPYQ-CSAGVWTSGIGHT-AGVVPKREITERDAAENLVADVLHVEQQL 78

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
               P      +    A+  F FN+G     +ST    +  + WE+A  +  +W    G 
Sbjct: 79  AACVPV--DMPQPIYDALVSFSFNVGTAAACRSTLVSYLKHRQWEQACNQLSRWVYVNGV 136

Query: 153 VLPGLVKRRDAE 164
              GL  RR  E
Sbjct: 137 KSKGLENRRQRE 148


>gi|320182668|gb|EFW57555.1| phage lysozyme [Shigella boydii ATCC 9905]
          Length = 177

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++       +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVVPGMKLSKEKCAQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|190890805|ref|YP_001977347.1| phage-related lysozyme protein [Rhizobium etli CIAT 652]
 gi|190696084|gb|ACE90169.1| putative phage-related lysozyme protein [Rhizobium etli CIAT 652]
          Length = 154

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 64/141 (45%), Gaps = 11/141 (7%)

Query: 35  MLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSL 89
           ++  FEGLR  AY D   GG  WTI YG T + V  G   T ++ +  L   L+  ++ +
Sbjct: 18  LVGSFEGLRQNAYPDPATGGQPWTICYGST-NGVKPGDRRTVEQCKALLALELQTYARGI 76

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
              +          + R VA+  F +N+G+     S+  + ++     +  E   KW +A
Sbjct: 77  ESCVRVP-----LPDARFVALTSFAYNVGVKAACGSSAVRLINQGRTAEGCEALLKWNRA 131

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G   PGL +RR  E    LE
Sbjct: 132 AGITFPGLTRRRQKERAFCLE 152


>gi|322832515|ref|YP_004212542.1| lysozyme [Rahnella sp. Y9602]
 gi|321167716|gb|ADW73415.1| Lysozyme [Rahnella sp. Y9602]
          Length = 176

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 73/151 (48%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  + +  KE EG  L AY+D  GG WTI  G T   G  V +GM +T ++ E     +
Sbjct: 22  APVLMEQFQKEKEGTSLIAYQD-QGGVWTICGGVTSVNGKPVFKGMKLTREQCETIDKAE 80

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
            +K+L+ + ++       +E + V +A F  +N+G G    STF  ++ A D   A  E 
Sbjct: 81  QAKALDWVEKNVHV--PLTEPQKVGIASFCPWNIGPGKCFPSTFYGKISAGDRLGACAEI 138

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           K+W   GGK          G V RRD E +L
Sbjct: 139 KRWIWDGGKDCRIRSNNCAGQVIRRDQESEL 169


>gi|9635531|ref|NP_059622.1| lysozyme [Enterobacteria phage P22]
 gi|138699|sp|P09963|LYS_BPP22 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|21914477|gb|AAM81442.1|AF527608_64 gene 19 protein [Salmonella phage P22-pbi]
 gi|215264|gb|AAA32266.1| gene 19 protein [Enterobacteria phage P22]
 gi|8439618|gb|AAF75040.1| lysozyme [Enterobacteria phage P22]
 gi|28394326|tpg|DAA01040.1| TPA_inf: lysozyme [Enterobacteria phage P22]
 gi|157734774|dbj|BAF80780.1| lysozyme [Enterobacteria phage P22]
 gi|169658906|dbj|BAG12663.1| lysozyme [Enterobacteria phage P22]
          Length = 146

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG    + V  GMTIT +++ + L +D    
Sbjct: 9   ITRLKREEGERLKAYSD-SRGIPTIGVGHTGKVDGNSVASGMTITAEKSSELLKEDLQWV 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 68  EDAI--SSLVRVPLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 125

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 126 A-GKDPDILLPRRRRERALFL 145


>gi|90108744|pdb|2ANV|A Chain A, Crystal Structure Of P22 Lysozyme Mutant L86m
 gi|90108745|pdb|2ANV|B Chain B, Crystal Structure Of P22 Lysozyme Mutant L86m
 gi|90108746|pdb|2ANX|A Chain A, Crystal Structure Of Bacteriophage P22 Lysozyme Mutant
           L87m
 gi|90108747|pdb|2ANX|B Chain B, Crystal Structure Of Bacteriophage P22 Lysozyme Mutant
           L87m
          Length = 146

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG    + V  GMTIT +++ + L +D    
Sbjct: 9   ITRLKREEGERLKAYSD-SRGIPTIGVGHTGKVDGNSVASGMTITAEKSSELLKEDLQWV 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 68  EDAI--SSLVRVPLNQNQYDAMCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 125

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 126 A-GKDPDILLPRRRRERALFL 145


>gi|15801561|ref|NP_287578.1| putative endolysin of prophage CP-933O [Escherichia coli O157:H7
           EDL933]
 gi|15830350|ref|NP_309123.1| endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|168751233|ref|ZP_02776255.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|168754255|ref|ZP_02779262.1| lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|168763169|ref|ZP_02788176.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|168767434|ref|ZP_02792441.1| lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|168777823|ref|ZP_02802830.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|168780954|ref|ZP_02805961.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|168787441|ref|ZP_02812448.1| lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|168801290|ref|ZP_02826297.1| lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|193070051|ref|ZP_03050998.1| lysozyme [Escherichia coli E110019]
 gi|195935194|ref|ZP_03080576.1| putative endolysin [Escherichia coli O157:H7 str. EC4024]
 gi|208808339|ref|ZP_03250676.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208815772|ref|ZP_03256951.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208822402|ref|ZP_03262721.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209396035|ref|YP_002269669.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217326335|ref|ZP_03442419.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254792202|ref|YP_003077039.1| phage lysozyme [Escherichia coli O157:H7 str. TW14359]
 gi|260854297|ref|YP_003228188.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|260867172|ref|YP_003233574.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|261226491|ref|ZP_05940772.1| phage lysozyme [Escherichia coli O157:H7 str. FRIK2000]
 gi|261258272|ref|ZP_05950805.1| putative endolysin [Escherichia coli O157:H7 str. FRIK966]
 gi|12515075|gb|AAG56190.1|AE005348_7 putative endolysin of prophage CP-933O [Escherichia coli O157:H7
           str. EDL933]
 gi|13360556|dbj|BAB34519.1| putative endolysin [Escherichia coli O157:H7 str. Sakai]
 gi|187767020|gb|EDU30864.1| phage lysozyme [Escherichia coli O157:H7 str. EC4196]
 gi|188014699|gb|EDU52821.1| lysozyme [Escherichia coli O157:H7 str. EC4113]
 gi|189001377|gb|EDU70363.1| lysozyme [Escherichia coli O157:H7 str. EC4076]
 gi|189358194|gb|EDU76613.1| lysozyme [Escherichia coli O157:H7 str. EC4401]
 gi|189363295|gb|EDU81714.1| lysozyme [Escherichia coli O157:H7 str. EC4486]
 gi|189366570|gb|EDU84986.1| lysozyme [Escherichia coli O157:H7 str. EC4501]
 gi|189372759|gb|EDU91175.1| lysozyme [Escherichia coli O157:H7 str. EC869]
 gi|189376503|gb|EDU94919.1| lysozyme [Escherichia coli O157:H7 str. EC508]
 gi|192956648|gb|EDV87104.1| lysozyme [Escherichia coli E110019]
 gi|208728140|gb|EDZ77741.1| lysozyme [Escherichia coli O157:H7 str. EC4206]
 gi|208732420|gb|EDZ81108.1| lysozyme [Escherichia coli O157:H7 str. EC4045]
 gi|208737887|gb|EDZ85570.1| lysozyme [Escherichia coli O157:H7 str. EC4042]
 gi|209157435|gb|ACI34868.1| lysozyme [Escherichia coli O157:H7 str. EC4115]
 gi|217322556|gb|EEC30980.1| lysozyme [Escherichia coli O157:H7 str. TW14588]
 gi|254591602|gb|ACT70963.1| phage lysozyme [Escherichia coli O157:H7 str. TW14359]
 gi|257752946|dbj|BAI24448.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|257763528|dbj|BAI35023.1| putative endolysin [Escherichia coli O111:H- str. 11128]
 gi|320188742|gb|EFW63402.1| Phage endolysin [Escherichia coli O157:H7 str. EC1212]
 gi|320193217|gb|EFW67855.1| Phage endolysin [Escherichia coli WV_060327]
 gi|323175905|gb|EFZ61499.1| phage lysozyme family protein [Escherichia coli 1180]
 gi|326343364|gb|EGD67129.1| Phage endolysin [Escherichia coli O157:H7 str. 1125]
 gi|326344342|gb|EGD68101.1| Phage endolysin [Escherichia coli O157:H7 str. 1044]
          Length = 177

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|283788249|ref|YP_003368114.1| phage lysozyme [Citrobacter rodentium ICC168]
 gi|282951703|emb|CBG91404.1| phage lysozyme [Citrobacter rodentium ICC168]
          Length = 166

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 65/129 (50%), Gaps = 9/129 (6%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLES 95
           +EG   T Y D  G   TI +GHTG DV  GMT T++E    L KD   A  +++  ++ 
Sbjct: 33  WEGKENTTYIDPTGTP-TICHGHTGPDVKPGMTKTDEECLALLEKDMKWAFAAIDRYVQV 91

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
                  +  + VA+A ++F  G  N+  ST  + ++A     + ++  +W  + G  LP
Sbjct: 92  P-----LTRGQTVALASWIFWAGETNFRNSTLLRLINAGQMPASCKQYIRWIYSKGVKLP 146

Query: 156 GLVKRRDAE 164
           GL  RR A+
Sbjct: 147 GLEARRSAD 155


>gi|260847234|ref|YP_003225012.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|257762381|dbj|BAI33878.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 177

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GTGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G + RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQISRRDQESAL 170


>gi|188587713|ref|YP_001922080.1| putative phage lysozyme [Clostridium botulinum E3 str. Alaska E43]
 gi|188497994|gb|ACD51130.1| putative phage lysozyme [Clostridium botulinum E3 str. Alaska E43]
          Length = 260

 Score = 58.2 bits (139), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 43/148 (29%), Positives = 69/148 (46%), Gaps = 5/148 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A I  +K +EG     Y D+ G   T+GYG TG ++    +ITE +A D L    + 
Sbjct: 108 VSEACINFIKSWEGFFAKPYYDMVG-VLTLGYGMTGDEIKGLSSITESKASDMLKDLINN 166

Query: 88  SLNLLLESSPALKSTS--ENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QDWEKAAEEC 143
               +++ S   K+ S  +N   A+  F +N G      ST  + + +  +D        
Sbjct: 167 KYAQIIKKSLDDKNISLKQNEFDALVSFAYNCGTAGLLGSTLYKNIVSGIRDKNTIISNF 226

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           + W+  GGK + GL +RR  E  + L+S
Sbjct: 227 QAWSNGGGKRIEGLYRRRMKEAAMFLDS 254


>gi|116253660|ref|YP_769498.1| hypothetical protein RL3920 [Rhizobium leguminosarum bv. viciae
           3841]
 gi|115258308|emb|CAK09410.1| putative phage-related protein [Rhizobium leguminosarum bv. viciae
           3841]
          Length = 154

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 65/142 (45%), Gaps = 13/142 (9%)

Query: 35  MLKEFEGLRLTAYRDIG--GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++  FEGLR  AY D    G  WTI YG T + V  G   T ++ +  L      SL L 
Sbjct: 18  LVGSFEGLRQNAYPDPATQGQPWTICYGST-NGVKPGDRKTVEQCKALL------SLELQ 70

Query: 93  LESSPALKST----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
             ++   +       + R VA+  F +N+GI     S+  + ++     +  E   KW +
Sbjct: 71  TYAAGIERCVRVTLPDARFVALTSFAYNVGIKAACGSSAVRLINQGRTAEGCEALLKWNR 130

Query: 149 AGGKVLPGLVKRRDAEVKLLLE 170
           A G V PGL +RR  E +  LE
Sbjct: 131 AAGIVFPGLTRRRQKERQFCLE 152


>gi|331035502|gb|AEC53059.1| hypothetical protein SCRM01_113c [Synechococcus phage S-CRM01]
          Length = 185

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 54/107 (50%), Gaps = 7/107 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDI--GGGAWTIGYGHT----GSDVTEGMTITEKEAEDFL 81
           VP   I + K +EG  LTAY D   GG  WTIG+G T    GS V +G  IT++ AE   
Sbjct: 61  VPEDAIYIKKFYEGCNLTAYPDPLSGGVPWTIGWGTTRYEDGSPVKQGDKITQERAESLF 120

Query: 82  LK-DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTF 127
           +K    + +  L  + P     ++ +  A+  F +NLG G Y  + F
Sbjct: 121 IKYTVDRVIPTLARTIPHWNEMTDRQRAALISFSYNLGEGFYAANGF 167


>gi|218688840|ref|YP_002397052.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218426404|emb|CAR07230.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
          Length = 177

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVFRRDQESAL 170


>gi|187731224|ref|YP_001880057.1| phage lysozyme [Shigella boydii CDC 3083-94]
 gi|218694798|ref|YP_002402465.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli 55989]
 gi|187428216|gb|ACD07490.1| phage lysozyme [Shigella boydii CDC 3083-94]
 gi|218351530|emb|CAU97242.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli 55989]
          Length = 177

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 70/150 (46%), Gaps = 12/150 (8%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
             K+L   +E +  +  T   +    +   +N+G G    STF +R++A D + A E  +
Sbjct: 82  RDKAL-AWVERNIKVPLTEPQKAGIASLCPYNIGPGKCFPSTFYKRLNAGDRKGACEAIR 140

Query: 145 KWTKAGGKVLP-------GLVKRRDAEVKL 167
            W K GG+          G V RRD E  L
Sbjct: 141 WWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|331662785|ref|ZP_08363708.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           TA143]
 gi|331061207|gb|EGI33171.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           TA143]
          Length = 177

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/152 (33%), Positives = 73/152 (48%), Gaps = 16/152 (10%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GMT+T+++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GSGIWTICRGATIVDGKPVIPGMTLTKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKST-SENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
             K+L  +  +   +K T +E +   +A F  +N+G      STF +R++A D + A E 
Sbjct: 82  RDKALAWVDRN---IKVTLTEPQKAGIASFCPYNIGPAKCFPSTFYKRLNAGDRKGACEA 138

Query: 143 CKKWTKAGGKVLP-------GLVKRRDAEVKL 167
            + W K  G+          G V RRD E  L
Sbjct: 139 IRWWIKDRGRDCRLRSNNCYGQVIRRDQESAL 170


>gi|149186229|ref|ZP_01864543.1| Gifsy-2 prophage lysozyme [Erythrobacter sp. SD-21]
 gi|148830260|gb|EDL48697.1| Gifsy-2 prophage lysozyme [Erythrobacter sp. SD-21]
          Length = 198

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 52/164 (31%), Positives = 82/164 (50%), Gaps = 15/164 (9%)

Query: 16  GMNGDDKHNKIP---VPNALIKMLKEFEGLR-------LTAYRD--IGGGAWTIGYGHTG 63
           G++  D    +P   V    I+++K FEG           AY D   GG  WTIG+G TG
Sbjct: 35  GVSAQDPAPSVPSCRVSPEGIQLIKRFEGCARERPDGCFEAYPDPGTGGAPWTIGWGATG 94

Query: 64  SDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYN 123
           +D++     T+ + +  L +D ++    +  S+     T++ +  A+  F FN   G   
Sbjct: 95  TDISLDTVWTKAQCDARLEQDIARHAKDVA-SAIGNCPTTQGQFDALVSFHFN--TGAIR 151

Query: 124 KSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +++  +   A ++E AAEE  +W  AGGKVL GL +RR  E KL
Sbjct: 152 RASLTKLHRAGEYEAAAEEFARWRYAGGKVLKGLERRRRQEAKL 195


>gi|209549987|ref|YP_002281904.1| glycoside hydrolase family 24 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
 gi|209535743|gb|ACI55678.1| glycoside hydrolase family 24 [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 154

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 66/141 (46%), Gaps = 11/141 (7%)

Query: 35  MLKEFEGLRLTAYRDIG--GGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSL 89
           ++  FEGLR +AY D    G  WTI YG T + V  G   T ++ +  L   L+  +  +
Sbjct: 18  LVGSFEGLRQSAYPDPATQGQPWTICYGST-NGVKPGDRKTVEQCKALLALELQTYAAGI 76

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           +  +          + R VA+  F +N+G+     S+  + ++     +  E   KW +A
Sbjct: 77  DHCVAVP-----LPDARFVALTSFAYNVGVKAACGSSAVKLINKGKTAEGCEALLKWNRA 131

Query: 150 GGKVLPGLVKRRDAEVKLLLE 170
            G V PGL +RR  E +  LE
Sbjct: 132 AGIVFPGLTRRRQKERQFCLE 152


>gi|194445839|ref|YP_002043308.1| glycoside hydrolase, family 24 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194404502|gb|ACF64724.1| glycoside hydrolase, family 24 [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
          Length = 169

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/143 (28%), Positives = 65/143 (45%), Gaps = 14/143 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK----- 87
           + ++ + EG RL  Y+    G WT G GHT + V     ITEKEA   L+ D        
Sbjct: 33  LALIADLEGCRLRPYQ-CSAGVWTSGIGHT-AGVVPKRDITEKEAAANLVADVLNVEKRL 90

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           ++ + ++  PA+         A+  F FN+G G   +ST    +  + W +A ++  +W 
Sbjct: 91  AVCVPVDMPPAVYD-------ALVSFAFNVGTGAACRSTLVYHLKHRQWWQACDQLTRWV 143

Query: 148 KAGGKVLPGLVKRRDAEVKLLLE 170
              G+   GL  RR  E    L+
Sbjct: 144 FVNGERNTGLENRRFRERTYCLK 166


>gi|9910774|sp|Q9ZXB7|LYS_BPH19 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase
 gi|4335686|gb|AAD17382.1| R protein [Enterobacteria phage H-19B]
          Length = 177

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GTGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L   +E +  +  T   +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKAL-AWVEKNIKVPLTDPQK-AGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|168465699|ref|ZP_02699581.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|195631620|gb|EDX50140.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
          Length = 145

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 73/144 (50%), Gaps = 14/144 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKD---A 85
           I  LK  EG RL AY D   G  TIG GHTG    + V  GMTIT +++ + L +D    
Sbjct: 8   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGNPVVSGMTITAEKSSELLKEDLQWV 66

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
             ++N L+         ++N+  A+   +FN+G   +  ST  ++++ ++++ AA     
Sbjct: 67  EDAINSLVRVP-----LNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAANAFLL 121

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLL 169
           W KA GK    L+ RR  E  L L
Sbjct: 122 WKKA-GKDPDILLPRRRRERALFL 144


>gi|1143594|emb|CAA47617.1| gp19 protein [Enterobacteria phage ES18]
          Length = 146

 Score = 58.2 bits (139), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG      V  GMTIT +++ + L +D    
Sbjct: 9   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGKPVVSGMTITAEKSSELLKEDLQWV 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 68  EDAI--SSLVRVPLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 125

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 126 A-GKDPDILLPRRRRERALFL 145


>gi|126173531|ref|YP_001049680.1| glycoside hydrolase family protein [Shewanella baltica OS155]
 gi|125996736|gb|ABN60811.1| glycoside hydrolase, family 24 [Shewanella baltica OS155]
          Length = 163

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 68/136 (50%), Gaps = 3/136 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++ + EGL L  Y D   G  T  +G TG +   G   +E+E    +L D  +  +  L 
Sbjct: 23  LVAQQEGLVLGTYVD-PVGIVTACFGKTGPEFELGQRFSEQECLA-MLADDLEVFDRQLT 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVL 154
           +   +  T   R  A   F++N+G  N++ ST ++++   D   A  E  +W  A GK L
Sbjct: 81  NQVRVPITDSER-AAYLSFMYNVGAQNFSDSTLRKKLLHGDRIGACNELSRWVYAKGKKL 139

Query: 155 PGLVKRRDAEVKLLLE 170
            GLV RR+AE +L L+
Sbjct: 140 QGLVNRREAERQLCLK 155


>gi|62362289|ref|YP_224214.1| gp76 [Enterobacteria phage ES18]
 gi|58339132|gb|AAW70547.1| gp76 [Enterobacteria phage ES18]
          Length = 145

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG      V  GMTIT +++ + L +D    
Sbjct: 8   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGKPVVSGMTITAEKSSELLKEDLQWV 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 67  EDAI--SSLVRVPLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 124

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 125 A-GKDPDILLPRRRRERALFL 144


>gi|320181556|gb|EFW56473.1| phage lysozyme [Shigella boydii ATCC 9905]
 gi|323172515|gb|EFZ58150.1| lysozyme [Escherichia coli LT-68]
          Length = 105

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (55%), Gaps = 4/102 (3%)

Query: 69  GMTITEKEAEDFLLKDASKSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTF 127
           G T TE E +  L KD +    +  + +P +K    E    A+  FV+N+G GN+  ST 
Sbjct: 3   GKTYTEAECKALLNKDLA---TVARQINPYIKVDIPETTRGALYSFVYNVGAGNFRTSTL 59

Query: 128 KQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            ++++  D + A ++ ++WT AGGK   GL+ RR+ E ++ L
Sbjct: 60  LRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCL 101


>gi|254560531|ref|YP_003067626.1| hypothetical protein METDI2074 [Methylobacterium extorquens DM4]
 gi|254267809|emb|CAX23656.1| hypothetical protein; putative Lysozyme-like domain
           [Methylobacterium extorquens DM4]
          Length = 187

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           EG RL AYRD  GG WTIG GHT +        G+ I   EA+    +D +  +  + E+
Sbjct: 15  EGRRLEAYRDSVGG-WTIGIGHTAAAGPPMPRAGLRIEAGEADAIFTRDVAAFVRTVAEA 73

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P  +   ++   A+    FN+G   + +ST  +R+ A D   A E    W +       
Sbjct: 74  IP--EPLPQHAFDALVSLCFNIGSAAFRRSTVLRRLRAGDRAGAGEAILMWNRPA----- 126

Query: 156 GLVKRRDAE 164
            ++ RR  E
Sbjct: 127 AIIPRRQGE 135


>gi|254195039|ref|ZP_04901468.1| lysozyme [Burkholderia pseudomallei S13]
 gi|254195721|ref|ZP_04902147.1| phage lysozyme [Burkholderia pseudomallei S13]
 gi|169651787|gb|EDS84480.1| lysozyme [Burkholderia pseudomallei S13]
 gi|169652466|gb|EDS85159.1| phage lysozyme [Burkholderia pseudomallei S13]
          Length = 162

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G T +E E    L          
Sbjct: 18  LAVVVPKFEGVKLAGYLDPVG-IPTKCMGDT-RDVIVGRTYSEAECRQSLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGRP 134

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VL GLVKRR AE + + E
Sbjct: 135 QWVTARGRVLSGLVKRR-AEERAICE 159


>gi|116205263|ref|XP_001228442.1| hypothetical protein CHGG_10515 [Chaetomium globosum CBS 148.51]
 gi|88176643|gb|EAQ84111.1| hypothetical protein CHGG_10515 [Chaetomium globosum CBS 148.51]
          Length = 258

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFL--- 81
           +A + ++ + EG R   Y D  G   T+GYGH       +++   + ++  + +  L   
Sbjct: 101 SATVDLIAKSEGFRANVYNDPAGHP-TVGYGHLCTKAKCAEIKYKIPLSTTDGKKLLADD 159

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA-- 139
           +K   K +  +L S   L   + N+  A+  + FN+G G    S   +R++  +      
Sbjct: 160 MKKFEKCITAMLNSKAKL---NLNQYGALVSWSFNVGCGAAQGSQLVKRLNKGENVNTVL 216

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           + E  KW  AGGK LPGLV RR+ E+ L  +S
Sbjct: 217 SNELPKWVNAGGKKLPGLVTRRNNEIALAKKS 248


>gi|260854369|ref|YP_003228260.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|291282467|ref|YP_003499285.1| putative endolysin [Escherichia coli O55:H7 str. CB9615]
 gi|257753018|dbj|BAI24520.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|290762340|gb|ADD56301.1| putative endolysin [Escherichia coli O55:H7 str. CB9615]
 gi|320637105|gb|EFX06950.1| putative endolysin [Escherichia coli O157:H7 str. G5101]
 gi|323152528|gb|EFZ38811.1| phage lysozyme family protein [Escherichia coli EPECa14]
          Length = 177

 Score = 57.8 bits (138), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|240280306|gb|EER43810.1| conserved hypothetical protein [Ajellomyces capsulatus H143]
          Length = 349

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/147 (32%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG-----MTITEKEAEDFLL 82
           V  A + ++KEFEG       D   G  T+GYGH     T+G       +++  A   L 
Sbjct: 33  VNKATLALIKEFEGFVPRPEPD-PIGLPTVGYGHLCK--TKGCKEVKFPLSKGTATTLLK 89

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA-A 140
           KD       +  S+      + N+  A+  + +N+G      S+   R++  +D  K  A
Sbjct: 90  KDLRSFQQAITLSTKTAVKLNANQYGALVSWAYNVGPNAARSSSLISRLNKGEDPNKVIA 149

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +E  KW  AGGKV  GLV+RR AEVKL
Sbjct: 150 QELPKWRLAGGKVFKGLVRRRKAEVKL 176


>gi|163850845|ref|YP_001638888.1| glycoside hydrolase family protein [Methylobacterium extorquens
           PA1]
 gi|163662450|gb|ABY29817.1| glycoside hydrolase family 24 [Methylobacterium extorquens PA1]
          Length = 187

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHT---GSDVTE-GMTITEKEAEDFLLKDASKSLNLLLES 95
           EG RL AYRD   G WTIG GHT   G  V   G+ I   EA+    +D +  +  + E+
Sbjct: 15  EGRRLEAYRD-SVGVWTIGIGHTAAAGPPVPRAGLRIEAGEADAIFTRDVAAFVRTVAEA 73

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P  +   ++   A+    FN+G   + +ST  +R+ A D   A E    W +       
Sbjct: 74  IP--EPLPQHAFDALVSLCFNIGPAAFRRSTVLRRLRAGDRAGAGEAILMWNRPA----- 126

Query: 156 GLVKRRDAE 164
            ++ RR  E
Sbjct: 127 AIIPRRQGE 135


>gi|260425205|ref|ZP_05779186.1| lysozyme [Citreicella sp. SE45]
 gi|260423777|gb|EEX17026.1| lysozyme [Citreicella sp. SE45]
          Length = 181

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 59/137 (43%), Gaps = 6/137 (4%)

Query: 33  IKMLKEFEGLRLTAYRDI--GGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASK 87
           I ++ ++EGLR  AY D       WT+ YG T   V  G   +  E    L +       
Sbjct: 38  IPLVSKWEGLRTEAYLDTIASPPVWTVCYGET-VGVKAGDRYSADECAAMLGRRILVYRS 96

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            L+  +      +     R  A     +N+G+    KST  +R++A D     E    W 
Sbjct: 97  GLHRYMTPETLAQRMPPTRDAAYTSLAYNVGVAGAGKSTATRRLNAGDIRGGCEALTWWN 156

Query: 148 KAGGKVLPGLVKRRDAE 164
           KAGG+V+ GLV RR  E
Sbjct: 157 KAGGRVIRGLVNRRAEE 173


>gi|254197873|ref|ZP_04904295.1| lysozyme [Burkholderia pseudomallei S13]
 gi|169654614|gb|EDS87307.1| lysozyme [Burkholderia pseudomallei S13]
          Length = 165

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/146 (32%), Positives = 65/146 (44%), Gaps = 11/146 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G T +E E    L          
Sbjct: 21  LAVVVPKFEGVKLAGYLDPVG-IPTKCMGDT-RDVIVGRTYSEAECRQSLETQLIAHAEP 78

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 79  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINEADDGRP 137

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W  A G+VL GLVKRR AE + + E
Sbjct: 138 QWVTARGRVLSGLVKRR-AEERAICE 162


>gi|218690232|ref|YP_002398444.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218427796|emb|CAR08561.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
          Length = 177

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V  GM +++ + +     +
Sbjct: 23  APEILDQFLDEKEGNHTMAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKGKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|153212095|ref|ZP_01947912.1| lysozyme [Vibrio cholerae 1587]
 gi|124116891|gb|EAY35711.1| lysozyme [Vibrio cholerae 1587]
          Length = 184

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 47/161 (29%), Positives = 75/161 (46%), Gaps = 18/161 (11%)

Query: 22  KHNKI--PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAED 79
           K+NK+   V    + +   FEG R  AY+D+GG  WT+  G T + V +G   T+ +  +
Sbjct: 2   KYNKLVGAVLIGAVALTGAFEGKRNVAYQDVGG-VWTVCNGET-NGVKQGDKYTDAQCAE 59

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
            L K   K    L +    L     N  +A  DF +N+G+GN   ST  + +  +  + A
Sbjct: 60  MLAKSLEKHNKPLEKLDYQLPP---NVHIATLDFAYNVGVGNLESSTLYRHLQNRQIQYA 116

Query: 140 AEECKKWTKA--GGKV---------LPGLVKRRDAEVKLLL 169
             +  +WTK    G++           G+V RR+ E +L L
Sbjct: 117 CYQFNRWTKVRIDGELRDCRNPQWNCRGIVVRREIETQLCL 157


>gi|308188171|ref|YP_003932302.1| lysozyme [Pantoea vagans C9-1]
 gi|308058681|gb|ADO10853.1| putative lysozyme [Pantoea vagans C9-1]
          Length = 169

 Score = 57.4 bits (137), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 62/138 (44%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ ++EG RL  Y+    G WT G G+T S V  G +ITE++A    + +  ++   L
Sbjct: 34  LRLIADYEGCRLQPYQ-CSAGKWTDGIGNT-SGVVPGKSITERQAAGNFITNVLRTEAAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
                   S  +    A+    FN+G GN   ST    +    W +A  +  +W    G 
Sbjct: 92  ARCVAV--SMPQQVYDALVSLAFNVGTGNVCASTMVTLLKKGQWREACYQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FSQGLDNRRGRELAWCLK 167


>gi|218689475|ref|YP_002397687.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218427039|emb|CAR07915.2| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
          Length = 177

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V  GM +++ + +     +
Sbjct: 23  APEILDQFLDEKEGNHTMAYRD-GAGIWTICRGATRVDGKPVIPGMKLSKGKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|329888601|ref|ZP_08267199.1| phage lysozyme family protein [Brevundimonas diminuta ATCC 11568]
 gi|328847157|gb|EGF96719.1| phage lysozyme family protein [Brevundimonas diminuta ATCC 11568]
          Length = 206

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 48/97 (49%), Gaps = 11/97 (11%)

Query: 32  LIKMLKEFEGLRLTAYRDI----------GGGAWTIGYGHTGSDVTEGMTITEKEAEDFL 81
           LI  LK+ EGLRL AY D            G  WTIGYG     + EG  ITE  AE +L
Sbjct: 50  LIAALKKDEGLRLKAYPDPLSPRARTGKGSGAPWTIGYGRA-RGIQEGQVITEATAEAWL 108

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLG 118
           ++DA +   ++  + P LK     R   + +  FN+G
Sbjct: 109 IEDAREHNRVIHAALPWLKRLDPVRRRVIENMHFNMG 145


>gi|269102620|ref|ZP_06155317.1| putative phage lysozyme precursor [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268162518|gb|EEZ41014.1| putative phage lysozyme precursor [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 180

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 51/163 (31%), Positives = 76/163 (46%), Gaps = 24/163 (14%)

Query: 19  GDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAE 78
           G D H K   P+ L   +   EG    AY+      WT G GHT  +V EG +   ++  
Sbjct: 24  GTDHHLKTS-PDGL-AFISNLEGCSSVAYQ-CSADRWTAGLGHT-KNVKEGDSANTEQIA 79

Query: 79  DFLLKD---ASKSLN--LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA 133
           D+ ++D   A K +N  + L + P          +AV+ FVFNLG GN+  ST+ +++ A
Sbjct: 80  DWFIEDIAAAEKVVNREVTLPAGPKYD-------MAVS-FVFNLGAGNFRSSTYLKKLKA 131

Query: 134 QDWEKAAEECKKWTKAGGK-------VLPGLVKRRDAEVKLLL 169
              + A  E  +W    GK          G+V RR AE ++ L
Sbjct: 132 GQLDAACYEFPRWVYVNGKDCRIDGNHCSGIVTRRLAEKEVCL 174


>gi|86356755|ref|YP_468647.1| putative lysozyme protein [Rhizobium etli CFN 42]
 gi|86280857|gb|ABC89920.1| putative lysozyme protein [Rhizobium etli CFN 42]
          Length = 154

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 59/134 (44%), Gaps = 5/134 (3%)

Query: 39  FEGLRLTAYRDIG--GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESS 96
           FEGLR  AY D    G  WTI YG T + V  G   T  E    L  +  +  N + +  
Sbjct: 22  FEGLRQHAYPDPATQGQPWTICYGST-NGVKPGDYKTVGECRALLSLELRRYANGIEQCV 80

Query: 97  PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPG 156
            A     + R VA+  F +N+G+     S+  + ++     +  E   KW +A G   PG
Sbjct: 81  TA--PLPDARFVALTSFAYNVGVRAACGSSAVRLINQGRTAEGCEALLKWNRAAGITFPG 138

Query: 157 LVKRRDAEVKLLLE 170
           L +RR  E    LE
Sbjct: 139 LTRRRQKERAFCLE 152


>gi|83955427|ref|ZP_00964058.1| phage-related endolysin [Sulfitobacter sp. NAS-14.1]
 gi|83840071|gb|EAP79246.1| phage-related endolysin [Sulfitobacter sp. NAS-14.1]
          Length = 299

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 63/140 (45%), Gaps = 5/140 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           +  + ++EGLRL AYRDI G  WT+ YG T   V  G   T+ + +  L ++       L
Sbjct: 157 VPYVGKWEGLRLAAYRDIVG-VWTVCYGET-KGVKPGDRYTKAQCDAMLARELISYRTRL 214

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           +              +R  A     +N+G+G    ST  +R++  D     +    W KA
Sbjct: 215 HRYFTRETLAGRLPVHRDTAYTSLAYNVGVGGAGGSTAVRRLNGGDIAGGCKAITWWDKA 274

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
           G +V+ GL  RR  +  L +
Sbjct: 275 GNRVVRGLTLRRGEDYALCM 294


>gi|89886016|ref|YP_516213.1| putative phage lysozyme [Sodalis phage phiSG1]
 gi|89191751|dbj|BAE80498.1| putative phage lysozyme [Sodalis phage phiSG1]
 gi|125470046|gb|ABN42238.1| gp31 [Sodalis phage phiSG1]
          Length = 136

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 62/124 (50%), Gaps = 10/124 (8%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSLNL 91
           ++   EG RL AY+    G WTIGYGHT   V  G  I+  +A +    D   A  ++N 
Sbjct: 10  LIMRLEGGRLRAYQ-CRAGIWTIGYGHT-EGVKPGDKISLDQALELFNHDVQWAVDAVNA 67

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           L++        S+ +  A+  FVFN+G   + +S   ++++A D   AA E  +W + GG
Sbjct: 68  LVKVP-----LSQGQFEALCSFVFNVGRAAFAQSRLLKKLNAGDVAGAAAEFPRWDRGGG 122

Query: 152 KVLP 155
              P
Sbjct: 123 GKNP 126


>gi|238790720|ref|ZP_04634482.1| Lysozyme [Yersinia frederiksenii ATCC 33641]
 gi|238721215|gb|EEQ12893.1| Lysozyme [Yersinia frederiksenii ATCC 33641]
          Length = 176

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 67/130 (51%), Gaps = 7/130 (5%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P    L ++L E EG RL AY D G G WTI  G T   G  V +GM ++  +       
Sbjct: 21  PATIILDQLLDEKEGNRLVAYPD-GKGIWTICRGATQVDGKPVVKGMKLSADKCAAVNQL 79

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +A K+++ + ++       +E ++  +A F  +N+G G    STF ++++A D + A  E
Sbjct: 80  EADKAISWVKKNVRV--PLTEPQIAGIASFCPYNIGPGKCFTSTFYKKLNAGDRKGACAE 137

Query: 143 CKKWTKAGGK 152
            K+W   GGK
Sbjct: 138 IKRWVYDGGK 147


>gi|322617171|gb|EFY14077.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315996572]
 gi|322617521|gb|EFY14420.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-1]
 gi|322624850|gb|EFY21679.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-3]
 gi|322630400|gb|EFY27170.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 495297-4]
 gi|322634580|gb|EFY31313.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-1]
 gi|322639291|gb|EFY35983.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 515920-2]
 gi|322646146|gb|EFY42661.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. NC_MB110209-0054]
 gi|322651990|gb|EFY48353.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. OH_2009072675]
 gi|322656163|gb|EFY52460.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. CASC_09SCPH15965]
 gi|322659315|gb|EFY55562.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 19N]
 gi|322665775|gb|EFY61958.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 81038-01]
 gi|322669987|gb|EFY66128.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MD_MDA09249507]
 gi|322673974|gb|EFY70071.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 414877]
 gi|322678731|gb|EFY74787.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 366867]
 gi|322683473|gb|EFY79487.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 413180]
 gi|322687548|gb|EFY83518.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 446600]
 gi|323193616|gb|EFZ78821.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609458-1]
 gi|323198523|gb|EFZ83625.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556150-1]
 gi|323203545|gb|EFZ88568.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 609460]
 gi|323208427|gb|EFZ93366.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 507440-20]
 gi|323213563|gb|EFZ98353.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 556152]
 gi|323218401|gb|EGA03111.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB101509-0077]
 gi|323219728|gb|EGA04209.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB102109-0047]
 gi|323224534|gb|EGA08815.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB110209-0055]
 gi|323232395|gb|EGA16498.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. MB111609-0052]
 gi|323235572|gb|EGA19656.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009083312]
 gi|323241269|gb|EGA25305.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 2009085258]
 gi|323245011|gb|EGA29013.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. 315731156]
 gi|323250129|gb|EGA34023.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2009159199]
 gi|323253914|gb|EGA37739.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008282]
 gi|323258784|gb|EGA42440.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008283]
 gi|323262842|gb|EGA46393.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008284]
 gi|323264217|gb|EGA47724.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008285]
 gi|323268702|gb|EGA52165.1| phage lysozyme [Salmonella enterica subsp. enterica serovar
           Montevideo str. IA_2010008287]
          Length = 145

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I +LK  EG  L AY D   G  TIG GHTG    + V  GMTIT +++ + L +D    
Sbjct: 8   ITILKREEGESLKAYPD-SRGIPTIGVGHTGKVDGNPVVSGMTITSEKSSELLKEDLQWV 66

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 67  EDAI--SSLVRVQLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWKK 124

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 125 A-GKDPDILLPRRRRERALFL 144


>gi|168243812|ref|ZP_02668744.1| lysozyme [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|194449717|ref|YP_002045030.1| lysozyme [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194408021|gb|ACF68240.1| lysozyme [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|205337214|gb|EDZ23978.1| lysozyme [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
          Length = 179

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L+E EG  L A RD  GG W++  G T   G  V +G  +T+ + + +   +
Sbjct: 25  APQLLDQFLQEREGNTLVAVRD-NGGVWSVCRGVTRIDGKPVVKGQRLTQSQCDHYNAIE 83

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L+ +  +       +E +   +A F  +N+G G    STF ++++A D + A  E 
Sbjct: 84  RDKALSWV--NKHVHIPLTEPQKTGIASFCPYNIGPGKCFPSTFYRKLNAGDRKGACAEI 141

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           ++W   GGK          G V RRD E  L
Sbjct: 142 RRWIYDGGKDCHNRENQCYGQVIRRDQESAL 172


>gi|193071336|ref|ZP_03052253.1| phage lysozyme [Escherichia coli E110019]
 gi|192955320|gb|EDV85806.1| phage lysozyme [Escherichia coli E110019]
          Length = 177

 Score = 57.0 bits (136), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
             W K GG+          G V RRD E  L
Sbjct: 140 LWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|307944684|ref|ZP_07660023.1| endolysin [Roseibium sp. TrichSKD4]
 gi|307772111|gb|EFO31333.1| endolysin [Roseibium sp. TrichSKD4]
          Length = 253

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 52/151 (34%), Positives = 67/151 (44%), Gaps = 16/151 (10%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           KI VP    K     EG R  AY D+ G   TI YG T   V  GM  T  E    L  +
Sbjct: 109 KIAVPFIAAK-----EGKRNRAYLDVVGVP-TICYGST-RGVKLGMVKTNAECTALLRDE 161

Query: 85  ASKSLNLLLESSPALKSTSENRLV------AVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
            ++  + L    P    T+++R +      A     FN GI    +ST  +R+++ D   
Sbjct: 162 VAEYRHGL---HPYFTKTTKSRRLPPSRDAAFTSLAFNCGIRAIGRSTATRRLNSGDIRG 218

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           A      W KAGG+V  GLV RR AE  L L
Sbjct: 219 ACHAITWWNKAGGRVWRGLVVRRSAERDLCL 249


>gi|298369823|ref|ZP_06981139.1| phage lysozyme [Neisseria sp. oral taxon 014 str. F0314]
 gi|298281283|gb|EFI22772.1| phage lysozyme [Neisseria sp. oral taxon 014 str. F0314]
          Length = 156

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 39  FEGLRLTAYRD--------IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           +EG R  +Y D        IG   +T+G    G  V  G T+T++E +   L       N
Sbjct: 18  WEGKRNHSYLDSVRIPTIGIGFVRYTLG-ARAGHKVCMGDTMTDEEIKAEFLNQIKSYEN 76

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            + E        ++++  A     +N+G+  + KST  +R++ + ++ A +    W KAG
Sbjct: 77  GVKEVVKV--PLTQSQFNACVSLCYNIGVAAFAKSTVVRRLNERKYKAACDAFAMWNKAG 134

Query: 151 GKVLPGLVKRRDAEVK 166
           G+V+PGL  RR +E K
Sbjct: 135 GRVIPGLANRRSSEQK 150


>gi|307308918|ref|ZP_07588601.1| glycoside hydrolase family 24 [Sinorhizobium meliloti BL225C]
 gi|306900552|gb|EFN31165.1| glycoside hydrolase family 24 [Sinorhizobium meliloti BL225C]
          Length = 154

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 57/156 (36%), Positives = 77/156 (49%), Gaps = 27/156 (17%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS----DVTEGMTITEKEAEDFLLKD 84
           P A I ++K  EG  L A+        TIGYGHT +    DV    TITE EAE  L  D
Sbjct: 7   PKA-ISLIKTSEGCELRAHF-CPANIPTIGYGHTKTVTKDDVKRRKTITEAEAERLLKAD 64

Query: 85  ASKSLNLLLESSPA----LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ----DW 136
            +     + ES  A    +K T +++  A+  F +NLGIG +  ST  +R++A+    D 
Sbjct: 65  LA-----VFESGVAKLVKVKLT-DDQFGALVSFAYNLGIGAFGSSTLLKRINAKASLADI 118

Query: 137 EKAAEECKKWTKAGG----KVLPGLVKRRDAEVKLL 168
           E++  +   W KA      K L GL KRR AE  L 
Sbjct: 119 ERSWLQ---WDKARVNGVLKPLAGLTKRRKAEFALF 151


>gi|254294374|ref|YP_003060397.1| glycoside hydrolase family 24 [Hirschia baltica ATCC 49814]
 gi|254042905|gb|ACT59700.1| glycoside hydrolase family 24 [Hirschia baltica ATCC 49814]
          Length = 597

 Score = 57.0 bits (136), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 73/145 (50%), Gaps = 14/145 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSL 89
           + ++K FEG R  A R +  G W +GYGH  S   EG+ ++ ++AE  L   LK   ++L
Sbjct: 12  LALIKSFEGFRERATR-LPDGRWVVGYGHVKS-AREGVRVSPEDAEALLIYDLKPIEEAL 69

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
             LL         ++N+  A+  F  N+ +G +  S   + +++ +  +AA   + W KA
Sbjct: 70  EDLL-----FSPLNQNQHDAIVSFASNISLGLFRDSEVLRFLNSGEHIRAAHAMEVWRKA 124

Query: 150 --GGK--VLPGLVKRRDAEVKLLLE 170
              G   V+  LV+RR  E  L LE
Sbjct: 125 RLNGHVCVVDALVRRRAIEKALFLE 149


>gi|320652155|gb|EFX20474.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H-
           str. H 2687]
          Length = 201

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 62/129 (48%), Gaps = 7/129 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 21  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIE 79

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 80  RDKALEWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAI 137

Query: 144 KKWTKAGGK 152
           + W K GG+
Sbjct: 138 RWWIKDGGR 146


>gi|91205900|ref|YP_538255.1| lysozyme [Rickettsia bellii RML369-C]
 gi|157826739|ref|YP_001495803.1| lysozyme [Rickettsia bellii OSU 85-389]
 gi|91069444|gb|ABE05166.1| Lysozyme [Rickettsia bellii RML369-C]
 gi|157802043|gb|ABV78766.1| Lysozyme [Rickettsia bellii OSU 85-389]
          Length = 151

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 73/138 (52%), Gaps = 6/138 (4%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           ++K+FE L+LT Y     G  TIGYGH       +     ITE++AE  L  D ++   +
Sbjct: 10  LIKQFESLQLTPYY-CPAGLKTIGYGHVIKPHEMLHLANKITEEDAEKLLDADIAEVNCV 68

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           L +   +  S + N+ VA+  F+FN G   +  ST  ++++   + +AA+E  KW    G
Sbjct: 69  LYKYCHS--SLNINQQVALISFIFNCGSTAFKNSTLLKKLNQNKYLEAADEFLKWIYVKG 126

Query: 152 KVLPGLVKRRDAEVKLLL 169
           K L GLVKRR  E  + L
Sbjct: 127 KKLKGLVKRRQIERAIFL 144


>gi|331672903|ref|ZP_08373689.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA280]
 gi|331070124|gb|EGI41493.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA280]
          Length = 177

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +T+++       +
Sbjct: 23  APQILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLTKEKCAQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K  G+          G V RRD E  L
Sbjct: 140 RWWIKDRGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|205360392|ref|ZP_03224610.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
 gi|205349870|gb|EDZ36501.1| phage lysozyme [Salmonella enterica subsp. enterica serovar Hadar
           str. RI_05P066]
          Length = 146

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 72/141 (51%), Gaps = 8/141 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG    + V  GM IT +++ + L +D    
Sbjct: 9   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGNPVVSGMIITAEKSSELLKEDLQWV 67

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 148
            + +  SS      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+    W K
Sbjct: 68  EDAI--SSLVRVPLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAFLLWRK 125

Query: 149 AGGKVLPGLVKRRDAEVKLLL 169
           A GK    L+ RR  E  L L
Sbjct: 126 A-GKDPDILLPRRRRERALFL 145


>gi|194444753|ref|YP_002040310.1| lysozyme [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
 gi|194403416|gb|ACF63638.1| lysozyme [Salmonella enterica subsp. enterica serovar Newport str.
           SL254]
          Length = 179

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L+E EG  L A RD  GG W++  G T   G  V +G  +T+ + + +   +
Sbjct: 25  APQLLDQFLQEREGNTLVAVRD-NGGVWSVCRGVTHIDGKPVVKGQRLTQSQCDHYNAIE 83

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF ++++A D + A  E 
Sbjct: 84  RDKALAWV--NKHVHIPLTEPQKAGIASFCPYNIGPGKCFPSTFYRKLNAGDRKGACAEI 141

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           ++W   GGK          G V RRD E  L
Sbjct: 142 RRWVYDGGKDCRNRENQCYGQVIRRDQESAL 172


>gi|306813982|ref|ZP_07448155.1| putative lysozyme [Escherichia coli NC101]
 gi|222032918|emb|CAP75658.1| lysozyme from lambdoid prophage Qin [Escherichia coli LF82]
 gi|305852619|gb|EFM53067.1| putative lysozyme [Escherichia coli NC101]
 gi|312945732|gb|ADR26559.1| predicted lysozyme [Escherichia coli O83:H1 str. NRG 857C]
 gi|324009138|gb|EGB78357.1| phage lysozyme [Escherichia coli MS 57-2]
          Length = 177

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V  GM +++++       +
Sbjct: 23  APQILDQFLDEKEGNHTKAYRD-GSGIWTICRGATVVDGKPVIPGMKLSKEKCAQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACESI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRTRSNNCYGQVIRRDQESAL 170


>gi|259907272|ref|YP_002647628.1| Phage lysozyme [Erwinia pyrifoliae Ep1/96]
 gi|224962894|emb|CAX54375.1| Phage lysozyme [Erwinia pyrifoliae Ep1/96]
 gi|283477087|emb|CAY72987.1| putative lysozyme [Erwinia pyrifoliae DSM 12163]
          Length = 169

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 70/139 (50%), Gaps = 8/139 (5%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K+L ++EG  L  Y+    G WT G G+T   V  G +IT ++A   L+ +  +  + L
Sbjct: 34  LKLLADYEGCHLMPYQ-CSAGIWTDGIGNT-EGVVSGRSITGQQAAGNLITNVLRVESAL 91

Query: 93  LE--SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            +  + P  +S  ++ LV++A   FN+G      ST  + ++ + W  A ++  +W    
Sbjct: 92  AQCLTEPVPQSVYDS-LVSLA---FNVGTTKTCGSTMVKLLNEKRWRDACQQLPRWIYVK 147

Query: 151 GKVLPGLVKRRDAEVKLLL 169
           G   PGL KRR  E+   L
Sbjct: 148 GVFNPGLKKRRAREMAWCL 166


>gi|167588936|ref|ZP_02381324.1| glycoside hydrolase, family 24 [Burkholderia ubonensis Bu]
          Length = 133

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/137 (33%), Positives = 60/137 (43%), Gaps = 29/137 (21%)

Query: 57  IGYGHTGSD---VTEGMTITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENRLVAV 110
           +G+  TG D   +  G T ++      L   + DA KS+  L+         S    VA 
Sbjct: 1   MGHARTGPDGKPLKLGQTYSDDVCSYLLGKDINDAEKSVRRLVRVP-----LSPGEQVAY 55

Query: 111 ADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG------------------GK 152
            DFVFN G  N+  ST  ++V+A D   A  E  KWT A                    K
Sbjct: 56  TDFVFNAGAANFASSTLLKKVNAGDRVGACRELPKWTCAAVAKGKGDASGMCATKDRTKK 115

Query: 153 VLPGLVKRRDAEVKLLL 169
            LPGLVKRR AE+K+ L
Sbjct: 116 QLPGLVKRRAAEMKVCL 132


>gi|168820658|ref|ZP_02832658.1| lysozyme [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205342571|gb|EDZ29335.1| lysozyme [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
          Length = 179

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L+E EG  L A RD  GG W++  G T   G  V +G  +T+ + + +   +
Sbjct: 25  APQLLDQFLQEREGNTLVAVRD-NGGVWSVCRGVTRIDGKPVVKGQRLTQSQCDHYNAIE 83

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF ++++A D + A  E 
Sbjct: 84  RDKALAWV--NKHVHIPLTEPQKAGIASFCPYNIGPGKCFPSTFYRKLNAGDRKGACAEI 141

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           ++W   GGK          G V RRD E  L
Sbjct: 142 RRWVYDGGKDCHNRENQCYGQVIRRDQESAL 172


>gi|291285778|ref|YP_003502596.1| phage lysozyme [Escherichia coli O55:H7 str. CB9615]
 gi|331666065|ref|ZP_08366959.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA143]
 gi|290765651|gb|ADD59612.1| phage lysozyme [Escherichia coli O55:H7 str. CB9615]
 gi|331057116|gb|EGI29110.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA143]
          Length = 177

 Score = 56.6 bits (135), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +T+++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLTKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGMASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K  G+          G V RRD E  L
Sbjct: 140 RWWIKDRGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter
          asiaticus str. psy62]
 gi|254040734|gb|ACT57530.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter
          asiaticus str. psy62]
          Length = 43

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 6/48 (12%)

Query: 17 MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS 64
          MNG  K     + NALI++ K +EGL+LTAYRD  GG WTIGYGH+GS
Sbjct: 1  MNGSSK-----ILNALIEITKRYEGLKLTAYRDP-GGTWTIGYGHSGS 42


>gi|262043391|ref|ZP_06016517.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|259039272|gb|EEW40417.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
          Length = 178

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 66/133 (49%), Gaps = 17/133 (12%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDA 85
           P  + + L E EG  LTAY+D G G WTI  G T   G  V +GM +T+ +       + 
Sbjct: 22  PVLMDQFLTEKEGSSLTAYKD-GSGIWTICRGATRVDGKPVIQGMKLTQAKCGQVNAIER 80

Query: 86  SKSL-----NLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKA 139
            K+L     N+ +  +P  K       V +A F  +N+G G    STF ++++A D + A
Sbjct: 81  DKALAWVEKNVHVPLTPPQK-------VGIASFCPYNIGPGKCLPSTFYRKLNAGDRKGA 133

Query: 140 AEECKKWTKAGGK 152
             E ++W   GG+
Sbjct: 134 CAEIRRWVFDGGR 146


>gi|322835211|ref|YP_004215237.1| Lysozyme [Rahnella sp. Y9602]
 gi|321170412|gb|ADW76110.1| Lysozyme [Rahnella sp. Y9602]
          Length = 179

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 71/147 (48%), Gaps = 14/147 (9%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKS 88
           L + L E EG RLTAY+D G G WTI  G T  D   V +GM +T  +       ++ K+
Sbjct: 29  LGQFLDEKEGNRLTAYQD-GVGVWTICRGATRVDGRLVYKGMKLTAAKCAQVNKLESDKA 87

Query: 89  LNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           +  +          ++ ++  +A F  +N+G      STF ++++  D   A  E K+W 
Sbjct: 88  IAWV--KGNVTVPLTQPQIAGIASFCPYNIGPAKCFTSTFYRKLNTGDKRGACSEIKRWV 145

Query: 148 KAGGKVLP-------GLVKRRDAEVKL 167
           + GGK          G V+RRD E +L
Sbjct: 146 RDGGKDCNIRANNCFGQVQRRDQESEL 172


>gi|161504543|ref|YP_001571655.1| hypothetical protein SARI_02656 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160865890|gb|ABX22513.1| hypothetical protein SARI_02656 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 146

 Score = 56.2 bits (134), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/146 (33%), Positives = 73/146 (50%), Gaps = 18/146 (12%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG----SDVTEGMTITEKEAEDFLLKDASKS 88
           I  LK  EG RL AY D   G  TIG GHTG    + V  GM IT +++ + L +D    
Sbjct: 9   ITRLKREEGERLKAYPD-SRGIPTIGVGHTGKVDGNPVVSGMIITAEKSSELLKED---- 63

Query: 89  LNLLLESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
              LL    A+ S      ++N+  A+   +FN+G   +  ST  ++++ ++++ AA+  
Sbjct: 64  ---LLWVEDAISSLVRVPLNQNQYDALCSLIFNIGKSAFAGSTVLRQLNLKNYQAAADAF 120

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLL 169
             W KA GK    L+ RR  E  L L
Sbjct: 121 LLWKKA-GKDPDILLPRRRRERALFL 145


>gi|290473361|ref|YP_003466227.1| putative Rhs accessory genetic element [Xenorhabdus bovienii SS-2004]
 gi|289172660|emb|CBJ79429.1| Putative Rhs accessory genetic element (modular protein) [Xenorhabdus
            bovienii SS-2004]
          Length = 1023

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 48/155 (30%), Positives = 73/155 (47%), Gaps = 22/155 (14%)

Query: 33   IKMLKEFEGLRLTAYRDIGGGA---WT----IGYGHTGSDV---TEGMTITEKEAEDFLL 82
            + +LK  E LRL  Y D  G     WT    IGYG         T    ITE EAE+   
Sbjct: 868  LDLLKGIESLRLKPYDDQTGKTVTKWTKGATIGYGKLIEKKDWDTYKDGITEDEAEELFK 927

Query: 83   KDAS---KSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ----D 135
            K  +   K++N         K  ++N+  A+  F +N+G   +N S+  + V+ +    D
Sbjct: 928  KTLAPFEKTVN-----DGITKEINQNQFDALTMFAYNIGAKGFNDSSVLKLVNDENAKTD 982

Query: 136  WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
            ++   +  K W K+ GKV  G++ RR AE+K+  E
Sbjct: 983  YDTLDDAWKAWNKSQGKVNQGVINRRAAELKIYNE 1017


>gi|99081146|ref|YP_613300.1| glycoside hydrolase family protein [Ruegeria sp. TM1040]
 gi|99037426|gb|ABF64038.1| phage related lysozyme [Ruegeria sp. TM1040]
          Length = 136

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/138 (32%), Positives = 72/138 (52%), Gaps = 8/138 (5%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL--L 93
           + ++EG+RL AYRDI G   TI +G T   V  G T T  E  D L KD     + +   
Sbjct: 1   MAKWEGVRLEAYRDIVG-VPTICFGDT-HGVQIGDTATMAECVDRLEKDVRAFYSEIRPC 58

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
            ++P + +  +  ++ +A   +N+G G   +ST  +  +A     A +E ++W  AGGK 
Sbjct: 59  MTNPNIPAGVQASMLELA---YNVGSGPVCRSTMMRLANAGKHRAACDELRRWVIAGGKR 115

Query: 154 LPGLVKRR-DAEVKLLLE 170
           + GL  RR D++  L L+
Sbjct: 116 VRGLANRRADSKRTLCLK 133


>gi|331677163|ref|ZP_08377859.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H591]
 gi|331075852|gb|EGI47150.1| lysozyme (Lysis protein) (Muramidase) (Endolysin) [Escherichia coli
           H591]
          Length = 149

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 51/94 (54%), Gaps = 5/94 (5%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKTLLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRV 131
           +K    E    A+  FV+N+G GN+  ST  +++
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNFRTSTLLRKI 123


>gi|110804273|ref|YP_687793.1| putative lysozyme [Shigella flexneri 5 str. 8401]
 gi|110806578|ref|YP_690098.1| putative lysozyme [Shigella flexneri 5 str. 8401]
 gi|110613821|gb|ABF02488.1| putative lysozyme [Shigella flexneri 5 str. 8401]
 gi|110616126|gb|ABF04793.1| putative lysozyme [Shigella flexneri 5 str. 8401]
          Length = 177

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLNEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K  G+          G V RRD E  L
Sbjct: 140 RWWIKDVGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|30062230|ref|NP_836401.1| putative endolysin R of prophage CP-933V [Shigella flexneri 2a str.
           2457T]
 gi|188491716|ref|ZP_02998986.1| phage lysozyme [Escherichia coli 53638]
 gi|30040475|gb|AAP16207.1| putative endolysin R of prophage CP-933V [Shigella flexneri 2a str.
           2457T]
 gi|188486915|gb|EDU62018.1| phage lysozyme [Escherichia coli 53638]
 gi|281600073|gb|ADA73057.1| Lysozyme [Shigella flexneri 2002017]
 gi|323172025|gb|EFZ57667.1| phage lysozyme family protein [Escherichia coli LT-68]
 gi|332760152|gb|EGJ90449.1| phage lysozyme family protein [Shigella flexneri 4343-70]
 gi|332761260|gb|EGJ91546.1| phage lysozyme family protein [Shigella flexneri 2747-71]
 gi|332763418|gb|EGJ93658.1| phage lysozyme family protein [Shigella flexneri K-671]
 gi|332768307|gb|EGJ98492.1| phage lysozyme family protein [Shigella flexneri 2930-71]
 gi|333007259|gb|EGK26743.1| phage lysozyme family protein [Shigella flexneri K-218]
 gi|333021240|gb|EGK40494.1| phage lysozyme family protein [Shigella flexneri K-304]
          Length = 177

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     +
Sbjct: 23  APQILDQFLNEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVIPGMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K  G+          G V RRD E  L
Sbjct: 140 RWWIKDVGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|319941529|ref|ZP_08015856.1| hypothetical protein HMPREF9464_01075 [Sutterella wadsworthensis
           3_1_45B]
 gi|319805003|gb|EFW01842.1| hypothetical protein HMPREF9464_01075 [Sutterella wadsworthensis
           3_1_45B]
          Length = 145

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 49/154 (31%), Positives = 74/154 (48%), Gaps = 14/154 (9%)

Query: 17  MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE 76
           MN D    ++ +P      +K  E LRL AY+    G WTIG+GHTG  V E  T + ++
Sbjct: 1   MNFDSYSYELAMP-----FVKAEETLRLKAYK-CPKGVWTIGWGHTGG-VKEEDTCSREQ 53

Query: 77  AEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFK--QRVDAQ 134
           AE ++  D   +   L +        S N+ +A+    +N+G     +   K  + ++A 
Sbjct: 54  AEAWIRSDLQSAQTGLAKYINV--PVSANQFIALLSLAYNMGAEGVVQKCPKMLRALNAG 111

Query: 135 DWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           D+E AA E    T  G   L GLV RR  E +L+
Sbjct: 112 DYETAANEFLDVTNGG---LAGLVARRRREAELM 142


>gi|320648028|gb|EFX16713.1| lysozyme-like protein [Escherichia coli O157:H- str. H 2687]
          Length = 105

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (54%), Gaps = 4/102 (3%)

Query: 69  GMTITEKEAEDFLLKDASKSLNLLLESSPALK-STSENRLVAVADFVFNLGIGNYNKSTF 127
           G T TE E +  L KD +    +  + +P +     E    A+  FV+N+G GN+  ST 
Sbjct: 3   GKTYTEAECKALLNKDLA---TVARQINPYINVDIPETTRGALYSFVYNVGAGNFRTSTL 59

Query: 128 KQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            ++++  D + A ++ ++WT AGGK   GL+ RR+ E ++ L
Sbjct: 60  LRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCL 101


>gi|57504932|ref|ZP_00370885.1| Phage lysozyme, putative [Campylobacter coli RM2228]
 gi|57019268|gb|EAL55971.1| Phage lysozyme, putative [Campylobacter coli RM2228]
          Length = 644

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 53/178 (29%), Positives = 84/178 (47%), Gaps = 20/178 (11%)

Query: 10  FVKRMIGMNGDDKHN---KIP-VPNALIKMLKEFEGLRLTAYRDIGG--------GAWTI 57
           +V + + +NG  ++N   KI  + N    +LK  E LRL  Y D  G        GA TI
Sbjct: 464 YVCKFVVVNGVSENNAQEKITHLSNDGQNLLKNIEKLRLKPYNDQNGKEITSYVKGA-TI 522

Query: 58  GYGHTGSDVTEGM---TITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFV 114
           GYGH        +    IT +EA+     D     N +  S  +  S ++N   A+    
Sbjct: 523 GYGHLIGQNEWDLYKNGITLQEADKLFKSDLLPFENAVKNSINS--SLAQNEFDALVILC 580

Query: 115 FNLGIGNYNKSTFKQRVDAQD--WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           FN+GI N+  S+  + ++ +   ++   E    W K+  KV+ GL+ RR+AE KL ++
Sbjct: 581 FNIGIDNFKNSSVAKIINGEKTGYKTLKEAWMAWNKSQNKVMQGLINRRNAEYKLYIQ 638


>gi|37527288|ref|NP_930632.1| hypothetical protein plu3414 [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36786722|emb|CAE15788.1| unnamed protein product [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 178

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 17/150 (11%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKS 88
           L + L E EG RL+AY+D  GG WTI  G T   G+   +GM +   +  D   ++A ++
Sbjct: 25  LSQFLDEKEGNRLSAYQD-AGGVWTICRGVTRIDGTPARQGMRLMPNQCRDLNAQEAKQA 83

Query: 89  LNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW- 146
           +  +  +       +E ++  +A F  +N+G      STF ++++A D + A  E K+W 
Sbjct: 84  IAWVKRN--VRVPLTEPQIAGIASFCPYNIGPSKCFSSTFYRKLNAGDKKGACAEIKRWV 141

Query: 147 ---------TKAGGKVLPGLVKRRDAEVKL 167
                    TK       G V+RR  E +L
Sbjct: 142 FDNGRDCRQTKGQANGCYGQVERRAQESEL 171


>gi|168467231|ref|ZP_02701073.1| lysozyme [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
 gi|195630372|gb|EDX48998.1| lysozyme [Salmonella enterica subsp. enterica serovar Newport str.
           SL317]
 gi|267993052|gb|ACY87937.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 14028S]
          Length = 179

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/150 (30%), Positives = 72/150 (48%), Gaps = 14/150 (9%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDA 85
           P  L + L+E EG  L A RD  GG W++  G T   G  V +G  +T+ + + +   + 
Sbjct: 26  PQLLDQFLQEREGNMLVAVRD-NGGVWSVCRGVTRIDGKPVVKGQRLTQSQCDHYNAIER 84

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            K+L  + ++     +  +   V +A F  +N+G G    STF ++++A D + A  E +
Sbjct: 85  DKALAWVNKNIHVPLTGPQK--VGIASFCPYNIGPGKCLPSTFYRKLNAGDRKGACAEIR 142

Query: 145 KWTKAGGK-------VLPGLVKRRDAEVKL 167
           +W   GGK          G V RRD E  L
Sbjct: 143 RWVYDGGKDCHNRENQCYGQVIRRDQESAL 172


>gi|168233655|ref|ZP_02658713.1| lysozyme [Salmonella enterica subsp. enterica serovar Kentucky str.
           CDC 191]
 gi|194471048|ref|ZP_03077032.1| lysozyme [Salmonella enterica subsp. enterica serovar Kentucky str.
           CVM29188]
 gi|194457412|gb|EDX46251.1| lysozyme [Salmonella enterica subsp. enterica serovar Kentucky str.
           CVM29188]
 gi|205332301|gb|EDZ19065.1| lysozyme [Salmonella enterica subsp. enterica serovar Kentucky str.
           CDC 191]
          Length = 179

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 45/151 (29%), Positives = 72/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L+E EG  L A RD  GG W++  G T   G  V +G  +T+ + + +   +
Sbjct: 25  APQLLDQFLQEREGNTLVAVRD-NGGVWSVCRGVTRIDGKLVVKGQRLTQSQCDHYNAIE 83

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L+ +  +       +E +   +A F  +N+G G    STF ++++A D + A  E 
Sbjct: 84  RDKALSWV--NKHVHIPLTEPQKTGIASFCPYNIGPGKCFPSTFYRKLNAGDRKGACAEI 141

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           ++W   GGK          G V RRD E  L
Sbjct: 142 RRWIYDGGKDCHNRENQCYGQVIRRDQESAL 172


>gi|308187208|ref|YP_003931339.1| endolysin [Pantoea vagans C9-1]
 gi|308057718|gb|ADO09890.1| putative endolysin [Pantoea vagans C9-1]
          Length = 179

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  + +  KE EG  LTAY D  GG WTI  G T   G  V +GM +T  +    +L  
Sbjct: 25  APTLMEQFQKEKEGSSLTAYAD-AGGVWTICGGVTQIKGKSVLQGMELTADQCR--ILDR 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           A ++  L   +       ++ + V +A F  +N+G G    S+F ++++A +   A  E 
Sbjct: 82  AEQAKALAWVNRHVTVPLTDPQRVGIASFCPWNIGPGKCLPSSFYRKLNAGNRRGACAEM 141

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           K+W   GGK          G V RRD E +L
Sbjct: 142 KRWIFDGGKDCRIRSNHCFGQVVRRDQESEL 172


>gi|83944489|ref|ZP_00956942.1| phage-related endolysin [Sulfitobacter sp. EE-36]
 gi|83844691|gb|EAP82575.1| phage-related endolysin [Sulfitobacter sp. EE-36]
          Length = 299

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/140 (27%), Positives = 63/140 (45%), Gaps = 5/140 (3%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD---ASKSL 89
           +  + ++EGLRL AYRDI G  WT+ YG T   V  G   T+ + +  L ++       L
Sbjct: 157 VPYVGKWEGLRLAAYRDIVG-VWTVCYGET-KGVKPGDRYTKAQCDAMLARELISYRTRL 214

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           +              +R  A     +N+G+G    ST  +R++  D     +    W +A
Sbjct: 215 HRYFTRETLAGRLPVHRDTAYTSLAYNVGVGGAGGSTAVRRLNGGDIVGGCKAITWWDRA 274

Query: 150 GGKVLPGLVKRRDAEVKLLL 169
           G +V+ GL  RR  +  L +
Sbjct: 275 GNRVVRGLTLRRGEDYALCM 294


>gi|323153928|gb|EFZ40152.1| phage lysozyme family protein [Escherichia coli EPECa14]
          Length = 159

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 64/129 (49%), Gaps = 7/129 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRKGACEAI 139

Query: 144 KKWTKAGGK 152
           + W K GG+
Sbjct: 140 RWWIKDGGR 148


>gi|290475796|ref|YP_003468687.1| putative lysozyme [Xenorhabdus bovienii SS-2004]
 gi|289175120|emb|CBJ81923.1| putative lysozyme (Lysis protein) (Muramidase) (Endolysin) (P13)
          (fragment) [Xenorhabdus bovienii SS-2004]
          Length = 79

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 3/59 (5%)

Query: 28 VPNALIKMLKEFEGLRLTAYRD--IGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
          + N  ++ ++++EGL+L AY D   GG  WTIGYGHT  DV  G  ITE++AE FL  D
Sbjct: 3  ISNKGLEFIQQWEGLKLKAYPDPATGGIPWTIGYGHT-KDVKPGQVITEQQAEAFLHDD 60


>gi|291618704|ref|YP_003521446.1| NucD2 [Pantoea ananatis LMG 20103]
 gi|291153734|gb|ADD78318.1| NucD2 [Pantoea ananatis LMG 20103]
          Length = 171

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 60/138 (43%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           +K++ ++EG RL  Y     G WT G G+T   V  G +ITE++A    + +  +    L
Sbjct: 34  LKLIADYEGCRLKPYL-CNAGVWTDGIGNT-RGVVPGKSITERQAAGTFITNVLRVEAAL 91

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
                   +  +    A+    FN+G GN   ST  + + A  W  A  +  +W    G 
Sbjct: 92  ARCVAV--TMPQQVYDALVSLAFNVGTGNVCASTMVKLIRASRWRDACYQLPRWVYVKGV 149

Query: 153 VLPGLVKRRDAEVKLLLE 170
              GL  RR  E+   L+
Sbjct: 150 FNQGLDNRRGRELGWCLK 167


>gi|163800604|ref|ZP_02194505.1| putative phage lysozyme [Vibrio sp. AND4]
 gi|159176047|gb|EDP60841.1| putative phage lysozyme [Vibrio sp. AND4]
          Length = 175

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/144 (29%), Positives = 67/144 (46%), Gaps = 17/144 (11%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE-AEDFL--LKDASKSLNLL 92
           +   EG R  AY+      WT G GHT + V +G  + E + A +F+  ++ A +++N  
Sbjct: 36  IANLEGCRTKAYQ-CSANVWTNGLGHT-TGVKQGDVVDEVQIAHNFIADVQTAEQAVNRY 93

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           L +       ++ +   +  FVFNLG GN  +ST  +  +     KA  E  +W    GK
Sbjct: 94  LTAE-----VTQAQFDVLVSFVFNLGAGNLKRSTMLKLFNQNKPLKACRELSRWVYVNGK 148

Query: 153 -------VLPGLVKRRDAEVKLLL 169
                     G+VKRR  E ++ L
Sbjct: 149 NCNDPDSQCSGVVKRRKIERQVCL 172


>gi|260844469|ref|YP_003222247.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
 gi|257759616|dbj|BAI31113.1| putative endolysin [Escherichia coli O103:H2 str. 12009]
          Length = 177

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 68/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L     +       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWGERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRRGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 170


>gi|258544084|ref|ZP_05704318.1| phage lysozyme [Cardiobacterium hominis ATCC 15826]
 gi|258520712|gb|EEV89571.1| phage lysozyme [Cardiobacterium hominis ATCC 15826]
          Length = 156

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 68/146 (46%), Gaps = 15/146 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           IK L   EG R   Y D  G   TIG GH  T S++T G    + EA  +    ++  + 
Sbjct: 6   IKSLLAREGSRSKMYYDAAGLP-TIGVGHLLTRSEMTSGKIWIDGEAIHWRDGLSNDQIT 64

Query: 91  LLLESSPALKSTSENRLVAVA----------DFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
            L +    L   + + LV VA           FVFN+GI  + KST  ++++A D+    
Sbjct: 65  RLFDRDNDLAEAAVSDLVKVALADHQFDVLVSFVFNVGINAFRKSTLLRKLNAGDYAAVP 124

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVK 166
           E+  +W  A GK  P L  RR+ E +
Sbjct: 125 EQLHRWIYAAGK--PVLRLRREEEAR 148


>gi|154277428|ref|XP_001539555.1| predicted protein [Ajellomyces capsulatus NAm1]
 gi|150413140|gb|EDN08523.1| predicted protein [Ajellomyces capsulatus NAm1]
          Length = 247

 Score = 55.5 bits (132), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 70/147 (47%), Gaps = 10/147 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG-----MTITEKEAEDFLL 82
           V  A + ++KEFEG       D   G  T+GYGH     T+G       +++  A   L 
Sbjct: 33  VNKATLALIKEFEGFVPRPEPD-PIGLPTVGYGHLCK--TKGCKEVKFPLSKGTATTLLK 89

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA-A 140
           KD       +  S+      + N+  A+  + +N+G      S+   R++  +D  +  A
Sbjct: 90  KDLRSFQQAITLSTKTAVKLNANQYGALVSWAYNVGPNAARSSSLISRLNQGEDPNQVIA 149

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +E  KW  AGGKV  GLV+RR AEVKL
Sbjct: 150 QELPKWRLAGGKVFEGLVRRRKAEVKL 176


>gi|327194293|gb|EGE61154.1| putative phage-related lysozyme protein [Rhizobium etli CNPAF512]
          Length = 154

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 63/134 (47%), Gaps = 5/134 (3%)

Query: 39  FEGLRLTAYRDIG--GGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESS 96
           FEGLR  AY D    G  WTI YG T + V  G   T ++ +  L  +  ++    +ES 
Sbjct: 22  FEGLRQNAYPDPATKGPPWTICYGST-NGVKPGDRRTVEQCKALLALEL-QTYAGGIESC 79

Query: 97  PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPG 156
            ++    + R VA+  F +N+G+     S+  + ++     +  E   KW +A G   PG
Sbjct: 80  VSVP-LPDARFVALTSFAYNVGVKAACGSSAVRLINQGRTAEGCEALLKWNRAAGITFPG 138

Query: 157 LVKRRDAEVKLLLE 170
           L +RR  E    LE
Sbjct: 139 LTRRRQKERAFCLE 152


>gi|169635864|dbj|BAG12399.1| BacL1 [Enterococcus faecalis]
          Length = 595

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 11/144 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASK 87
           I + K++    L A   + G  G  +IGYGH  ++   +  GM ITE +A   +L+D   
Sbjct: 8   IDLCKKYSNFSLKA---VAGRNGILSIGYGHFTNEKHPIKPGMVITESQATQ-ILRDDLN 63

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K + 
Sbjct: 64  EHAALISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDIMHFTNNKEFNSAAREMKLYV 122

Query: 148 KAGGKV-LPGLVKRRDAEVKLLLE 170
              G + LP LV+RR+AE  L LE
Sbjct: 123 YDIGSIKLPKLVERRNAETALYLE 146


>gi|256959384|ref|ZP_05563555.1| predicted protein [Enterococcus faecalis DS5]
 gi|256949880|gb|EEU66512.1| predicted protein [Enterococcus faecalis DS5]
          Length = 595

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 11/144 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASK 87
           I + K++    L A   + G  G  +IGYGH  ++   +  GM ITE +A   +L+D   
Sbjct: 8   IDLCKKYSNFSLKA---VAGRNGILSIGYGHFTNEKHPIKPGMVITESQATQ-ILRDDLN 63

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K + 
Sbjct: 64  EHAALISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDIMHFTNNKEFNSAAREMKLYV 122

Query: 148 KAGGKV-LPGLVKRRDAEVKLLLE 170
              G + LP LV+RR+AE  L LE
Sbjct: 123 YDIGSIKLPKLVERRNAETALYLE 146


>gi|168214556|ref|ZP_02640181.1| phage minor structural protein [Clostridium perfringens CPE str.
           F4969]
 gi|170713949|gb|EDT26131.1| phage minor structural protein [Clostridium perfringens CPE str.
           F4969]
          Length = 992

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKDASKSLN 90
           +I  +K  EG     Y D   G  T+GYG TG+++    + ++E  A  +L+ + ++   
Sbjct: 811 IIYYVKGIEGYAPYHYYD-SVGVKTLGYGMTGNELNGVSVPLSETSATHYLVNNFNRDYY 869

Query: 91  ---LLLESSPALKSTSENRLVAVADFVFNLGI-GNYNKSTFKQRVDAQDWEKAAEECKKW 146
              L +  S  + +  +  + A A F +N G+ G  N    K+ V+ +  E    E  KW
Sbjct: 870 IPVLNIVKSKGVSNPLQREIDAFASFAYNCGVEGFRNSQLLKRYVNGERGENIHNEFMKW 929

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AG  V  GL++RR+ E K+ 
Sbjct: 930 IHAGSSVSNGLIRRREEEWKIF 951


>gi|331672674|ref|ZP_08373463.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA280]
 gi|331070317|gb|EGI41683.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA280]
          Length = 176

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/150 (32%), Positives = 69/150 (46%), Gaps = 14/150 (9%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDA 85
           P  L + L E EG  +TAYRD G G WTI  G T   G  V  GM +T+++       + 
Sbjct: 24  PQILDQFLDEKEGNHITAYRD-GSGIWTICRGATMVDGKPVIPGMKLTKEKCAQVNAIER 82

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            K+L  +  +       +E +   +A F  +N+G      STF +R++A D + A E  +
Sbjct: 83  DKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPDKCFPSTFYKRLNAGDRKGACEAIR 140

Query: 145 KWTKAGGKVLP-------GLVKRRDAEVKL 167
            W K  G+          G V RRD E  L
Sbjct: 141 WWIKDRGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|217388393|ref|YP_002333423.1| bacteriocin [Enterococcus faecalis]
 gi|216409936|dbj|BAH02371.1| bacteriocin [Enterococcus faecalis]
          Length = 595

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 11/144 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASK 87
           I + K++    L A   + G  G  +IGYGH  ++   +  GM ITE +A   +L+D   
Sbjct: 8   IDLCKKYSNFSLKA---VAGRNGILSIGYGHFTNEKHPIKPGMVITESQATQ-ILRDDLN 63

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K + 
Sbjct: 64  EHAALISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDIMHFTNNKEFNSAAREMKLYV 122

Query: 148 KAGGKV-LPGLVKRRDAEVKLLLE 170
              G + LP LV+RR+AE  L LE
Sbjct: 123 YDIGSIKLPKLVERRNAETALYLE 146


>gi|325096625|gb|EGC49935.1| conserved hypothetical protein [Ajellomyces capsulatus H88]
          Length = 349

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 69/147 (46%), Gaps = 10/147 (6%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEG-----MTITEKEAEDFLL 82
           V  A + ++KEFEG       D   G  T+GYGH     T+G       +++  A   L 
Sbjct: 33  VNKATLALIKEFEGFVPRPEPD-PIGLPTVGYGHLCK--TKGCKEVKFPLSKGTATTLLK 89

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA-A 140
           KD       +  S+      + N+  A+  + +N+G      S+   R++  +D  K  A
Sbjct: 90  KDLRSFQQAITLSTKTAVKLNANQYGALVSWAYNVGPNAARSSSLISRLNKGEDPNKVIA 149

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +E  KW  A GKV  GLV+RR AEVKL
Sbjct: 150 QELPKWRLASGKVFKGLVRRRKAEVKL 176


>gi|255976453|ref|ZP_05427039.1| predicted protein [Enterococcus faecalis T2]
 gi|255969325|gb|EET99947.1| predicted protein [Enterococcus faecalis T2]
          Length = 598

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 11/144 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASK 87
           I + K++    L A   + G  G  +IGYGH  ++   +  GM ITE +A   +L+D   
Sbjct: 11  IDLCKKYSNFSLKA---VAGRNGILSIGYGHFTNEKHPIKPGMVITESQATQ-ILRDDLN 66

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K + 
Sbjct: 67  EHAALISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDIMHFTNNKEFNSAAREMKLYV 125

Query: 148 KAGGKV-LPGLVKRRDAEVKLLLE 170
              G + LP LV+RR+AE  L LE
Sbjct: 126 YDIGSIKLPKLVERRNAETALYLE 149


>gi|296282635|ref|ZP_06860633.1| hypothetical protein CbatJ_03385 [Citromicrobium bathyomarinum
           JL354]
          Length = 253

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 72/144 (50%), Gaps = 9/144 (6%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           K L + EG+RLT YRD+ G   T+G GH       +  G  IT ++A  FL +D   +  
Sbjct: 105 KALAQEEGMRLTVYRDVAGYP-TVGIGHLVRPEDGLKVGDRITREQAMAFLAQDLKTAEQ 163

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST---FKQRVDAQDWEKAAEECKKWT 147
            +++    LK   ++   A+ D  +N+G G  ++S      + +   D+   AEE   + 
Sbjct: 164 AVVDVVGDLK-LYQHEFDALVDLAYNVGEGTLSESESPDLNRAIALADYTGIAEEL-DYR 221

Query: 148 KAGGKVLPGLVKRRDAEVKLLLES 171
            AGG++  GLV R +   ++ LE+
Sbjct: 222 FAGGRIAGGLVHRSERRAQIFLEA 245


>gi|191169223|ref|ZP_03030977.1| phage lysozyme [Escherichia coli B7A]
 gi|331683059|ref|ZP_08383660.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H299]
 gi|190900734|gb|EDV60529.1| phage lysozyme [Escherichia coli B7A]
 gi|315293037|gb|EFU52389.1| phage lysozyme [Escherichia coli MS 153-1]
 gi|331079274|gb|EGI50471.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H299]
          Length = 177

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G +V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKNVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|167553966|ref|ZP_02347708.1| lysozyme [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205321711|gb|EDZ09550.1| lysozyme [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
          Length = 179

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 44/151 (29%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L+E EG  L A RD  GG W++  G T   G  V +G  +T+ + + +   +
Sbjct: 25  APQLLDQFLQEREGNTLVAVRD-NGGVWSVCRGVTRIDGKPVVKGQRLTQSQCDHYNAIE 83

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF ++++  D + A  E 
Sbjct: 84  RDKALAWVNKN--VHIPLTEPQKTGIASFCPYNIGPGKCFPSTFYRKLNEGDRKGACAEI 141

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           ++W   GGK          G V RRD E  L
Sbjct: 142 RRWVYDGGKDCHNRKNQCYGQVIRRDQEAAL 172


>gi|307289448|ref|ZP_07569400.1| phage lysozyme [Enterococcus faecalis TX0109]
 gi|306499598|gb|EFM68963.1| phage lysozyme [Enterococcus faecalis TX0109]
 gi|315026343|gb|EFT38275.1| phage lysozyme [Enterococcus faecalis TX2137]
 gi|315146410|gb|EFT90426.1| phage lysozyme [Enterococcus faecalis TX4244]
          Length = 611

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 11/144 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASK 87
           I + K++    L A   + G  G  +IGYGH  ++   +  GM ITE +A   +L+D   
Sbjct: 24  IDLCKKYSNFSLKA---VAGRNGILSIGYGHFTNEKHPIKPGMVITESQATQ-ILRDDLN 79

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K + 
Sbjct: 80  EHAALISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDIMHFTNNKEFNSAAREMKLYV 138

Query: 148 KAGGKV-LPGLVKRRDAEVKLLLE 170
              G + LP LV+RR+AE  L LE
Sbjct: 139 YDIGSIKLPKLVERRNAETALYLE 162


>gi|219681296|ref|YP_002456060.1| endolysin [Erwinia phage phiEa21-4]
 gi|327198424|ref|YP_004327012.1| lysozyme [Erwinia phage phiEa104]
 gi|199580563|gb|ACH88950.1| endolysin [Erwinia phage phiEa21-4]
 gi|311875120|emb|CBX44380.1| lysozyme [Erwinia phage phiEa104]
          Length = 157

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 74/148 (50%), Gaps = 13/148 (8%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFL---LKDASK 87
           + L+  EG    AY D+ G   TIG+G T      V  G T T + A+  L   L D   
Sbjct: 9   QALEVMEGFSAKAYLDVAG-VPTIGFGDTSVRARKVKMGDTTTLEAAKAELALDLHDFKS 67

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
            +   L  + A+K T++N+  A+  F +N+G+ N+  S+  +   A D+E AA+    W 
Sbjct: 68  GVEKYL--AKAVKGTTQNQFDALVIFAYNVGLTNFASSSVLRNHLAGDFEAAAKSFALWN 125

Query: 148 K---AGGKVLP-GLVKRRDAEVKLLLES 171
           K    G KV+  GLV RR  E+++ L S
Sbjct: 126 KITVKGKKVVSKGLVNRRAKEIEIYLHS 153


>gi|320659097|gb|EFX26702.1| putative endolysin [Escherichia coli O55:H7 str. USDA 5905]
          Length = 147

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 62/128 (48%), Gaps = 7/128 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVIPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G G    STF +R++A D   A E  
Sbjct: 82  RDKALAWVEKNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRINAGDRRGACEAI 139

Query: 144 KKWTKAGG 151
           + W K GG
Sbjct: 140 RWWIKDGG 147


>gi|260769176|ref|ZP_05878109.1| glycoside hydrolase family 24 [Vibrio furnissii CIP 102972]
 gi|260614514|gb|EEX39700.1| glycoside hydrolase family 24 [Vibrio furnissii CIP 102972]
          Length = 138

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           +++K+ EGLRL  YR       TIGYG    D      I+++EAE  L  D   ++    
Sbjct: 7   QLIKKHEGLRLKPYR-CSNQKLTIGYGRNLQD----NGISQQEAETLLQHDLDAAVKEA- 60

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA---QDWEKAAEEC--KKWTK 148
           E+ P   S +E R   + D +FNLG+  +    FK+ + A   Q W  AA E    +W +
Sbjct: 61  ETLPYFASLNEARQAVIVDMIFNLGLPRF--GMFKKMIAAIEQQLWHVAANEMLNSRWAR 118

Query: 149 AGGK 152
             GK
Sbjct: 119 QVGK 122


>gi|183599084|ref|ZP_02960577.1| hypothetical protein PROSTU_02536 [Providencia stuartii ATCC 25827]
 gi|188021307|gb|EDU59347.1| hypothetical protein PROSTU_02536 [Providencia stuartii ATCC 25827]
          Length = 178

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 69/152 (45%), Gaps = 17/152 (11%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKS 88
           L   L E EG  L AYRD GGG  TI  G T   G  V  G  ++  E +     +A K+
Sbjct: 25  LSGFLNEKEGNSLKAYRD-GGGVVTICRGVTRIGGKSVKMGTQLSPAECDRLNQIEADKA 83

Query: 89  LNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           +  +          +E ++  +A F  +N+G      STF ++++A D + A  E  KWT
Sbjct: 84  IAWVKRHVHV--PLTEPQIAGIASFCPYNIGPSKCFSSTFYRKLNAGDIKGACAELPKWT 141

Query: 148 KAGGKVLP----------GLVKRRDAEVKLLL 169
           + GGK             G V RRD E +LL 
Sbjct: 142 RDGGKDCRQTKGQPNGCYGQVIRRDQEAELLC 173


>gi|283835898|ref|ZP_06355639.1| phage lysozyme [Citrobacter youngae ATCC 29220]
 gi|291068069|gb|EFE06178.1| phage lysozyme [Citrobacter youngae ATCC 29220]
          Length = 116

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 31/96 (32%), Positives = 51/96 (53%), Gaps = 4/96 (4%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-TGSDVTEGMTITEKEAEDFLLKDASKSL 89
           A +  +++++GL L  Y+D   G W IGYGH   +D T    IT  +AE  LL D  +  
Sbjct: 11  ACVAFIQQWQGLSLEKYQD-KNGVWVIGYGHEITADETFDTPITAMQAESLLLADLKRCE 69

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKS 125
            L+ E  P LK   +    A+  ++F++GI  ++ +
Sbjct: 70  ALIHEKRPQLKDRFQQE--ALIAWIFSVGITRFSTT 103


>gi|251778086|ref|ZP_04821006.1| choline binding protein PcpA [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243082401|gb|EES48291.1| phage lysozyme [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 260

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/147 (27%), Positives = 67/147 (45%), Gaps = 5/147 (3%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V  A I  +K +EG     Y D+ G   T+GYG TG ++    +ITE +A   L    + 
Sbjct: 108 VSEACINFIKSWEGFFSKPYYDMVG-VLTLGYGMTGDEIKGLSSITESKASKMLKDLINN 166

Query: 88  SLNLLLESSPALKSTS--ENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ--DWEKAAEEC 143
               +++ S   K+ S  +N   A+  F +N G      ST  + +  +  D +      
Sbjct: 167 KYAKIIKKSLDDKNISLKQNEFDALVSFAYNCGTSGLLDSTLYKNICNRIIDKDTITSNF 226

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           + W+  GGK + GL +RR  E  + L+
Sbjct: 227 QAWSNGGGKRIEGLYRRRTKEAAMFLD 253


>gi|261225755|ref|ZP_05940036.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. FRIK2000]
 gi|261257930|ref|ZP_05950463.1| putative lysozyme R of prophage CP-933R [Escherichia coli O157:H7
           str. FRIK966]
          Length = 146

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 65/143 (45%), Gaps = 14/143 (9%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +  K+L  +  
Sbjct: 2   EKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDQVNAIERDKALEWVER 60

Query: 95  SSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
           +       +E +   +A F  +N+G G    STF +R++A D   A E  + W K GG+ 
Sbjct: 61  NIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYRRINAGDRRGACEAIRWWIKDGGRD 118

Query: 154 LP-------GLVKRRDAEVKLLL 169
                    G V RRD E  L  
Sbjct: 119 CRIRSNNCYGQVSRRDQESALAC 141


>gi|256963378|ref|ZP_05567549.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
 gi|256953874|gb|EEU70506.1| conserved hypothetical protein [Enterococcus faecalis HIP11704]
          Length = 390

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 72/144 (50%), Gaps = 11/144 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASK 87
           I + K++    L A   + G  G  +IGYGH  ++   +  GM ITE +A   +L+D   
Sbjct: 8   IDLCKKYSNFSLKA---VAGRNGILSIGYGHFTNEKHPIKPGMVITESQATQ-ILRDDLN 63

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
               L+    A+K+T +N+  A+  F  + G+G    S      + +++  AA E K + 
Sbjct: 64  EHAALISKLLAIKAT-QNQFDALVSFSHSKGLGFLPSSDIMHFTNNKEFNSAAREMKLYV 122

Query: 148 KAGGKV-LPGLVKRRDAEVKLLLE 170
              G + LP LV+RR+AE  L LE
Sbjct: 123 YDIGSIKLPKLVERRNAETALYLE 146


>gi|24372250|ref|NP_716292.1| lysozyme, putative [Shewanella oneidensis MR-1]
 gi|24346174|gb|AAN53737.1|AE015512_4 lysozyme, putative [Shewanella oneidensis MR-1]
          Length = 185

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 73/155 (47%), Gaps = 21/155 (13%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           ++  ++EG  LT Y D   G  T   GHT  D+  G T TE+E  +   KD +++   LL
Sbjct: 23  QLTDKWEGNSLTVYVD-AVGVLTACRGHTSKDLKLGQTFTEQECMEIFAKDIARADKQLL 81

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE----------- 142
           + +  ++ T ++   A   F+   G GN+  ST ++++ A D   A +E           
Sbjct: 82  QLTATVRLT-DSEHAAYLSFMHWAGYGNFASSTLRKKLLAGDRVGACKELTQACSTNQQT 140

Query: 143 ----CKKW---TKAGGKV-LPGLVKRRDAEVKLLL 169
               C  W   T+ G KV L GL+KRR  E  + L
Sbjct: 141 GERVCNGWTYGTRLGVKVRLNGLIKRRAEEQAICL 175


>gi|300938344|ref|ZP_07153098.1| phage lysozyme [Escherichia coli MS 21-1]
 gi|300456680|gb|EFK20173.1| phage lysozyme [Escherichia coli MS 21-1]
          Length = 177

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/151 (32%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L   +E +  +  T E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKAL-AWVERNIKVPMT-EPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|315181711|gb|ADT88624.1| lysozyme, hypothetical [Vibrio furnissii NCTC 11218]
          Length = 138

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 60/124 (48%), Gaps = 13/124 (10%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           +++K+ EGLRL  YR       TIGYG    D      I+++EAE  L  D   ++    
Sbjct: 7   QLIKKHEGLRLKPYR-CSNQKLTIGYGRNLQD----NGISQQEAETLLQHDLDAAVKEA- 60

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA---QDWEKAAEEC--KKWTK 148
           E+ P   S +E R   + D +FNLG+  +    FK+ + A   Q W  AA E    +W +
Sbjct: 61  ETLPYFASLNEARKAVIVDMIFNLGLPRF--GMFKKMIAAIEQQLWHVAANEMLNSRWAR 118

Query: 149 AGGK 152
             GK
Sbjct: 119 QVGK 122


>gi|283784797|ref|YP_003364662.1| phage lysozyme [Citrobacter rodentium ICC168]
 gi|282948251|emb|CBG87819.1| putative phage lysozyme [Citrobacter rodentium ICC168]
          Length = 179

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 66/132 (50%), Gaps = 13/132 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    A++D GGG WTI  G T  D   V +GM +T+ + +     +
Sbjct: 22  APVILDQFLNEKEGNSFPAHKD-GGGIWTICRGATMVDDKLVVQGMKLTQAKCDRVNAIE 80

Query: 85  ASKSL---NLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAA 140
             K+L   NL ++        +E +   +A F  +N+G G    STF +R++A D + A 
Sbjct: 81  RDKALAWVNLNIKVP-----LTEPQKAGIASFCPYNIGPGKCFPSTFFKRINAGDRKGAC 135

Query: 141 EECKKWTKAGGK 152
           E  + W K GG+
Sbjct: 136 EAIRWWIKDGGR 147


>gi|126207989|ref|YP_001053214.1| putative endolysin [Actinobacillus pleuropneumoniae L20]
 gi|126096781|gb|ABN73609.1| putative endolysin [Actinobacillus pleuropneumoniae serovar 5b str.
           L20]
          Length = 180

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 43/169 (25%), Positives = 76/169 (44%), Gaps = 15/169 (8%)

Query: 7   IISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT--GS 64
           +++ +  M+   GD+    +      ++++   EG R   Y+       T+G G T  G 
Sbjct: 18  VLTMIAIMVTNYGDEFRTSVEG----LEIIGNAEGCRREPYK-CPADVLTVGVGSTAAGG 72

Query: 65  DVTEGMTITEKEAEDFLLKD----ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
           ++ E   I   +      K+    A + +N L       K   ++   +V    FN+G G
Sbjct: 73  ELIEANKIYSDDEIARRWKNDVVIAERCVNRLANG----KQMPQSVFDSVVSITFNVGCG 128

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
             +KST  ++ +AQDW+    E  +W  +GG+ L GL+ RR+ E  L L
Sbjct: 129 ALSKSTLFRKANAQDWQGVCNELPRWVYSGGRKLKGLMLRREKEKALCL 177


>gi|123442124|ref|YP_001006106.1| bacteriophage lysozyme [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122089085|emb|CAL11915.1| bacteriophage lysozyme [Yersinia enterocolitica subsp.
           enterocolitica 8081]
          Length = 160

 Score = 54.7 bits (130), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 66/132 (50%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG +  AY D+     T+  GHTG D+      ++ E +  L +D +    ++     A
Sbjct: 31  LEGRKYVAYYDVVN-VLTVCDGHTGKDIIPSKKYSDAECDALLQQDLAPVQRIV---DAA 86

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K   S+ +  A+  F +N+G   + +ST  ++++  D + A +E ++W  A G+   GL
Sbjct: 87  VKIPLSQYQKAALYSFTYNVGRHAFIRSTLLKKLNTGDIKGACDELRRWIYADGQSWKGL 146

Query: 158 VKRRDAEVKLLL 169
             RR+ E +L L
Sbjct: 147 QNRREIERELCL 158


>gi|218688933|ref|YP_002397145.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
 gi|218426497|emb|CAR07325.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli ED1a]
          Length = 177

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 48/151 (31%), Positives = 70/151 (46%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++       +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAIMVDGKPVVPGMKLSKEKCAQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L   +E +  L  T E +   +A F  +N+G      STF ++++A D + A  E 
Sbjct: 82  RDKAL-AWVEKNIKLPLT-EPQKAGIASFCPYNIGPSKCFTSTFYRKLNAGDRKGACAEI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           ++W   GG+          G V RRD E  L
Sbjct: 140 RRWIYDGGRDCRNRSNNCYGQVSRRDQESAL 170


>gi|319428016|gb|ADV56090.1| glycoside hydrolase family 24 [Shewanella putrefaciens 200]
 gi|319428256|gb|ADV56330.1| glycoside hydrolase family 24 [Shewanella putrefaciens 200]
          Length = 190

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 72/152 (47%), Gaps = 23/152 (15%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE-SS 96
           ++EG  LT Y D   G  T   GHT  D+  G T TE++  +   KD +++   LL+ ++
Sbjct: 27  KWEGNSLTVYVD-AVGVLTACRGHTSKDLKLGQTFTEQQCMEIFAKDIARADKQLLQLTA 85

Query: 97  PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE-------------- 142
           P   + SE+   A   F+   G GN+  ST ++++ A D   A +E              
Sbjct: 86  PVRLTDSEH--AAYLSFMHWAGYGNFASSTLRKKLLAGDRVGACKELTQACSTNPQTGER 143

Query: 143 -CKKW---TKAGGKV-LPGLVKRRDAEVKLLL 169
            C  W   T+ G KV L GL+KRR  E  L L
Sbjct: 144 VCNGWTYGTRLGVKVRLNGLIKRRAEEQALCL 175


>gi|238790572|ref|ZP_04634339.1| Lysozyme [Yersinia frederiksenii ATCC 33641]
 gi|238721369|gb|EEQ13042.1| Lysozyme [Yersinia frederiksenii ATCC 33641]
          Length = 176

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 73/152 (48%), Gaps = 14/152 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P    L + L E EG RL AY D G   WTI  G T   G  V +GM +T ++       
Sbjct: 21  PASIILSQFLDEKEGNRLVAYPD-GKNIWTICRGTTRVDGKPVVKGMKLTAEKCAVVNKL 79

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           +A K+++ + ++       +E ++  +A F  +N+G      STF ++++A D + A  E
Sbjct: 80  EADKAISWVKQNVHV--PLTEPQIAGIASFCPYNIGPSKCFTSTFYRKLNAGDRKGACTE 137

Query: 143 CKKWTKAGGK-------VLPGLVKRRDAEVKL 167
            K+W   GGK          G ++RR  E +L
Sbjct: 138 IKRWIYDGGKDCNIRSNNCYGQIERRTQESEL 169


>gi|301025112|ref|ZP_07188706.1| phage lysozyme [Escherichia coli MS 69-1]
 gi|300396221|gb|EFJ79759.1| phage lysozyme [Escherichia coli MS 69-1]
          Length = 177

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRNCRVRSNNCYGQVIRRDQESAL 170


>gi|284921459|emb|CBG34528.1| probable prophage lysozyme (endolysin) [Escherichia coli 042]
          Length = 182

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|219870839|ref|YP_002475214.1| glycoside hydrolase family protein/phage lysozyme [Haemophilus
           parasuis SH0165]
 gi|219691043|gb|ACL32266.1| glycoside hydrolase family protein/phage lysozyme [Haemophilus
           parasuis SH0165]
          Length = 181

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/167 (28%), Positives = 74/167 (44%), Gaps = 10/167 (5%)

Query: 8   ISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT--GSD 65
           + FV  +I +   D H +       ++++ + EG +   Y        T+G G T   S 
Sbjct: 14  VCFVSAIIAVLNTDFHGQFRTSKQGLEIIGDAEGCKREPYL-CPANVLTVGIGSTEASSG 72

Query: 66  VTEGMTITEKE-AEDFL--LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNY 122
             E    T+KE A+ +L  ++ A K +          +S  +    A     FN G G  
Sbjct: 73  KIERKVYTDKEIAQRWLVDIQHAEKCVKRYANGGDIPQSVFD----AATSLTFNAGCGTV 128

Query: 123 NKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           +KSTF +++ + D+  A  E  KW  +GGK L GL  RR+ E  L L
Sbjct: 129 SKSTFFRKIKSGDYVGACNELPKWVYSGGKKLRGLEIRREKEKALCL 175


>gi|301306482|ref|ZP_07212548.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|300838288|gb|EFK66048.1| phage lysozyme [Escherichia coli MS 124-1]
          Length = 177

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|168207342|ref|ZP_02633347.1| Gp15 protein [Clostridium perfringens E str. JGS1987]
 gi|170661326|gb|EDT14009.1| Gp15 protein [Clostridium perfringens E str. JGS1987]
          Length = 990

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 68/142 (47%), Gaps = 6/142 (4%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKDASKSLN 90
           +I  +K  EG     Y D   G  T+GYG TG+++    + ++E  A  +L+ + ++   
Sbjct: 809 IIYYVKGIEGYAPYHYYD-SVGVKTLGYGMTGNELNGVSVPLSETSATHYLVNNFNRDYY 867

Query: 91  ---LLLESSPALKSTSENRLVAVADFVFNLGI-GNYNKSTFKQRVDAQDWEKAAEECKKW 146
              L +  S  + +  +  + A A F +N G+ G  N    K+ ++ +  E    E  KW
Sbjct: 868 IPVLNIVKSKGVSNPLQREIDAFASFAYNCGVEGFRNSQLLKRYINGERGEGIHNEFMKW 927

Query: 147 TKAGGKVLPGLVKRRDAEVKLL 168
             AG  V  GL++RR+ E K+ 
Sbjct: 928 IHAGNSVSNGLIRRREEEWKIF 949


>gi|169868480|ref|XP_001840811.1| lysozyme [Coprinopsis cinerea okayama7#130]
 gi|116497969|gb|EAU80864.1| lysozyme [Coprinopsis cinerea okayama7#130]
          Length = 282

 Score = 54.3 bits (129), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 68/146 (46%), Gaps = 14/146 (9%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG-----SDVTEGMTITEKEAEDFLLKDASK 87
           ++ +K  EG   +   D  G   T+GYGH       ++V     +T+ +A   L  D   
Sbjct: 128 VREIKSSEGFVKSPAPDPIG-LPTVGYGHLCKTKGCAEVPYKFPLTDAQATSLLKSDLKT 186

Query: 88  SLNLLLESSPALKST---SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD--WEKAAEE 142
             N +   S  L+ T   +EN+  A+  + FN+G      ST   R++  D   + A EE
Sbjct: 187 FQNCI---SKDLRDTVRLNENQYGALVSWAFNVGCRATGSSTLIARLNRGDNPAKVAEEE 243

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLL 168
             KW KA GKVL GLV RR  E+ + 
Sbjct: 244 LPKWNKANGKVLQGLVNRRKREIAMF 269


>gi|148734541|ref|YP_001285558.1| LysN [Enterobacteria phage TLS]
 gi|38046800|gb|AAR09299.1| LysN [Enterobacteria phage TLS]
          Length = 164

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/141 (29%), Positives = 65/141 (46%), Gaps = 9/141 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++E EG++   Y+DI G  WT+ +G TG+DV  G   T +E +  L K    + + + +
Sbjct: 22  LIEEIEGVKYKPYKDIAG-IWTVCHGITGNDVILGKEYTRRECDALLAKHMKVAADAVDK 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT-----KA 149
           +       S     A+  F FN G G + KST  ++++  D      E   WT     K 
Sbjct: 81  AVKVDIPISMR--AALYSFTFNAGTGAFRKSTMLKKINNGDLYGGCGELWNWTYYRNPKT 138

Query: 150 GGK-VLPGLVKRRDAEVKLLL 169
           G K    GL  RR  E K  +
Sbjct: 139 GKKEKSKGLKNRRAVEYKYCV 159


>gi|16129513|ref|NP_416072.1| Qin prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. MG1655]
 gi|89108396|ref|AP_002176.1| predicted lysozyme [Escherichia coli str. K-12 substr. W3110]
 gi|170020096|ref|YP_001725050.1| lysozyme [Escherichia coli ATCC 8739]
 gi|170081222|ref|YP_001730542.1| Qin prophage; lysozyme [Escherichia coli str. K-12 substr. DH10B]
 gi|194436424|ref|ZP_03068525.1| phage lysozyme [Escherichia coli 101-1]
 gi|218554116|ref|YP_002387029.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli IAI1]
 gi|218699876|ref|YP_002407505.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli IAI39]
 gi|218705056|ref|YP_002412575.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli UMN026]
 gi|238900774|ref|YP_002926570.1| Qin prophage; putative lysozyme [Escherichia coli BW2952]
 gi|256022765|ref|ZP_05436630.1| Qin prophage; putative lysozyme [Escherichia sp. 4_1_40B]
 gi|260855292|ref|YP_003229183.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|293405057|ref|ZP_06649049.1| lysozyme [Escherichia coli FVEC1412]
 gi|298380702|ref|ZP_06990301.1| lysozyme lambdoid prophage Qin [Escherichia coli FVEC1302]
 gi|300899661|ref|ZP_07117892.1| phage lysozyme [Escherichia coli MS 198-1]
 gi|300903925|ref|ZP_07121820.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|301326425|ref|ZP_07219777.1| phage lysozyme [Escherichia coli MS 78-1]
 gi|301647716|ref|ZP_07247509.1| phage lysozyme [Escherichia coli MS 146-1]
 gi|307310881|ref|ZP_07590527.1| Lysozyme [Escherichia coli W]
 gi|331652932|ref|ZP_08353937.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli M718]
 gi|331668009|ref|ZP_08368864.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA271]
 gi|14194912|sp|P76159|LYSQ_ECOLI RecName: Full=Probable lysozyme from lambdoid prophage Qin;
           AltName: Full=Endolysin; AltName: Full=Lysis protein;
           AltName: Full=Muramidase
 gi|1787836|gb|AAC74627.1| Qin prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. MG1655]
 gi|85675021|dbj|BAE76469.1| predicted lysozyme [Escherichia coli str. K12 substr. W3110]
 gi|169755024|gb|ACA77723.1| Lysozyme [Escherichia coli ATCC 8739]
 gi|169889057|gb|ACB02764.1| Qin prophage; predicted lysozyme [Escherichia coli str. K-12
           substr. DH10B]
 gi|194424456|gb|EDX40442.1| phage lysozyme [Escherichia coli 101-1]
 gi|218360884|emb|CAQ98454.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli IAI1]
 gi|218369862|emb|CAR17636.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli IAI39]
 gi|218432153|emb|CAR13041.1| putative membrane-associated lysozyme; Qin prophage [Escherichia
           coli UMN026]
 gi|222033315|emb|CAP76055.1| lysozyme from lambdoid prophage Qin [Escherichia coli LF82]
 gi|238863374|gb|ACR65372.1| Qin prophage; predicted lysozyme [Escherichia coli BW2952]
 gi|257753941|dbj|BAI25443.1| putative endolysin [Escherichia coli O26:H11 str. 11368]
 gi|260449324|gb|ACX39746.1| Lysozyme [Escherichia coli DH1]
 gi|291427265|gb|EFF00292.1| lysozyme [Escherichia coli FVEC1412]
 gi|298278144|gb|EFI19658.1| lysozyme lambdoid prophage Qin [Escherichia coli FVEC1302]
 gi|300356786|gb|EFJ72656.1| phage lysozyme [Escherichia coli MS 198-1]
 gi|300404085|gb|EFJ87623.1| phage lysozyme [Escherichia coli MS 84-1]
 gi|300846841|gb|EFK74601.1| phage lysozyme [Escherichia coli MS 78-1]
 gi|301074151|gb|EFK88957.1| phage lysozyme [Escherichia coli MS 146-1]
 gi|306909059|gb|EFN39555.1| Lysozyme [Escherichia coli W]
 gi|312946157|gb|ADR26984.1| putative endolysin [Escherichia coli O83:H1 str. NRG 857C]
 gi|315060853|gb|ADT75180.1| Qin prophage; predicted lysozyme [Escherichia coli W]
 gi|315136195|dbj|BAJ43354.1| lysozyme [Escherichia coli DH1]
 gi|315253265|gb|EFU33233.1| phage lysozyme [Escherichia coli MS 85-1]
 gi|320643968|gb|EFX13057.1| putative endolysin [Escherichia coli O157:H- str. 493-89]
 gi|320660355|gb|EFX27829.1| putative endolysin [Escherichia coli O55:H7 str. USDA 5905]
 gi|323156716|gb|EFZ42854.1| phage lysozyme family protein [Escherichia coli EPECa14]
 gi|323169846|gb|EFZ55502.1| phage lysozyme family protein [Escherichia coli LT-68]
 gi|323185908|gb|EFZ71265.1| phage lysozyme family protein [Escherichia coli 1357]
 gi|323378576|gb|ADX50844.1| Lysozyme [Escherichia coli KO11]
 gi|323942033|gb|EGB38211.1| phage lysozyme [Escherichia coli E482]
 gi|323947937|gb|EGB43932.1| phage lysozyme [Escherichia coli H120]
 gi|323973804|gb|EGB68978.1| phage lysozyme [Escherichia coli TA007]
 gi|331049030|gb|EGI21102.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli M718]
 gi|331064751|gb|EGI36655.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA271]
 gi|332343263|gb|AEE56597.1| phage lysozyme [Escherichia coli UMNK88]
          Length = 177

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|254298375|ref|ZP_04965827.1| phage lysozyme [Burkholderia pseudomallei 406e]
 gi|157808401|gb|EDO85571.1| phage lysozyme [Burkholderia pseudomallei 406e]
          Length = 162

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 60/140 (42%), Gaps = 10/140 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D  G   T   G T  DV  G   +E E    L          
Sbjct: 18  LAVVVPKFEGVKLVGYLDPVG-IPTKCMGDT-RDVVVGRAYSEAECLSSLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGARAYCTSTTAKRFNAGDLRGACRAINESDDGRP 134

Query: 145 KWTKAGGKVLPGLVKRRDAE 164
           +W  A G+ +PGLVKRR  E
Sbjct: 135 QWVTARGREMPGLVKRRADE 154


>gi|331673143|ref|ZP_08373911.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA280]
 gi|331069341|gb|EGI40728.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli TA280]
          Length = 177

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRVRSNNCYGQVIRRDQESAL 170


>gi|170744035|ref|YP_001772690.1| glycoside hydrolase family protein [Methylobacterium sp. 4-46]
 gi|168198309|gb|ACA20256.1| glycoside hydrolase family 24 [Methylobacterium sp. 4-46]
          Length = 211

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 64/134 (47%), Gaps = 12/134 (8%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKSLN 90
           +L+  EG RLTAY+D   G WTIG G T +     V  G+ IT  E++    +   +S++
Sbjct: 10  VLRAREGERLTAYKD-SVGVWTIGVGITTASGLIVVRPGLRITRAESDRLFAQAVERSVD 68

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
            +  +    K   +    A A   +N+G   + +ST  ++ +A D   AAE    W +  
Sbjct: 69  PVRRA--LAKPVPQEFFDACASLAYNIGPVRFAESTIVRKANAGDLAGAAEAFLLWNRPA 126

Query: 151 GKVLPGLVKRRDAE 164
             +LP    RR AE
Sbjct: 127 A-ILP----RRRAE 135


>gi|150378410|ref|YP_001315004.1| glycoside hydrolase family protein [Sinorhizobium medicae WSM419]
 gi|150032957|gb|ABR65071.1| glycoside hydrolase family 24 [Sinorhizobium medicae WSM419]
          Length = 260

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 65/144 (45%), Gaps = 26/144 (18%)

Query: 47  YRDIGGGAWTIGYGH----------TGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESS 96
           Y D   G  TIGYG              D+  G  ITE++A  FL +D S +  L ++ +
Sbjct: 82  YND-AAGYCTIGYGRLIKKERCRDLDLGDLRRG--ITEEQAVAFLKEDLSFA-RLAVQRN 137

Query: 97  PALKSTSE------------NRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
                 S             ++  A+  F+FN+G  NY +ST  +R+     E AA E  
Sbjct: 138 TVYDRDSNGDGRKDPIEANNDQFSALVSFIFNVGERNYKRSTLLRRMQQDRNELAAREFL 197

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLL 168
           +W +A G++  GL+ RR+ E  L 
Sbjct: 198 RWVRADGRIYEGLIARRECEQSLF 221


>gi|48697551|ref|YP_024909.1| gp03 R [Burkholderia phage BcepB1A]
 gi|47717521|gb|AAT37767.1| gp03 R [Burkholderia phage BcepB1A]
          Length = 165

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/143 (32%), Positives = 65/143 (45%), Gaps = 10/143 (6%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           + L E EG RL AY+D GG  WT   G T   V      T+ E  D +   A       +
Sbjct: 24  QFLHEKEGDRLIAYQDTGG-KWTACMGVT-RGVKPHARYTQAEC-DRMDAQAVAGAETDV 80

Query: 94  ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
           ES   +  +   R   ++   +NLG    +KSTF + ++    ++A EE KKWT  GGK 
Sbjct: 81  ESLVTVPMSKPQRAAVISFCGYNLGATKCSKSTFLRLLNEGKRKEACEEIKKWTYVGGKD 140

Query: 154 LP-------GLVKRRDAEVKLLL 169
                    G+  RRD E +L L
Sbjct: 141 CTDASNNCRGIPLRRDQEYQLCL 163


>gi|307138208|ref|ZP_07497564.1| putative endolysin [Escherichia coli H736]
 gi|331642142|ref|ZP_08343277.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H736]
 gi|331038940|gb|EGI11160.1| putative lysozyme from lambdoid prophage Qin (Lysisprotein)
           (Muramidase) (Endolysin) [Escherichia coli H736]
          Length = 177

 Score = 53.9 bits (128), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G    STF +R++A D + A E  
Sbjct: 82  RDKALAWVDRNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|82776681|ref|YP_403030.1| putative endolysin [Shigella dysenteriae Sd197]
 gi|309789003|ref|ZP_07683598.1| phage lysozyme family protein [Shigella dysenteriae 1617]
 gi|6759968|gb|AAF28126.1|AF153317_22 endolysin [Shigella dysenteriae]
 gi|81240829|gb|ABB61539.1| putative endolysin [Shigella dysenteriae Sd197]
 gi|308923274|gb|EFP68786.1| phage lysozyme family protein [Shigella dysenteriae 1617]
          Length = 177

 Score = 53.9 bits (128), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 46/155 (29%), Positives = 71/155 (45%), Gaps = 14/155 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG   TAYRD G G WTI  G     G  V  GM +++++ +     +
Sbjct: 23  APEILDQFLDEKEGNHTTAYRD-GAGIWTICRGAILVDGKPVVPGMKLSKEKCDRVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  + ++       +E +   +A F  +N+G      STF ++++A D + A  E 
Sbjct: 82  RDKALAWVEKNIRV--PLTEPQKAGIASFCPYNIGPSKCFTSTFYRKLNAGDRKGACAEI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKLLLES 171
           ++W   GG+          G V RRD E  L   S
Sbjct: 140 RRWIYDGGRDCRNRSNNCYGQVSRRDQESALACWS 174


>gi|33770570|ref|NP_892107.1| lysis protein [Yersinia phage PY54]
 gi|33636153|emb|CAD91822.1| lysis protein [Yersinia phage PY54]
          Length = 177

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 69/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  + +  KE EG  L AY D  GG WTI  G T   G  V +GM +T+ +     +  
Sbjct: 23  APVMMSQFQKEKEGTSLIAYPD-NGGVWTICGGVTRVDGKPVVKGMKLTQTQCNS--IDK 79

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
           A ++  LL          +E + V +A F  +N+G      STF ++++  D   A  E 
Sbjct: 80  AEQAKALLWVQKNVYVPLTEPQKVGIASFCPWNIGPSKCFTSTFYRKLNLGDRLGACAEI 139

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           K+W   GGK          G ++RR+ E +L
Sbjct: 140 KRWIHDGGKDCRIRSNNCYGQIERREQESEL 170


>gi|87303205|ref|ZP_01086003.1| putative bacteriophage lysozyme [Synechococcus sp. WH 5701]
 gi|87282372|gb|EAQ74332.1| putative bacteriophage lysozyme [Synechococcus sp. WH 5701]
          Length = 171

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A++ F+FN+G G +  ST  + ++  D+  AA++  +W K GG+VL GLV+RR  E  + 
Sbjct: 35  ALSSFIFNVGPGAFANSTLLKLLNLGDYHGAADQFLRWNKGGGRVLAGLVRRRAEERAMF 94

Query: 169 L 169
           +
Sbjct: 95  I 95


>gi|273810610|ref|YP_003344991.1| gp56 [Sodalis phage SO-1]
 gi|258619895|gb|ACV84148.1| gp56 [Sodalis phage SO-1]
          Length = 163

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 57/112 (50%), Gaps = 8/112 (7%)

Query: 53  GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVAD 112
           G +T GYGHTG++     +IT  EA D L +D + + N +  +  A  S ++ +  A+ D
Sbjct: 32  GLYTWGYGHTGTNPPR--SITRAEALDLLKRDVAYAENWV--NKYAHPSINQAQFDALVD 87

Query: 113 FVFNLGIG----NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKR 160
            V N G G    +   + F   V   DW K      ++ K GG+VL GLV+R
Sbjct: 88  LVINAGPGPIMPDNIANDFDDAVRLGDWAKVRATLPQFRKQGGEVLKGLVRR 139


>gi|167821714|ref|ZP_02453394.1| glycoside hydrolase, family 24 [Burkholderia pseudomallei 91]
          Length = 181

 Score = 53.5 bits (127), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 65/157 (41%), Gaps = 30/157 (19%)

Query: 38  EFEGLRLTAYRD-IGGGAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKD---ASKSLN 90
           +FEG     Y D +G     +G+  TG D   +  G T ++      L KD   A K++ 
Sbjct: 26  QFEGYSNKVYSDPVGINTVCVGHARTGPDGKPLRLGQTYSDDVCSYLLGKDISEADKAVR 85

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA- 149
            L++        S    +A  DF FN G  N   ST  ++V+A D   A  E  +W+   
Sbjct: 86  RLVKVP-----LSAGERIAYTDFAFNAGAANLAASTLLKKVNAGDRMGACRELPRWSCVT 140

Query: 150 -----------------GGKVLPGLVKRRDAEVKLLL 169
                              K LPGLVKRRDA ++  L
Sbjct: 141 VPVGKGDVSGMCATKDRSKKQLPGLVKRRDAALRTCL 177


>gi|318605413|emb|CBY26911.1| lysozyme [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 160

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 37/132 (28%), Positives = 64/132 (48%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG R  AY D+     T+  GHTG D+      ++ E +  L +D +    ++     A
Sbjct: 31  LEGRRYVAYYDVVN-VLTVCDGHTGKDIIPSKKYSDAECDALLQQDLAPVQRIV---DAA 86

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K   S+ +  A+  F +N+G   + +ST  ++++  D + A +E + W  A G+   GL
Sbjct: 87  VKIPLSQYQKAALYSFTYNVGQHAFIQSTLLKKLNTGDIKGACDELRLWIYADGQSWKGL 146

Query: 158 VKRRDAEVKLLL 169
             RR  E +L L
Sbjct: 147 QNRRGVERELCL 158


>gi|168697951|ref|ZP_02730228.1| putative endolysin [Gemmata obscuriglobus UQM 2246]
          Length = 165

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/146 (30%), Positives = 62/146 (42%), Gaps = 15/146 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I  + + EG  L AY+D+GG  +TI +G T     E   +  KEA D L K     +   
Sbjct: 22  IPFITDHEGESLKAYQDVGG-VYTICHGETSGVKAE--QVATKEACDALTKS---RVGQF 75

Query: 93  LESSPALKST--SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +    AL     S   L A     +N+GI  Y +ST  +  +A +          W  AG
Sbjct: 76  MAQVHALHKVELSPATLAAHTSMAYNIGIAAYARSTTLRLTNAGNIAAGCRAMANWYTAG 135

Query: 151 GK-------VLPGLVKRRDAEVKLLL 169
           GK          GL+ RR+ E+ L L
Sbjct: 136 GKDCRVRSNNCYGLINRRNDEIALCL 161


>gi|146312254|ref|YP_001177328.1| lysozyme [Enterobacter sp. 638]
 gi|145319130|gb|ABP61277.1| Lysozyme [Enterobacter sp. 638]
          Length = 178

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 47/153 (30%), Positives = 69/153 (45%), Gaps = 17/153 (11%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDA 85
           P    + + E EG  L A  D GG  W++ +G T   G  V +G   TE + +     + 
Sbjct: 22  PILFDQFISEKEGNALVAVVDPGG-VWSLCHGVTVIDGKSVIKGQRATEAQCKKVNAIER 80

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            K+L  +  +       +E + V +A F  +N+G G    STF QR++A D E A E  +
Sbjct: 81  DKALAWVDRNIKV--PLTEPQKVGIASFCPYNIGPGKCYPSTFYQRINAGDREGACEAIR 138

Query: 145 KWTKAGGKVLP----------GLVKRRDAEVKL 167
            W K GG+             G V+RRD E  L
Sbjct: 139 WWIKDGGRDCRLTKGQKNGCYGQVERRDQESAL 171


>gi|84684048|ref|ZP_01011950.1| probable phage-related lysozyme [Maritimibacter alkaliphilus
           HTCC2654]
 gi|84667801|gb|EAQ14269.1| probable phage-related lysozyme [Rhodobacterales bacterium
           HTCC2654]
          Length = 314

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 60/135 (44%), Gaps = 10/135 (7%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           E+EG+RL AY        TIG G T   G  VT GM IT ++A D L  D    L     
Sbjct: 135 EYEGVRLEAYMPTPDDRPTIGVGATHIDGKPVTMGMVITMEQAMDLL--DEHMRLYRTFY 192

Query: 95  SSPALKSTSENRL-----VAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
                + +   RL      A   +  N+G G   +ST  +R++A   E A +    + K 
Sbjct: 193 MKALTEESRRTRLNTPRDCAFTSWTLNIGGGAAQRSTAIKRLNAGWIEGACDAMTWFHKQ 252

Query: 150 GGKVLPGLVKRRDAE 164
            G+ LPGL  RR  E
Sbjct: 253 AGRPLPGLQIRRGKE 267


>gi|261343771|ref|ZP_05971416.1| lysozyme [Providencia rustigianii DSM 4541]
 gi|282568155|gb|EFB73690.1| lysozyme [Providencia rustigianii DSM 4541]
          Length = 178

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 69/152 (45%), Gaps = 17/152 (11%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKS 88
           L   L E EG  L AYRD  GG  TI  G T   G  +  G  +T  E ++    +A K+
Sbjct: 25  LSSFLDEKEGNLLKAYRD-AGGVVTICRGVTRIDGQKIKLGTKLTLAECDELNRIEADKA 83

Query: 89  LNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           +  +          +E ++  +A F  +N+G      STF ++++A D + A  E  KWT
Sbjct: 84  IGWVKRHVHV--PLTEPQIAGIASFCPYNIGPSKCFSSTFYRKLNAGDIKGACAELPKWT 141

Query: 148 KAGGKVLP----------GLVKRRDAEVKLLL 169
           + GGK             G V RRD E +LL 
Sbjct: 142 RDGGKDCRQTKGQPNGCYGQVIRRDQEAELLC 173


>gi|85059659|ref|YP_455361.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84780179|dbj|BAE74956.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 175

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 74/148 (50%), Gaps = 18/148 (12%)

Query: 35  MLKEF----EGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASK 87
           M+ +F    EGLR  AY+D GGG WTI  G T   G  V +GM ++  + E     + +K
Sbjct: 24  MMSQFQDEKEGLRTAAYQD-GGGVWTICGGTTFVNGKPVVQGMRLSVDQCERIDKVEQAK 82

Query: 88  SLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
           +L   +E +  +  T E + V +A F  +++G      STF ++++A D   A  E ++W
Sbjct: 83  AL-AWVERNVRVPLT-ETQKVGIASFCPWSIGPAKCFSSTFWKKLNAGDRSGACAEIRRW 140

Query: 147 TKAGGKVLP-------GLVKRRDAEVKL 167
              GG+          G V RR+ E +L
Sbjct: 141 IWDGGRDCRIRSNNCYGQVLRREQEAEL 168


>gi|226940922|ref|YP_002795996.1| Lysozyme [Laribacter hongkongensis HLHK9]
 gi|226715849|gb|ACO74987.1| Lysozyme [Laribacter hongkongensis HLHK9]
          Length = 104

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/56 (44%), Positives = 33/56 (58%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
           A     +N+G G +  ST  Q+++A D+  A  E  +WT AGG  LPGLVKRR  E
Sbjct: 40  AFVSLAYNIGSGAFCSSTLVQKLNAGDYAGACAEIDRWTYAGGIRLPGLVKRRAEE 95


>gi|331676479|ref|ZP_08377176.1| phage lysozyme [Escherichia coli H591]
 gi|331075972|gb|EGI47269.1| phage lysozyme [Escherichia coli H591]
          Length = 88

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 40/61 (65%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ RR+ E ++ 
Sbjct: 24  ALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREIC 83

Query: 169 L 169
           L
Sbjct: 84  L 84


>gi|289827254|ref|ZP_06545958.1| putative lysozyme protein R of prophage CP-933K [Salmonella
           enterica subsp. enterica serovar Typhi str. E98-3139]
          Length = 124

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 50/97 (51%), Gaps = 10/97 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSL 89
           +K++ ++EG RL  Y+    G WT G G+T S V  G TITE++A + L+ +     ++L
Sbjct: 34  LKLIADYEGCRLQPYQ-CSAGVWTDGIGNT-SGVIPGKTITERQAAEGLISNVLRVERAL 91

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST 126
              ++  P  K        A   F FN+G GN   ST
Sbjct: 92  ERCVKQQPPQKVYD-----AAVSFAFNVGTGNACSST 123


>gi|331677164|ref|ZP_08377860.1| phage lysozyme [Escherichia coli H591]
 gi|331075853|gb|EGI47151.1| phage lysozyme [Escherichia coli H591]
          Length = 95

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 40/61 (65%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ RR+ E ++ 
Sbjct: 31  ALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREIC 90

Query: 169 L 169
           L
Sbjct: 91  L 91


>gi|254523572|ref|ZP_05135627.1| lysozyme [Stenotrophomonas sp. SKA14]
 gi|219721163|gb|EED39688.1| lysozyme [Stenotrophomonas sp. SKA14]
          Length = 172

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 57/141 (40%), Gaps = 17/141 (12%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           ++ FEG     YRD+ G   T+ YGHT     E  T    E E  L  D   + N +   
Sbjct: 29  VQPFEGYSAQPYRDVVG-KLTVCYGHTAK--VEQRTYARAECERLLQSDLGVAWNTV--Q 83

Query: 96  SPALKSTSENRLVAVADFVFNLGIG------------NYNKSTFKQRVDAQDWEKAAEEC 143
           S      ++ +  A+  F FN+G G            N  +   +   +   W+ A  + 
Sbjct: 84  SCIKVPMTDYQAAALTSFAFNVGPGGAGVKDGLCTLRNGQQPRIRVYANQGRWDLACAQL 143

Query: 144 KKWTKAGGKVLPGLVKRRDAE 164
             W  AGGK   GL +RR AE
Sbjct: 144 SNWANAGGKSYKGLERRRTAE 164


>gi|165918603|ref|ZP_02218689.1| phage lysozyme [Coxiella burnetii RSA 334]
 gi|165917731|gb|EDR36335.1| phage lysozyme [Coxiella burnetii RSA 334]
          Length = 144

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 67/142 (47%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D   G WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 10  LEFLKRHEGFSPHLYKD-SVGKWTIGYGRNLEDDP----LHEYEAEFLLMQDIER-LDKA 63

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+AA+E    +W + 
Sbjct: 64  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAAKEMLNSEWAEE 123

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 124 --------VKSRATELAQLMDS 137


>gi|212218414|ref|YP_002305201.1| lysozyme [Coxiella burnetii CbuK_Q154]
 gi|212012676|gb|ACJ20056.1| lysozyme [Coxiella burnetii CbuK_Q154]
          Length = 146

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 67/142 (47%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D   G WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 12  LEFLKRHEGFSPHLYKD-SVGKWTIGYGRNLEDDP----LHEYEAEFLLMQDIER-LDKA 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+AA+E    +W + 
Sbjct: 66  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAAKEMLNSEWAEE 125

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 126 --------VKSRATELAQLMDS 139


>gi|269104767|ref|ZP_06157463.1| lysozyme [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268161407|gb|EEZ39904.1| lysozyme [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 181

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 43/144 (29%), Positives = 60/144 (41%), Gaps = 12/144 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I +   FEG R  AY+D  GG WT  +G T   +  G   T  E E  L     K  N  
Sbjct: 15  IALTGGFEGYRHYAYQD-SGGVWTACFGET-ERIHPGDQFTISECETMLATSLDKH-NAP 71

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK 152
           +   P     S +  +A  D  +N+GI  +  ST  + +   D+  A  +  +W    GK
Sbjct: 72  IRKIPQQLPLSVH--LAALDMSYNIGISAFEHSTMYRYLLNGDYPSACRQISRWRFVAGK 129

Query: 153 VLP-------GLVKRRDAEVKLLL 169
                     G+VKRR+   KL L
Sbjct: 130 DCAIKRNNCYGIVKRRELVQKLCL 153


>gi|153206714|ref|ZP_01945555.1| phage lysozyme [Coxiella burnetii 'MSU Goat Q177']
 gi|120577077|gb|EAX33701.1| phage lysozyme [Coxiella burnetii 'MSU Goat Q177']
          Length = 144

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 45/142 (31%), Positives = 67/142 (47%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D   G WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 10  LEFLKRHEGFSPHLYKD-SVGKWTIGYGRNLEDDP----LHEYEAEFLLMQDIER-LDKA 63

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+AA+E    +W + 
Sbjct: 64  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAAKEMLNSEWAEE 123

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 124 --------VKSRATELAQLMDS 137


>gi|282533183|gb|ADA82292.1| putative endolysin [Escherichia phage K1G]
 gi|282547333|gb|ADA82390.1| putative endolysin [Escherichia phage K1ind1]
          Length = 161

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 63/138 (45%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           +     FEG R TAYR      + TIGYGH G DVT G TIT    +  LL +   +  +
Sbjct: 10  LHFCAAFEGFRGTAYRATPNEKYLTIGYGHYGPDVTPGKTIT--PGQGLLLLNRDMAKAV 67

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR-VDAQDWEKAAEECKKWTKAG 150
               + A  S ++ +  AV D V+N+G G  + +T   + + + D      +   +    
Sbjct: 68  AAVDAAAHHSLTQAQFDAVCDLVYNVGAGVISATTGTGKALRSGDIATLRAKLALFINQN 127

Query: 151 GKVLPGLVKRRDAEVKLL 168
           GK L GL +R    + L 
Sbjct: 128 GKPLLGLRRRTAGRLALF 145


>gi|268589638|ref|ZP_06123859.1| lysozyme [Providencia rettgeri DSM 1131]
 gi|291315037|gb|EFE55490.1| lysozyme [Providencia rettgeri DSM 1131]
          Length = 178

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 68/152 (44%), Gaps = 17/152 (11%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKS 88
           L   L E EG  L  YRD GGG  TI  G T   G  V  G  ++  E +     +A K+
Sbjct: 25  LSGFLDEKEGNSLKTYRD-GGGVVTICRGVTRIDGKPVKMGTQLSPAECDRLNQIEADKA 83

Query: 89  LNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           +  +          +E ++  +A F  +N+G      STF ++++A D + A  E  KWT
Sbjct: 84  IAWVKRHVHV--PLTEPQIAGIASFCPYNIGPYKCFSSTFYRKLNAGDIKGACAELPKWT 141

Query: 148 KAGGKVLP----------GLVKRRDAEVKLLL 169
           + GGK             G V RRD E +LL 
Sbjct: 142 RDGGKDCRQTKGQPNGCYGQVIRRDQEAELLC 173


>gi|254522573|ref|ZP_05134628.1| lysozyme [Stenotrophomonas sp. SKA14]
 gi|219720164|gb|EED38689.1| lysozyme [Stenotrophomonas sp. SKA14]
          Length = 154

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/132 (32%), Positives = 63/132 (47%), Gaps = 10/132 (7%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           +K +EG   T Y D+ G A T  YG TG    E    TE+E  + L     + L  +   
Sbjct: 22  VKPWEGYSPTPYVDMVGVA-TYCYGDTGRP--EKAVYTEQECAEKLNSRLGQYLTGI--Q 76

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK---KWTKAGGK 152
           S        ++  A+  + +N+G+G   +ST   R++A   + AA  C    +W  AGGK
Sbjct: 77  SCIRVPLEPHQAAALLSWTYNVGVGAACRSTLVARINAG--QPAASWCAELDRWVYAGGK 134

Query: 153 VLPGLVKRRDAE 164
            + GLV RR AE
Sbjct: 135 RVQGLVNRRAAE 146


>gi|197935896|ref|YP_002213732.1| putative lysozyme [Ralstonia phage RSB1]
 gi|197927059|dbj|BAG70401.1| putative lysozyme [Ralstonia phage RSB1]
          Length = 165

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 1/112 (0%)

Query: 56  TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVF 115
           TI  GHTG DV  G    ++  + +  KDA  S+  +   S   K T +    A+   V 
Sbjct: 45  TICDGHTGPDVYRGQRANDQMCDAWRAKDAEVSIKAIRRCSGDAKLT-QYEFDALVSLVH 103

Query: 116 NLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
           N+G   Y  ST  + +     ++   +  +W  +GG+ L GLV RR +E  L
Sbjct: 104 NIGPTAYCGSTMSRLIREGKLDQVPGQFDRWVYSGGRKLRGLVNRRQSERNL 155


>gi|146311897|ref|YP_001176971.1| lysozyme [Enterobacter sp. 638]
 gi|145318773|gb|ABP60920.1| Lysozyme [Enterobacter sp. 638]
          Length = 178

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/154 (29%), Positives = 69/154 (44%), Gaps = 17/154 (11%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P    + + E EG  L A  D GG  W++ +G T   G  V +G   TE + +     +
Sbjct: 21  APILFDQFISEKEGNALVAVVDPGG-VWSLCHGVTVIDGKSVIKGQRATEAQCKKVNAIE 79

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E + V +A F  +N+G G    STF QR++A D + A E  
Sbjct: 80  RDKALAWVDRNIKV--PLTEPQKVGIASFCPYNIGPGKCYPSTFYQRINAGDGKGACEAI 137

Query: 144 KKWTKAGGKVLP----------GLVKRRDAEVKL 167
           + W K GG+             G V+RRD E  L
Sbjct: 138 RWWIKDGGRDCRLTKGQKNGCYGQVERRDQESAL 171


>gi|94317699|gb|ABF15014.1| endolysin Gp19 [Salmonella enterica subsp. enterica serovar
           Typhimurium]
          Length = 76

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 39/61 (63%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A+  FV+N+G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ RR+ E  + 
Sbjct: 12  ALYSFVYNVGAGNFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREVERDVC 71

Query: 169 L 169
           L
Sbjct: 72  L 72


>gi|322835661|ref|YP_004215687.1| Lysozyme [Rahnella sp. Y9602]
 gi|321170862|gb|ADW76560.1| Lysozyme [Rahnella sp. Y9602]
          Length = 176

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 71/151 (47%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  + +  KE EG  L AY+D  GG WTI  G T   G  V  GM +T  + +     +
Sbjct: 22  APVMMAQFQKEKEGTSLIAYQD-QGGKWTICGGVTAVNGKPVYRGMRLTLTQCDAIDKVE 80

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
            +K+L  + ++       +E + V +A F  +N+G      STF ++++A D   A  E 
Sbjct: 81  QAKALAWVGKN--IYVPLTEPQKVGIASFCPWNIGPAKCFTSTFYRKLNAGDRLGACAEI 138

Query: 144 KKWTKAGGK-------VLPGLVKRRDAEVKL 167
           K+W   GGK          G V RR+ E +L
Sbjct: 139 KRWVHDGGKDCNIWANNCSGQVIRREQESEL 169


>gi|323171765|gb|EFZ57410.1| lysozyme [Escherichia coli LT-68]
          Length = 188

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 61/143 (42%), Gaps = 15/143 (10%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           P A I+ +  +E  R T YRDI G   T+G G TG    E    TE E     + D   +
Sbjct: 30  PEAQIR-IATWEDCRATPYRDIAG-VMTVGCGSTGH--VENRLYTETEVAGRWVNDMQHA 85

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGN----------YNKSTFKQRVDAQDWEK 138
            N + ++     +  ++   A+ D  FNLG  N          Y+++T  +   A +W  
Sbjct: 86  ENCINQNFSG-NAMPQSAFEAMTDAAFNLGCRNLMWFRDKNRNYHRTTIWKHAQAHNWPD 144

Query: 139 AAEECKKWTKAGGKVLPGLVKRR 161
                  +  +GG+   GLV RR
Sbjct: 145 MCNRLTDFVNSGGERSQGLVNRR 167


>gi|332161438|ref|YP_004298015.1| bacteriophage lysozyme [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
 gi|325665668|gb|ADZ42312.1| bacteriophage lysozyme [Yersinia enterocolitica subsp. palearctica
           105.5R(r)]
          Length = 151

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 64/132 (48%), Gaps = 5/132 (3%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG +  AY D+     T+  GHTG D+      ++ E +  L +D +    ++     A
Sbjct: 22  LEGRKYVAYYDVVN-VLTVCDGHTGKDIIPSKKYSDAECDALLQQDLAPVQRIV---DAA 77

Query: 99  LK-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           +K   S+ +  A+  F +N+G   + +ST  ++++  D + A +E + W  A G+   GL
Sbjct: 78  VKIPLSQYQKAALYSFTYNVGQHAFIQSTLLKKLNTGDIKGACDELRLWIYADGQSWKGL 137

Query: 158 VKRRDAEVKLLL 169
             RR  E +L L
Sbjct: 138 QNRRGVERELCL 149


>gi|323169323|gb|EFZ54999.1| lysozyme [Shigella sonnei 53G]
 gi|323170063|gb|EFZ55719.1| lysozyme [Escherichia coli LT-68]
          Length = 182

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 61/143 (42%), Gaps = 15/143 (10%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           P A I+ +  +E  R T YRDI G   T+G G TG    E    TE E     + D   +
Sbjct: 30  PEAQIR-IATWEDCRATPYRDIAG-VMTVGCGSTGH--VENRLYTETEVAGRWVNDMQHA 85

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGN----------YNKSTFKQRVDAQDWEK 138
            N + ++     +  ++   A+ D  FNLG  N          Y+++T  +   A +W  
Sbjct: 86  ENCINQNFSG-NAMPQSAFEAMTDAAFNLGCRNLMWFRDKNRNYHRTTIWKHAQAHNWPD 144

Query: 139 AAEECKKWTKAGGKVLPGLVKRR 161
                  +  +GG+   GLV RR
Sbjct: 145 MCNRLTDFVNSGGERSQGLVNRR 167


>gi|320197742|gb|EFW72350.1| Phage endolysin [Escherichia coli EC4100B]
          Length = 177

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 46/151 (30%), Positives = 68/151 (45%), Gaps = 14/151 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
            P  L + L E EG    AYRD G G WTI  G T   G  V   M +++++ +     +
Sbjct: 23  APQILDQFLDEKEGNHTMAYRD-GSGIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIE 81

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
             K+L  +  +       +E +   +A F  +N+G G     TF +R++A D + A E  
Sbjct: 82  RDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPLTFYKRLNAGDRKGACEAI 139

Query: 144 KKWTKAGGKVLP-------GLVKRRDAEVKL 167
           + W K GG+          G V RRD E  L
Sbjct: 140 RWWIKDGGRDCRIRSNNCYGQVIRRDQESAL 170


>gi|153009617|ref|YP_001370832.1| glycoside hydrolase family protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151561505|gb|ABS15003.1| glycoside hydrolase family 24 [Ochrobactrum anthropi ATCC 49188]
          Length = 168

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 55/125 (44%), Gaps = 2/125 (1%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESS-P 97
           +EG+   AY D  G  WT+  G T   V +G   T+K+  + L+          L     
Sbjct: 28  WEGMENQAYYDKLGKVWTVCLGET-KGVQKGDYYTDKQCREKLITRLENDFRQPLRKCIR 86

Query: 98  ALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGL 157
                      ++ D  +N+G G   KST  +R+  + W  A      + +AGGKV+ GL
Sbjct: 87  TFDQAPIGVQASMLDLSYNIGTGAACKSTAARRMSDRQWRAACNAMTAFNRAGGKVVEGL 146

Query: 158 VKRRD 162
            KRR+
Sbjct: 147 KKRRE 151


>gi|323186181|gb|EFZ71534.1| lysozyme [Escherichia coli 1357]
          Length = 172

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 61/143 (42%), Gaps = 15/143 (10%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKS 88
           P A I+ +  +E  R T YRDI G   T+G G TG    E    TE E     + D   +
Sbjct: 20  PEAQIR-IATWEDCRATPYRDIAG-VMTVGCGSTGH--VENRLYTETEVAGRWVNDMQHA 75

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGN----------YNKSTFKQRVDAQDWEK 138
            N + ++     +  ++   A+ D  FNLG  N          Y+++T  +   A +W  
Sbjct: 76  ENCINQNFSG-NAMPQSAFEAMTDAAFNLGCRNLMWFRDKNRNYHRTTIWKHAQAHNWPD 134

Query: 139 AAEECKKWTKAGGKVLPGLVKRR 161
                  +  +GG+   GLV RR
Sbjct: 135 MCNRLTDFVNSGGERSQGLVNRR 157


>gi|49475812|ref|YP_033853.1| Phage related lysozyme [Bartonella henselae str. Houston-1]
 gi|49238620|emb|CAF27863.1| Phage related lysozyme [Bartonella henselae str. Houston-1]
          Length = 149

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 51/98 (52%), Gaps = 2/98 (2%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129
           M IT+++AE    +D  K     +E S  +   ++ ++ A+  F +N+    + KST  +
Sbjct: 1   MRITQEQAEAIFCEDL-KQFGKTVEQSVKV-CLTDAQIAALVSFCYNVETQAFCKSTLLK 58

Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +++   +E    E +KW K GGK + G V RR AE  L
Sbjct: 59  KLNNGAYESVPAELQKWNKVGGKAIQGFVNRRAAEAGL 96


>gi|261251497|ref|ZP_05944071.1| putative phage lysozyme [Vibrio orientalis CIP 102891]
 gi|260938370|gb|EEX94358.1| putative phage lysozyme [Vibrio orientalis CIP 102891]
          Length = 193

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/143 (27%), Positives = 67/143 (46%), Gaps = 8/143 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V +A ++++   EG R   YR   G A T G G+T  DV     + E+ A+D++    S 
Sbjct: 45  VSSAALELIGNAEGCRQDPYRCPAGLA-TNGIGNT-HDVPSATVLLEQVAKDWVKNIQSA 102

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGI------GNYNKSTFKQRVDAQDWEKAAE 141
              +    S +  + ++ +  A   F FN G       GN + +   + +   ++ KA E
Sbjct: 103 ERCITKAESISGIAMTQGQFDAFTSFAFNTGCTKFRRNGNGSATQIYKHIMQGEYLKACE 162

Query: 142 ECKKWTKAGGKVLPGLVKRRDAE 164
           + K+W  +GGK   GL+ RR  E
Sbjct: 163 QLKRWVYSGGKKYNGLIVRRGLE 185


>gi|15004854|ref|NP_149314.1| integrin-like repeat-containing lysozyme [Clostridium
           acetobutylicum ATCC 824]
 gi|14994466|gb|AAK76896.1|AE001438_149 Integrin-like repeats domain fused to lysozyme, LYCV glycosyl
           hydrolase [Clostridium acetobutylicum ATCC 824]
          Length = 752

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 7/140 (5%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           LI  + ++E      YR       TIGYGH          +T+++A D L +D   + N 
Sbjct: 603 LITFIGQYESFSPVPYRGADYQNRTIGYGHVIQPGENLSYLTDEQARDLLQRDIQNTTNA 662

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK----KWT 147
           +   +  LK T +N+  ++ DF +N GI     S   + + A +   +A+  K     W+
Sbjct: 663 VSSITSGLKLT-QNQFDSLVDFAYNCGISALESSILLKNIKAGN--TSADTLKTNFISWS 719

Query: 148 KAGGKVLPGLVKRRDAEVKL 167
              G+ L GL +RR  E ++
Sbjct: 720 YCNGEELLGLWRRRMDEWQM 739


>gi|325511298|gb|ADZ22933.1| Integrin-like repeats domain fused to lysozyme, LYCV glycosyl
           hydrolase [Clostridium acetobutylicum EA 2018]
          Length = 742

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 38/140 (27%), Positives = 64/140 (45%), Gaps = 7/140 (5%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           LI  + ++E      YR       TIGYGH          +T+++A D L +D   + N 
Sbjct: 593 LITFIGQYESFSPVPYRGADYQNRTIGYGHVIQPGENLSYLTDEQARDLLQRDIQNTTNA 652

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK----KWT 147
           +   +  LK T +N+  ++ DF +N GI     S   + + A +   +A+  K     W+
Sbjct: 653 VSSITSGLKLT-QNQFDSLVDFAYNCGISALESSILLKNIKAGN--TSADTLKTNFISWS 709

Query: 148 KAGGKVLPGLVKRRDAEVKL 167
              G+ L GL +RR  E ++
Sbjct: 710 YCNGEELLGLWRRRMDEWQM 729


>gi|85374412|ref|YP_458474.1| hypothetical protein ELI_07925 [Erythrobacter litoralis HTCC2594]
 gi|84787495|gb|ABC63677.1| hypothetical protein ELI_07925 [Erythrobacter litoralis HTCC2594]
          Length = 193

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 71/146 (48%), Gaps = 9/146 (6%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKDASKS 88
           L + + E EG+RLT YRD+  G  T+G GH      ++  G  I+E  A  F  +D +K+
Sbjct: 41  LKEAMIEEEGVRLTVYRDV-AGYPTVGVGHLVLASDNLAVGERISEDRALRFFERDLAKA 99

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYN---KSTFKQRVDAQDWEKAAEECKK 145
             ++++    ++   ++   A+ D  FN+G G  +          + A+D +K  EE   
Sbjct: 100 KRVVVDLVGDVR-LYQHEFDALVDLAFNVGEGTLSPDKSPRLNAAIAARDHDKMVEEL-S 157

Query: 146 WTKAGGKVLPGLVKRRDAEVKLLLES 171
           +  A G V  GLV R +    + +++
Sbjct: 158 YHHAKGSVANGLVYRSERRANIFVDA 183


>gi|215919088|ref|NP_820035.2| phage lysozyme [Coxiella burnetii RSA 493]
 gi|206583973|gb|AAO90549.2| lysozyme [Coxiella burnetii RSA 493]
          Length = 146

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D   G WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 12  LEFLKRHEGFSPHLYKD-SVGKWTIGYGRNLEDDP----LHEYEAEFLLMQDIER-LDKA 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+A +E    +W + 
Sbjct: 66  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAVKEMLNSEWAEE 125

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 126 --------VKSRATELAQLMDS 139


>gi|158423761|ref|YP_001525053.1| phage-related lysozyme [Azorhizobium caulinodans ORS 571]
 gi|158330650|dbj|BAF88135.1| phage-related lysozyme [Azorhizobium caulinodans ORS 571]
          Length = 253

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 59/122 (48%), Gaps = 12/122 (9%)

Query: 53  GAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDAS---KSLNLLLESSPALKSTSENR 106
           G  TIG+GHT   G     G   ++ E +  L +D +    S++ +L+  P     +++ 
Sbjct: 39  GVLTIGWGHTNDHGRAFRAGAVWSQAECDTALAQDLATLEASVSTILKDVP----LAQHE 94

Query: 107 LVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVK 166
             A+    +N  IG   +S+   ++ A    +      +W K GG+VLPGL +RR+AE  
Sbjct: 95  YDALVSMSYN--IGPLTRSSIPAKLKAGRKAEVRAVMARWNKGGGRVLPGLTRRREAEAD 152

Query: 167 LL 168
           L 
Sbjct: 153 LF 154


>gi|240950414|ref|ZP_04754665.1| putative endolysin [Actinobacillus minor NM305]
 gi|240295034|gb|EER45890.1| putative endolysin [Actinobacillus minor NM305]
          Length = 180

 Score = 50.8 bits (120), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 41/170 (24%), Positives = 72/170 (42%), Gaps = 15/170 (8%)

Query: 7   IISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---G 63
           +++ +  MI   GD+    +    A ++++   EG R   Y+       T+G G T   G
Sbjct: 18  VLTMIAVMITNYGDEFRTSV----AGLEIIGNAEGCRREPYK-CPADVLTVGVGSTAAGG 72

Query: 64  SDVTEGMTITEKEAEDFLLKD---ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
             +  G   ++ E       D   A + +N         K   ++   A     FN+G G
Sbjct: 73  EPIKVGKIYSDDEIARRWKNDVVIAERCVNRFANG----KHMPQSVFDAAVSITFNVGCG 128

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
             ++ST  ++ + +DW     E  +W  +GG+ L GL+ RR+ E  L L 
Sbjct: 129 ALSRSTMFRKANTRDWVGVCNEFPRWVYSGGRKLKGLIIRREKEKALCLS 178


>gi|161830681|ref|YP_001596697.1| phage lysozyme [Coxiella burnetii RSA 331]
 gi|161762548|gb|ABX78190.1| phage lysozyme [Coxiella burnetii RSA 331]
          Length = 144

 Score = 50.4 bits (119), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D   G WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 10  LEFLKRHEGFSPHLYKD-SVGKWTIGYGRNLEDDP----LDEYEAEFLLMQDIER-LDKA 63

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+A +E    +W + 
Sbjct: 64  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAVKEMLNSEWAEE 123

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 124 --------VKSRATELAQLMDS 137


>gi|212212550|ref|YP_002303486.1| lysozyme [Coxiella burnetii CbuG_Q212]
 gi|212010960|gb|ACJ18341.1| lysozyme [Coxiella burnetii CbuG_Q212]
          Length = 146

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D   G WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 12  LEFLKRHEGFSPHLYKD-SVGKWTIGYGRNLEDDP----LHEYEAEFLLMQDIER-LDKA 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+ A+E    +W + 
Sbjct: 66  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQTAKEMLNSEWAEE 125

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 126 --------VKSRATELAQLMDS 139


>gi|170109930|ref|XP_001886171.1| glycoside hydrolase family 24 protein [Laccaria bicolor S238N-H82]
 gi|164638755|gb|EDR03030.1| glycoside hydrolase family 24 protein [Laccaria bicolor S238N-H82]
          Length = 159

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 66/148 (44%), Gaps = 8/148 (5%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-----TGSDVTEGMTITEKEAEDFLL 82
           + +A + ++K  E L      D   G  T+GYGH       S+VT    ++   A     
Sbjct: 1   ISSATVNLIKGSESLVPIPSPD-PIGLLTVGYGHKCLKPQCSEVTFPFPLSSSTASQLFA 59

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD-AQDWEKA-A 140
           +D ++ +N L  S       ++N+  A+  + +N G      ST  +R++  +D     A
Sbjct: 60  QDMTQYINCLHRSISKSVVLNDNQFGALVSWTYNAGCEGMGTSTLVKRLNNGEDPNTVVA 119

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           +E  KW  A  K+  GLV RR+ E+   
Sbjct: 120 QELPKWNIAKKKISKGLVNRRNREISFF 147


>gi|85059177|ref|YP_454879.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779697|dbj|BAE74474.1| phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 175

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 69/141 (48%), Gaps = 14/141 (9%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           E EGLR  AY+D GGG WTI  G T      V +GM ++ ++ E     + +K+L  +  
Sbjct: 31  EKEGLRTVAYQD-GGGIWTICGGTTFVNAKPVVKGMRLSLEQCEKIDKAEQAKALAWVER 89

Query: 95  SSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV 153
           +       +E + V +A F  +++G      STF ++++A D   A  E ++W   GG+ 
Sbjct: 90  NVRV--PLTETQKVGIASFCPWSIGPARCFSSTFWKKLNAGDRRGACAEIRRWIWDGGRD 147

Query: 154 LP-------GLVKRRDAEVKL 167
                    G V RR+ E +L
Sbjct: 148 CRIRSNDCYGQVLRREQEAEL 168


>gi|170719072|ref|YP_001784226.1| glycoside hydrolase family protein [Haemophilus somnus 2336]
 gi|168827201|gb|ACA32572.1| glycoside hydrolase family 24 [Haemophilus somnus 2336]
          Length = 179

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 11/143 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ + EG R   Y        T+G G T +  + G     K   D  +  A + +N +
Sbjct: 36  LELIGQVEGCRRDPYH-CPSDVLTVGIGSTVA--SSGAIEPHKRYSDAEI--AKRWVNDI 90

Query: 93  LESSPALKSTSENRLV------AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             +   +   +  RL+      +V    FN+G G  ++ST  ++ + +DW     E  KW
Sbjct: 91  QVAERCVNQFANGRLMPQSVFDSVVSITFNVGCGKLSRSTMFRQANEKDWRGVCNEFPKW 150

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
             AGGK L GL  RR+ E  L L
Sbjct: 151 VYAGGKRLRGLEIRREKEKALCL 173


>gi|113461531|ref|YP_719600.1| lysozyme, phage-related lysozyme [Haemophilus somnus 129PT]
 gi|112823574|gb|ABI25663.1| lysozyme, possible phage-related lysozyme [Haemophilus somnus
           129PT]
          Length = 178

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 39/143 (27%), Positives = 64/143 (44%), Gaps = 11/143 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++++ + EG R   Y        T+G G T +  + G     K   D  +  A + +N +
Sbjct: 35  LELIGQVEGCRRDPYH-CPSDVLTVGIGSTVA--SSGAIEPHKRYSDAEI--AKRWVNDI 89

Query: 93  LESSPALKSTSENRLV------AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
             +   +   +  RL+      +V    FN+G G  ++ST  ++ + +DW     E  KW
Sbjct: 90  QVAERCVNQFANGRLMPQSVFDSVVSITFNVGCGKLSRSTMFRQANEKDWRGVCNEFPKW 149

Query: 147 TKAGGKVLPGLVKRRDAEVKLLL 169
             AGGK L GL  RR+ E  L L
Sbjct: 150 VYAGGKRLRGLEIRREKEKALCL 172


>gi|85058725|ref|YP_454427.1| putative phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
 gi|84779245|dbj|BAE74022.1| putative phage lysozyme lysis protein [Sodalis glossinidius str.
           'morsitans']
          Length = 108

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 48/88 (54%), Gaps = 3/88 (3%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  +G+R T YRD  GG  ++ YGHTGSD+  G   +  E +  L  D   ++ ++  
Sbjct: 24  LIQWHKGVRYTPYRD-SGGVLSVCYGHTGSDIIPGKRYSAAECQSLLDSDLKAAMAVV-- 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNY 122
            +      +E++  A+A F +N+G G +
Sbjct: 81  DANVTVPLTESQKAALASFAYNVGSGAF 108


>gi|323166839|gb|EFZ52582.1| lysozyme domain protein [Shigella sonnei 53G]
          Length = 115

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 30/85 (35%), Positives = 45/85 (52%), Gaps = 5/85 (5%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            EG+    Y+DI G  WT+ +GHTG D+  G T  E E +  L KD +    +  + +P 
Sbjct: 34  LEGVSYILYKDIIG-VWTVCHGHTGKDIMPGKTYAEAECKALLNKDLA---TVARQINPY 89

Query: 99  LK-STSENRLVAVADFVFNLGIGNY 122
           +K    E    A+  FV+N+G GN+
Sbjct: 90  IKVDIPETTRGALYSFVYNVGAGNF 114


>gi|315252126|gb|EFU32094.1| phage lysozyme [Escherichia coli MS 85-1]
          Length = 135

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 57/113 (50%), Gaps = 7/113 (6%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQD 135
           +  K+L  +  +       +E +   +A F  +N+G G    STF +R++A D
Sbjct: 81  ERDKALAWVERNIKV--PLTEPQKAGIASFCPYNIGPGKCFPSTFYKRLNAGD 131


>gi|282535282|gb|ADA82488.1| putative endolysin [Escherichia phage K1ind3]
 gi|282547383|gb|ADA82439.1| putative endolysin [Escherichia phage K1ind2]
          Length = 161

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 61/138 (44%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           +     FEG R TAYR      + TIGYGH G DVT G TIT    +  LL +   +  +
Sbjct: 10  LHFCAAFEGFRGTAYRATPNEKYLTIGYGHYGPDVTPGKTIT--PGQGLLLLNRDMAKAV 67

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR-VDAQDWEKAAEECKKWTKAG 150
               + A  S ++ +  AV D V+N G G    +T   + + + D      +   +    
Sbjct: 68  AAVDAAAHHSLTQAQFDAVCDLVYNAGAGVIASTTGTGKALRSGDTATLRAKLALFINQN 127

Query: 151 GKVLPGLVKRRDAEVKLL 168
           GK L GL +R    + L 
Sbjct: 128 GKPLLGLRRRTAGRLALF 145


>gi|282534234|gb|ADA82342.1| putative endolysin [Escherichia phage K1H]
          Length = 162

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 61/138 (44%), Gaps = 4/138 (2%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAW-TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           +     FEG R TAYR      + TIGYGH G DVT G TIT    +  LL +   +  +
Sbjct: 10  LHFCAAFEGFRGTAYRATPNEKYLTIGYGHYGPDVTPGKTIT--PGQGLLLLNRDMAKAV 67

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR-VDAQDWEKAAEECKKWTKAG 150
               + A  S ++ +  AV D V+N G G    +T   + + + D      +   +    
Sbjct: 68  AAVDAAAHHSLTQAQFDAVCDLVYNAGAGVIASTTGAGKALRSGDTATLRAKLALFINQN 127

Query: 151 GKVLPGLVKRRDAEVKLL 168
           GK L GL +R    + L 
Sbjct: 128 GKPLLGLRRRTAGRLALF 145


>gi|209363945|ref|YP_001424391.2| lysozyme [Coxiella burnetii Dugway 5J108-111]
 gi|207081878|gb|ABS78226.2| lysozyme [Coxiella burnetii Dugway 5J108-111]
          Length = 146

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 44/142 (30%), Positives = 66/142 (46%), Gaps = 17/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           ++ LK  EG     Y+D     WTIGYG    D      + E EAE  L++D  + L+  
Sbjct: 12  LEFLKRHEGFSPHLYKD-SVSKWTIGYGRNLEDDP----LHEYEAEFLLMQDIER-LDKA 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKST-FKQRVDAQDWEKAAEEC--KKWTKA 149
           L    A ++    R   + D  +NLG G   K T   Q ++ QD+E+AA+E    +W + 
Sbjct: 66  LSLHEAYQALDNERKAIILDMAYNLGYGGLMKFTHLWQALEKQDYEQAAKEMLNSEWAEE 125

Query: 150 GGKVLPGLVKRRDAEVKLLLES 171
                   VK R  E+  L++S
Sbjct: 126 --------VKSRATELAQLMDS 139


>gi|84393320|ref|ZP_00992080.1| putative phage lysozyme [Vibrio splendidus 12B01]
 gi|84376036|gb|EAP92924.1| putative phage lysozyme [Vibrio splendidus 12B01]
          Length = 196

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 59/137 (43%), Gaps = 8/137 (5%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG R   Y     G  T G G+T     + +T+ E+ A+D+++        +      A 
Sbjct: 60  EGCRFEPY-TCPAGLITNGIGNTHGVPDQPITL-EQVAKDWVVNLQGAEQCIESAEKAAK 117

Query: 100 KSTSENRLVAVADFVFNLGIGNYNK------STFKQRVDAQDWEKAAEECKKWTKAGGKV 153
           +  S+ +  A   F FN G   + K      +     +   D+E+A +E  KW   GGK 
Sbjct: 118 RPMSQGQFDAFTSFSFNTGCSRFMKNHDGSATRIFTYIKQGDYERACKELPKWVYGGGKK 177

Query: 154 LPGLVKRRDAEVKLLLE 170
           LPGL+ RR  E    +E
Sbjct: 178 LPGLMTRRGIEYARCME 194


>gi|322614002|gb|EFY10938.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 315996572]
 gi|322617894|gb|EFY14787.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 495297-1]
 gi|322625491|gb|EFY22317.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 495297-3]
 gi|322629956|gb|EFY26729.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 495297-4]
 gi|322632155|gb|EFY28906.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 515920-1]
 gi|322636495|gb|EFY33202.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 515920-2]
 gi|322643129|gb|EFY39703.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 531954]
 gi|322644650|gb|EFY41186.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. NC_MB110209-0054]
 gi|322651326|gb|EFY47710.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. OH_2009072675]
 gi|322652758|gb|EFY49097.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. CASC_09SCPH15965]
 gi|322659059|gb|EFY55311.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 19N]
 gi|322663239|gb|EFY59443.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 81038-01]
 gi|322668725|gb|EFY64878.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. MD_MDA09249507]
 gi|322674471|gb|EFY70564.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 414877]
 gi|322678322|gb|EFY74383.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 366867]
 gi|322682420|gb|EFY78441.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 413180]
 gi|322684134|gb|EFY80140.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 446600]
 gi|323192310|gb|EFZ77542.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 609458-1]
 gi|323196262|gb|EFZ81414.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 556150-1]
 gi|323201410|gb|EFZ86476.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 609460]
 gi|323206480|gb|EFZ91441.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 507440-20]
 gi|323212072|gb|EFZ96899.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 556152]
 gi|323216977|gb|EGA01700.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. MB101509-0077]
 gi|323220342|gb|EGA04796.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. MB102109-0047]
 gi|323224390|gb|EGA08679.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. MB110209-0055]
 gi|323228319|gb|EGA12450.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. MB111609-0052]
 gi|323233414|gb|EGA17507.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 2009083312]
 gi|323237125|gb|EGA21192.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 2009085258]
 gi|323243660|gb|EGA27676.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. 315731156]
 gi|323246096|gb|EGA30083.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2009159199]
 gi|323250876|gb|EGA34754.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2010008282]
 gi|323257631|gb|EGA41317.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2010008283]
 gi|323261838|gb|EGA45405.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2010008284]
 gi|323266105|gb|EGA49596.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2010008285]
 gi|323268649|gb|EGA52116.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Montevideo str. IA_2010008287]
          Length = 118

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT  +AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHVLTPDETLTFITPDQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL   SP L
Sbjct: 69 MLLQNCSPEL 78


>gi|312623270|ref|YP_004024883.1| glycoside hydrolase family 24 [Caldicellulosiruptor kronotskyensis
           2002]
 gi|312203737|gb|ADQ47064.1| glycoside hydrolase family 24 [Caldicellulosiruptor kronotskyensis
           2002]
          Length = 421

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 49/168 (29%), Positives = 84/168 (50%), Gaps = 30/168 (17%)

Query: 30  NALIKMLK--EFEG-LRLTAYRDIGGGAWTIGYGHT--GSDVTEGM---------TITEK 75
           +A+++ +K  E++G     AY D  G  WTIGYGH   G ++ E +          I E+
Sbjct: 237 DAIVEFIKIYEYKGEYSKFAYSDKDG-VWTIGYGHVLRGKELEEYVDLKTHKPKKAIIEE 295

Query: 76  EAEDFL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG-NYNKST----- 126
           +A++FL   +K A+ ++N  +E +      S+N+  A+  F FN+G     NKS+     
Sbjct: 296 KAKEFLKNDIKAAADAINEFMEENKI--QLSQNQFDALVSFTFNVGSAWTKNKSSETRND 353

Query: 127 ----FKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
                K  +D+    K  ++   WTK  G+V  GL +RR  E ++ ++
Sbjct: 354 IIKAVKSGIDSNLERKLRDDFLSWTKVQGEVWEGLQRRRYDEWEMFVK 401


>gi|251777902|ref|ZP_04820822.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243082217|gb|EES48107.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 261

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 71/156 (45%), Gaps = 21/156 (13%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V    I  +K +EG     Y D  G   T+GYG TG ++ +   +TE++A + +LKD   
Sbjct: 109 VSEKCINFIKSWEGYFSKPYYDCVGIK-TLGYGMTGKEIEDLDYVTEEQATN-MLKD--- 163

Query: 88  SLNLLLES--SPALK--------STSENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QD 135
               L+E+  +P +K        +  ++   A+  F +N G      ST  + + A  +D
Sbjct: 164 ----LIENKYAPPIKKDLISKGITLKQHEFDALVSFAYNCGTTGLLSSTLYKNIVAGIRD 219

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
                   + W+  GGK + GL KRR  E  + L +
Sbjct: 220 KNTITANFQAWSNGGGKRIDGLYKRRTKEAAMFLNA 255


>gi|317049628|ref|YP_004117276.1| glycoside hydrolase family 24 [Pantoea sp. At-9b]
 gi|316951245|gb|ADU70720.1| glycoside hydrolase family 24 [Pantoea sp. At-9b]
          Length = 171

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 40/163 (24%), Positives = 66/163 (40%), Gaps = 10/163 (6%)

Query: 2   CIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH 61
           C++  +++    + G      H  +      +K++ + EG RL  Y+    G WT G G+
Sbjct: 9   CVVGAVLAIAATLPGF--QQLHTSVEG----LKLIADAEGCRLKPYQ-CDAGKWTDGIGN 61

Query: 62  TGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN 121
           T S V  G +ITE++A    + +  +    L        +  +    A+    FN+G GN
Sbjct: 62  T-SGVVPGRSITERQAAGNFITNVLRVEAALARCVAV--TMPQQVYDALVSLAFNVGTGN 118

Query: 122 YNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
              ST    +    W  A  +  +W    G    GL  RR  E
Sbjct: 119 VCGSTMVALLKKGRWRDACLQLPRWVYVLGVFNQGLDNRRQRE 161


>gi|227823935|ref|YP_002827908.1| phage-related lysozyme [Sinorhizobium fredii NGR234]
 gi|227342937|gb|ACP27155.1| phage-related lysozyme [Sinorhizobium fredii NGR234]
          Length = 587

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 72/141 (51%), Gaps = 10/141 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGM----TITEKEAEDFLLKDASK 87
           +  ML E E + L AY D G G  TIG GHT +          TI+  EA +    D +K
Sbjct: 8   ICAMLAE-EAIVLAAYND-GTGTMTIGAGHTAAAGPPAPRAGATISLTEAINIYRNDLAK 65

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           + + +  +  A+   S+++  A+  + FN   G  + +T  ++++A D   AA E  +W 
Sbjct: 66  TESQVQAAVRAV--LSQHQFDALVSWHFN--TGAVSSATLTRKLNAGDAAGAAAEFARWN 121

Query: 148 KAGGKVLPGLVKRRDAEVKLL 168
           K+ GKVL GLV RR+ E  + 
Sbjct: 122 KSKGKVLEGLVARRERETAMF 142


>gi|102994908|gb|ABF71471.1| endolysin [Enterobacteria phage A5]
          Length = 116

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 54/100 (54%), Gaps = 9/100 (9%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL---LKDASKSLNL 91
           +++E EG++   Y+DI G  WT+ +G TG+DV  G   T +E +  L   +K A+ +++ 
Sbjct: 22  LIEEIEGVKYKPYKDIAG-IWTVCHGITGNDVILGKEYTRRECDALLAKHMKFAADAVDK 80

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV 131
            ++    L   +     A+  F FN G G + KST  +++
Sbjct: 81  AVKVEIPLSMRA-----ALYSFTFNAGTGAFRKSTMLKKI 115


>gi|257421596|ref|ZP_05598586.1| predicted protein [Enterococcus faecalis X98]
 gi|257163420|gb|EEU93380.1| predicted protein [Enterococcus faecalis X98]
 gi|315156492|gb|EFU00509.1| phage lysozyme [Enterococcus faecalis TX0043]
          Length = 375

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 68/139 (48%), Gaps = 11/139 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMT-ITEKEAEDFLLKDASKSL 89
           ++K+FEG RLTAY D+G G  TIG+GH      + +  G+T  ++ +A+    KD     
Sbjct: 149 LIKKFEGCRLTAY-DLGDGMITIGWGHAEPKGQTSLIPGVTRWSQAQADSQFWKDIKVYE 207

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           + +  +S  ++S ++N+  A+  F +N G G +    + + V         E    +   
Sbjct: 208 SAV--NSYFIRSFNQNQFDAMVSFTYNNGTGVFANWNWDRDVSNS---YITESFANYINK 262

Query: 150 GGKVLPGLVKRRDAEVKLL 168
           G +   GL +RR  E+ L 
Sbjct: 263 GTEYEEGLRRRRQEEINLF 281


>gi|315151711|gb|EFT95727.1| phage lysozyme [Enterococcus faecalis TX0012]
          Length = 375

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 40/139 (28%), Positives = 70/139 (50%), Gaps = 11/139 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMT-ITEKEAEDFLLKDASKSL 89
           ++K+FEG RLTAY D+G G  TIG+GH      + +  G+T  ++ +A+    KD     
Sbjct: 149 LIKKFEGCRLTAY-DLGDGMITIGWGHAEPKGQTSLIPGVTRWSQAQADSQFWKDIKVYE 207

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           + +  +S  ++S ++N+  A+  F +N G G +  + +    DA +     E    +   
Sbjct: 208 SAV--NSYFIRSFNQNQFDAMVSFTYNNGTGVF--ANWNWDRDASN-SYITESFANYINK 262

Query: 150 GGKVLPGLVKRRDAEVKLL 168
           G +   GL +RR  E+ L 
Sbjct: 263 GTEYEEGLRRRRQEEINLF 281


>gi|238027709|ref|YP_002911940.1| phage-related lysozyme [Burkholderia glumae BGR1]
 gi|237876903|gb|ACR29236.1| Phage-related lysozyme [Burkholderia glumae BGR1]
          Length = 256

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 62/145 (42%), Gaps = 27/145 (18%)

Query: 46  AYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTS-- 103
           A R + G  WT G+G TG DV EG T T+  A      DA    NL   ++   ++ +  
Sbjct: 111 ALRALSGAPWTCGWGSTGPDVREGTTWTQATA------DARHDANLQAAAALVDRAVTVV 164

Query: 104 --ENRLVAVADFVFNLGIGNYN-----------------KSTFKQRVDAQDWEKAAEECK 144
              +   A+   V N+G G                     ST  + ++A     AA++  
Sbjct: 165 LAPHEKAAMVSIVNNVGPGRARAAGDPGRDGIVTLASGAPSTLLRMLNAGARLAAADQFL 224

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLL 169
            W +AGG V  GL +RR AE +L L
Sbjct: 225 VWNRAGGVVSDGLKRRRAAERELFL 249


>gi|171683784|ref|XP_001906834.1| hypothetical protein [Podospora anserina S mat+]
 gi|170941852|emb|CAP67505.1| unnamed protein product [Podospora anserina S mat+]
          Length = 269

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 2/65 (3%)

Query: 105 NRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA--AEECKKWTKAGGKVLPGLVKRRD 162
           N+  A+  + FN+G G    ST   R++  +      A+E  +W   GG VLPGLV+RR+
Sbjct: 191 NQYGALISWSFNMGCGAAQTSTLVARLNKGENVNTVLAQELPRWVYGGGVVLPGLVRRRN 250

Query: 163 AEVKL 167
           AEV L
Sbjct: 251 AEVAL 255


>gi|157921544|gb|ABW02851.1| putative phage lysozyme [Aggregatibacter aphrophilus NJ8700]
          Length = 180

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 55  WTIGYGHTGSDVTEGMTITEKE-AEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADF 113
           WT G G+T +DV  G  ++++E AE +  KD  K     +      K  S+    A    
Sbjct: 55  WTDGIGNT-NDVVLGRKLSDEEIAERW--KDNIKIAENCVNRWANGKELSQGAFEAAVSI 111

Query: 114 VFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            FN+G     ++T  +     D      +  +W  + GKVLPGLVKRR+ E  L L
Sbjct: 112 TFNVGCSKLKQATLFKYARVGDINLMCNQFPRWVYSQGKVLPGLVKRRNVEKALCL 167


>gi|187934460|ref|YP_001887135.1| phage lysozyme [Clostridium botulinum B str. Eklund 17B]
 gi|187722613|gb|ACD23834.1| phage lysozyme [Clostridium botulinum B str. Eklund 17B]
          Length = 260

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 71/150 (47%), Gaps = 13/150 (8%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD--- 84
           V    I  +K +EG     Y D   G  T+GYG TG ++    +ITE +A D +LKD   
Sbjct: 108 VSEDCINFIKSWEGFFEKPYYD-AVGVLTLGYGMTGDEIKGLSSITESKASD-MLKDLIN 165

Query: 85  --ASKSLNLLLESSPA-LKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QDWEKA 139
              +K++   L+S    LK    + L++   F +N GI     ST  + + A  ++    
Sbjct: 166 NKYAKAIKKDLDSKGVNLKQCEFDALIS---FAYNCGIVGLLGSTLYKNIVAGIRNPNTI 222

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            +  + W+  GGK + GL +RR  E  + +
Sbjct: 223 TDNFQAWSNGGGKRIEGLYRRRTKEANMFI 252


>gi|251792270|ref|YP_003006992.1| lysozyme [Aggregatibacter aphrophilus NJ8700]
 gi|247533659|gb|ACS96905.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Aggregatibacter aphrophilus NJ8700]
          Length = 175

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 54/116 (46%), Gaps = 4/116 (3%)

Query: 55  WTIGYGHTGSDVTEGMTITEKE-AEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADF 113
           WT G G+T +DV  G  ++++E AE +  KD  K     +      K  S+    A    
Sbjct: 50  WTDGIGNT-NDVVLGRKLSDEEIAERW--KDNIKIAENCVNRWANGKELSQGAFEAAVSI 106

Query: 114 VFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            FN+G     ++T  +     D      +  +W  + GKVLPGLVKRR+ E  L L
Sbjct: 107 TFNVGCSKLKQATLFKYARVGDINLMCNQFPRWVYSQGKVLPGLVKRRNVEKALCL 162


>gi|163801723|ref|ZP_02195621.1| phage lysozyme [Vibrio sp. AND4]
 gi|159174640|gb|EDP59442.1| phage lysozyme [Vibrio sp. AND4]
          Length = 195

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 71/146 (48%), Gaps = 12/146 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL--LKDASKSLN 90
           + ++   EG RL  Y     G  T G G+T +  +  +++ +  A+D++  L+ A + + 
Sbjct: 52  LAIVGNMEGCRLEPY-TCPSGLTTNGIGNTHNVPSRTISMNQV-AKDWVKNLQGAERCIT 109

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNY--NKSTFKQRVD----AQDWEKAAEECK 144
            + + S  +   S+ +  A   F FN G   +  N    + R+     A+ +E+A  +  
Sbjct: 110 RVEKQSELV--LSQGQFDAFVSFAFNTGCPRFERNPDGSQTRIFRDLLARRYEQACNQLP 167

Query: 145 KWTKAGGKVLPGLVKRRDAEVKLLLE 170
           +W    GK LPGLVKRR AE +  +E
Sbjct: 168 RWVYGAGKKLPGLVKRRRAEYERCME 193


>gi|229587205|ref|YP_002845706.1| Lysozyme [Rickettsia africae ESF-5]
 gi|228022255|gb|ACP53963.1| Lysozyme [Rickettsia africae ESF-5]
          Length = 68

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/61 (39%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 103 SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA-GGKVLPGLVKRR 161
           +EN+   +  F+FN G G +  ST +Q+++  ++  AA E  +W  A GG  L GLVKRR
Sbjct: 4   TENQQAVLISFIFNCGAGAFQASTLQQKLNRGEYANAANELLRWMCAKGGLKLQGLVKRR 63

Query: 162 D 162
            
Sbjct: 64  Q 64


>gi|49475660|ref|YP_033701.1| hypothetical protein BH08990 [Bartonella henselae str. Houston-1]
 gi|49238467|emb|CAF27695.1| Phage-related protein [Bartonella henselae str. Houston-1]
          Length = 153

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 35/58 (60%)

Query: 114 VFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           + N+GI  +  ST  ++++  D+E    E +KWTKAGGK L  LV RR AE  L  +S
Sbjct: 24  LVNIGIAAFQNSTLLKKLNKGDYESVPIELQKWTKAGGKRLKDLVHRRAAEAGLWAKS 81


>gi|71276167|ref|ZP_00652447.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71898332|ref|ZP_00680505.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
 gi|71163085|gb|EAO12807.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71731855|gb|EAO33913.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
          Length = 82

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/56 (42%), Positives = 38/56 (67%), Gaps = 1/56 (1%)

Query: 115 FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           FN+G+G +++ST  +R++A D   AA++   W  AGG+V  GL+ RR AE ++L E
Sbjct: 6   FNIGVGAFHRSTLLKRLNAGDVAGAAQQFHVWKWAGGRVQSGLIIRRAAE-RVLFE 60


>gi|71274672|ref|ZP_00650960.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71901599|ref|ZP_00683680.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
 gi|71164404|gb|EAO14118.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71728647|gb|EAO30797.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
          Length = 80

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/54 (42%), Positives = 35/54 (64%)

Query: 115 FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           FN+G+G +++ST  +R++A D   AA++   W  AGG+V  GL+ RR AE  L 
Sbjct: 6   FNIGVGAFHRSTLLKRLNAGDVAGAAQQFHVWKWAGGRVQSGLIIRRAAERALF 59


>gi|332160987|ref|YP_004297564.1| Lysozyme [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|325665217|gb|ADZ41861.1| Lysozyme [Yersinia enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862144|emb|CBX72308.1| lysozyme [Yersinia enterocolitica W22703]
          Length = 176

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 67/144 (46%), Gaps = 14/144 (9%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNL 91
            L E EG RL+AYRD G G  TI  G T   G  V  GM +T  +      K+A+ ++  
Sbjct: 29  FLDEKEGNRLSAYRD-GMGKPTICRGVTFIDGKPVQMGMALTATQCNKLNQKEAAAAIAW 87

Query: 92  LLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           +  +       +E +   +A F  +N+G      STF  ++++ D   A  E K+W + G
Sbjct: 88  VERNVHV--PLTEPQKAGIASFCPYNIGPAKCLPSTFYYKLNSGDRIGACAEIKRWIRDG 145

Query: 151 GK-------VLPGLVKRRDAEVKL 167
           GK          G ++RR  E +L
Sbjct: 146 GKDCRIRSNNCYGQIERRAQESEL 169


>gi|238897632|ref|YP_002923311.1| phage lysozyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
 gi|229465389|gb|ACQ67163.1| phage lysozyme [Candidatus Hamiltonella defensa 5AT (Acyrthosiphon
           pisum)]
          Length = 121

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 59/118 (50%), Gaps = 10/118 (8%)

Query: 57  IGYGHTGSDVTEGMTITEKEAEDFLLKDA---SKSLNLLLESSPALKSTSENRLVAVADF 113
           I YGHT S V  G  IT ++AE F  +D    +  LN L++        ++N+  A+   
Sbjct: 4   INYGHT-SGVQAGDVITPEQAEAFFREDIPIITAHLNQLIKVR-----VNQNQFDALVSL 57

Query: 114 VFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           +F +G   +  ST  +++++    +  ++C    +     LPGLV RR  E K+L ES
Sbjct: 58  IFKIGSRVFAVSTLLKKLNSGAAAEFPKDCHGTVQGKKMPLPGLVARRQKE-KVLFES 114


>gi|15893221|ref|NP_360935.1| putative lysozyme [Rickettsia conorii str. Malish 7]
 gi|15620437|gb|AAL03836.1| lysozyme-like protein [Rickettsia conorii str. Malish 7]
          Length = 67

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/60 (40%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 103 SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA-GGKVLPGLVKRR 161
           +EN+  A+  F+FN G G +  ST +Q+++  ++  AA E  +W  A GG  L GLVKR+
Sbjct: 4   TENQQAALISFIFNCGAGAFQASTLQQKLNRGEYANAANELLRWMCAKGGLKLQGLVKRQ 63


>gi|87302368|ref|ZP_01085193.1| WD-40 repeat protein [Synechococcus sp. WH 5701]
 gi|87283293|gb|EAQ75249.1| WD-40 repeat protein [Synechococcus sp. WH 5701]
          Length = 657

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 36/148 (24%), Positives = 69/148 (46%), Gaps = 17/148 (11%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHT--------------GSDVTEGMTITEKEAED 79
           +++  +EGL L    D  G    IG+ H               G ++     IT+ +AED
Sbjct: 508 QLVISYEGLDLKPRIDSLGNT-VIGFNHVLTEKEVSTKRISIKGKEINFQGGITKIQAED 566

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKA 139
            L +D   S  L+ E        + N+  A+  F+F++G+  + +S   + ++     + 
Sbjct: 567 LLNQDLEPSRKLVKELVKV--QLNSNQKTALVQFIFSIGLEAFKESELLKVLNEGRHNEV 624

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKL 167
            ++ ++WT  G K   GL K+R++E++L
Sbjct: 625 PDQMRRWTNVGDKASLGLKKKRESEIEL 652


>gi|206563765|ref|YP_002234528.1| putative phage lysozyme [Burkholderia cenocepacia J2315]
 gi|198039805|emb|CAR55778.1| putative phage lysozyme [Burkholderia cenocepacia J2315]
          Length = 184

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 68/138 (49%), Gaps = 10/138 (7%)

Query: 39  FEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           +EG R T Y+D GG + T+  GHT   G++     T T +E    L+KD +K    L  S
Sbjct: 28  WEGWRNTVYKDQGGVS-TVCAGHTDRIGTENITKQTYTNEECGRILIKDLNKDEAQLRAS 86

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA----GG 151
                  ++ + V + DFV NLGIG  N  + +  +   D  KA  +  ++  A    GG
Sbjct: 87  IGYDVPLTQGQEVILIDFVHNLGIGALNAGSLRPLLLRGDVNKACAKILEYKYARVGPGG 146

Query: 152 KV--LPGLVKRRDAEVKL 167
            +  + GL  RR+AE ++
Sbjct: 147 SLQEVKGLRLRREAENRV 164


>gi|293392339|ref|ZP_06636668.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
 gi|291425156|gb|EFE98356.1| conserved hypothetical protein [Serratia odorifera DSM 4582]
          Length = 175

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/150 (28%), Positives = 72/150 (48%), Gaps = 14/150 (9%)

Query: 29  PNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDA 85
           P  + +   E EG RLTAY+D G G  TI  G T   G  V +G  +T ++ +     + 
Sbjct: 22  PVMMSQFQGEKEGQRLTAYQD-GVGILTICGGVTMVNGQKVVKGQRLTAEQCKQIDAVEQ 80

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            K+++ +  +     + +E + V +A F  +N+G G    STF ++++A D   A  E +
Sbjct: 81  KKAIDWVDRNVKV--TLTEPQKVGIASFCPWNIGPGKCFTSTFYKKLNAGDRIGACREIR 138

Query: 145 KWTKAGGKVLP-------GLVKRRDAEVKL 167
           +W    G+          G + RRD E +L
Sbjct: 139 RWIYDAGRDCRIRSNNCYGQILRRDQEAEL 168


>gi|229844496|ref|ZP_04464636.1| putative endolysin [Haemophilus influenzae 6P18H1]
 gi|229812745|gb|EEP48434.1| putative endolysin [Haemophilus influenzae 6P18H1]
          Length = 180

 Score = 48.5 bits (114), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           +     FN+G G  +KST  + + A+ +EKA  E  +W  A GK L GLV RR+ E  L 
Sbjct: 114 SAVSITFNVGCGAVSKSTMFKYLRAKQYEKACGEFPRWVYASGKKLAGLVVRREKEKALC 173

Query: 169 L 169
           L
Sbjct: 174 L 174


>gi|168206526|ref|ZP_02632531.1| Gp15 protein [Clostridium perfringens E str. JGS1987]
 gi|170662048|gb|EDT14731.1| Gp15 protein [Clostridium perfringens E str. JGS1987]
          Length = 984

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 70/146 (47%), Gaps = 12/146 (8%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKDASK--- 87
           +I  +K  EG     Y D   G  T+GYG T  ++    + ++E  A  +L+ + +    
Sbjct: 801 IIYYVKGIEGYAPYHYYD-SVGVKTLGYGMTRKELNGVSVPLSETSATHYLVNNFNNLYY 859

Query: 88  --SLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKST---FKQRVDAQDWEKAAEE 142
              LN+L   +    +  +  + A+A F +N G+G+         K+ V  +  E    E
Sbjct: 860 VPVLNML--KARGATNMLQREVDALASFAYNCGLGSNGLGGSQLLKKYVAGERGESIHNE 917

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLL 168
            KKW   GG+VLPGLV+RR+ E K+ 
Sbjct: 918 FKKWVHGGGEVLPGLVRRREEEWKIF 943


>gi|145631709|ref|ZP_01787471.1| putative endolysin [Haemophilus influenzae R3021]
 gi|144982652|gb|EDJ90194.1| putative endolysin [Haemophilus influenzae R3021]
          Length = 180

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           +     FN+G G  +KST  + + A+ +EKA  E  +W  A GK L GLV RR+ E  L 
Sbjct: 114 SAVSITFNVGCGAVSKSTMFKYLRAKQYEKACGEFPRWVYASGKKLAGLVVRREKEKALC 173

Query: 169 L 169
           L
Sbjct: 174 L 174


>gi|188580669|ref|YP_001924114.1| glycoside hydrolase family 24 [Methylobacterium populi BJ001]
 gi|179344167|gb|ACB79579.1| glycoside hydrolase family 24 [Methylobacterium populi BJ001]
          Length = 209

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 59/129 (45%), Gaps = 12/129 (9%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHT---GSDVTE-GMTITEKEAEDFLLKDASKSLNLLLES 95
           EG RL AYRD   G WTIG GHT   G  +   G+ I   EA+    +D +  +  + E+
Sbjct: 15  EGRRLEAYRD-SVGVWTIGIGHTAAAGPPIPRAGLRIDAAEADAIFARDVAAFVRTVAEA 73

Query: 96  SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            P  +   ++   A+    FN+G   + +S+  +R+ A D   A E    W +       
Sbjct: 74  LP--EPLPQHAFDALVSLCFNIGPAAFRRSSVLRRLRAGDRLGAGEAILMWNRPA----- 126

Query: 156 GLVKRRDAE 164
            ++ RR  E
Sbjct: 127 AIIPRRQGE 135


>gi|301168956|emb|CBW28552.1| DLP12 prophage; predicted lysozyme [Haemophilus influenzae 10810]
          Length = 180

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/61 (40%), Positives = 34/61 (55%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           +     FN+G G  +KST  + + A+ +EKA  E  +W  A GK L GLV RR+ E  L 
Sbjct: 114 SAVSITFNVGCGAVSKSTMFKYLRAKQYEKACGEFPRWVYASGKKLAGLVVRREKEKALC 173

Query: 169 L 169
           L
Sbjct: 174 L 174


>gi|188588773|ref|YP_001921087.1| putative phage lysozyme [Clostridium botulinum E3 str. Alaska E43]
 gi|188499054|gb|ACD52190.1| putative phage lysozyme [Clostridium botulinum E3 str. Alaska E43]
          Length = 262

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 66/154 (42%), Gaps = 17/154 (11%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V    I  +K +EG   T Y D  G   T+GYG TG ++     +TE +A   L +  +K
Sbjct: 110 VSTICIDFIKSWEGYFATPYIDCVGVK-TLGYGMTGKEIEGLEYVTEGQATSMLKEWINK 168

Query: 88  SLNLLLESSPALKSTSENRLV--------AVADFVFNLGIGNYNKSTFKQRV--DAQDWE 137
                   +P +K   E++ V        A+  F +N G      ST  + V    +D +
Sbjct: 169 KY------APTIKKDLESKNVNLKQHEFDALVSFTYNCGTSGLLGSTLYKNVCNGIRDKD 222

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
                 + W+  GG+ + GL +RR  E  + L +
Sbjct: 223 TITSNFQAWSNGGGRRIEGLYRRRTKEAAMFLSA 256


>gi|227220|prf||1617096B lysozyme
          Length = 163

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 56/112 (50%), Gaps = 8/112 (7%)

Query: 53  GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVAD 112
           G +T GYGHTG++     +IT  EA + L +D + + + +  +  A  S ++ +  A+ D
Sbjct: 32  GLYTWGYGHTGTNPPR--SITRAEALELLKRDVAYAEDCV--NKYAHPSINQAQFDALVD 87

Query: 113 FVFNLGIG----NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKR 160
            V N G G    +   + F   V   DW K      ++ K GG VL GLV+R
Sbjct: 88  LVINAGPGPIVPDDVANDFDDAVRLGDWAKVRAILPQFRKQGGSVLLGLVRR 139


>gi|170749049|ref|YP_001755309.1| glycoside hydrolase family protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170655571|gb|ACB24626.1| glycoside hydrolase family 24 [Methylobacterium radiotolerans JCM
           2831]
          Length = 196

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 61/134 (45%), Gaps = 5/134 (3%)

Query: 39  FEGLRLTAYRDIGGG--AWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESS 96
           FEGLR TAY D   G   WT  +G T   +  G T T  E +  L +   K   L +E+ 
Sbjct: 64  FEGLRTTAYPDPATGREPWTACFGET-EGIRRGDTFTVAECKAMLARSLEK-YALRMEAC 121

Query: 97  PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPG 156
              +  ++    A     +N+  G + KS+  +  +A +   + +   ++ +A G  +P 
Sbjct: 122 -VTRPMADETYAAFLSLSYNVDSGGFCKSSVARLWNAGESRASYDAMLRFNRAAGVTMPV 180

Query: 157 LVKRRDAEVKLLLE 170
           L +RR  E  L L+
Sbjct: 181 LTRRRTQERALCLK 194


>gi|161616657|ref|YP_001590623.1| hypothetical protein SPAB_04474 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|168232437|ref|ZP_02657495.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Kentucky str. CDC 191]
 gi|168260661|ref|ZP_02682634.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|168465109|ref|ZP_02699001.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|194470230|ref|ZP_03076214.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|197250073|ref|YP_002148533.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|204928844|ref|ZP_03220043.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|238910367|ref|ZP_04654204.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Tennessee str. CDC07-0191]
 gi|161366021|gb|ABX69789.1| hypothetical protein SPAB_04474 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|194456594|gb|EDX45433.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|195632162|gb|EDX50646.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197213776|gb|ACH51173.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|204322277|gb|EDZ07475.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205333198|gb|EDZ19962.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Kentucky str. CDC 191]
 gi|205350211|gb|EDZ36842.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
          Length = 118

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT ++AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHMLTPDETLTFITPEQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 69 MLLQNCLPEL 78


>gi|158334004|ref|YP_001515176.1| hypothetical protein AM1_0818 [Acaryochloris marina MBIC11017]
 gi|158304245|gb|ABW25862.1| hypothetical protein AM1_0818 [Acaryochloris marina MBIC11017]
          Length = 501

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/137 (29%), Positives = 61/137 (44%), Gaps = 12/137 (8%)

Query: 43  RLTAYRDI----GGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           R+ AY D     GG   TIG+G T    GS +  G  IT+ EA+D       K   L L+
Sbjct: 133 RIQAYPDPRAGSGGLPVTIGWGSTYYKNGSAIQMGDIITQAEADDLYDYICHKDFWLKLQ 192

Query: 95  SS-PALKSTSENRLVAVADFVFNLG---IGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG 150
           S+ P     ++ +  A+  F +N G    G+ N  T  + +  +DW+        +    
Sbjct: 193 STIPYWDDMTDLQRAALTSFAYNNGADFYGSPNHRTITRNLKDKDWQAVPGTLMMYRNPS 252

Query: 151 GKVLPGLVKRRDAEVKL 167
             V  GL +RR AE K+
Sbjct: 253 ENVEVGLGRRRYAEAKV 269


>gi|251781163|ref|ZP_04824083.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243085478|gb|EES51368.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 260

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 42/156 (26%), Positives = 71/156 (45%), Gaps = 21/156 (13%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASK 87
           V +  I  +K +EG     Y D  G   T+GYG TG ++ EG+    +E    +LKD   
Sbjct: 108 VSSKCIDFIKSWEGYFAKPYYDCVGVK-TLGYGMTGKEI-EGLEYVTEEQATNMLKD--- 162

Query: 88  SLNLLLES--SPALK--------STSENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QD 135
               L+E+  +PA+K        +  ++   A+  F +N G+     ST  + + +  +D
Sbjct: 163 ----LIENKYAPAVKKDLDSKNITLKQHEFDALISFAYNCGVVGLVGSTLYKNIVSGIRD 218

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
                   + W+  GGK + GL +RR  E  + L +
Sbjct: 219 KNIITSNFQVWSNGGGKRIEGLYRRRIKEAAMFLSA 254


>gi|294661142|ref|YP_003573017.1| hypothetical protein Aasi_1537 [Candidatus Amoebophilus asiaticus
           5a2]
 gi|227336292|gb|ACP20889.1| hypothetical protein Aasi_1537 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 583

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 75/152 (49%), Gaps = 14/152 (9%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD 84
           +  A +  +  +EG  L  Y+D+  G  TIGYGH      D ++   IT K+A + L +D
Sbjct: 432 ISQAGLNFIASYEGCSLKVYKDV-AGIETIGYGHVVLPREDFSK--EITHKKALELLHQD 488

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDW--EKAAEE 142
           A +++  +   S       +++  A+  F FN+G     +S   + ++++D   EK  E 
Sbjct: 489 ADEAIRGV--KSQVKVPLLQHQFDALVSFTFNVGSKALKESRLLKLINSRDMEPEKIREA 546

Query: 143 CKKWTKA--GGKV--LPGLVKRRDAEVKLLLE 170
             ++ KA   G +  + GLV RR  E KL LE
Sbjct: 547 FLRFRKAKINGVLTDVQGLVNRRGTEAKLFLE 578


>gi|296425665|ref|XP_002842360.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295638625|emb|CAZ86551.1| unnamed protein product [Tuber melanosporum]
          Length = 265

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 46/90 (51%), Gaps = 7/90 (7%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGM--TITEKEAEDFLLKDASK 87
           IKM+K+ EG R   Y+D   G  TIGYGH   T     E +   ITEKEAED ++KD  +
Sbjct: 160 IKMIKKLEGFRGDIYKD-QVGVDTIGYGHNCVTAPGTCEALNPPITEKEAEDLMMKDMEQ 218

Query: 88  SLNLLLESSPALKSTSENRLVAVADFVFNL 117
               + +  P  +  + N+  ++  +V   
Sbjct: 219 FEKCVCD-LPNSEELTSNQFCSMVRYVCTF 247


>gi|213426508|ref|ZP_03359258.1| putative phage endolysin [Salmonella enterica subsp. enterica
           serovar Typhi str. E02-1180]
          Length = 106

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
           +A I  +K+++GL L  YRD  G  W IGYGH  +       IT  +AE FLL D +   
Sbjct: 10  SACIAFIKQWQGLSLEKYRDRQGN-WVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCD 68

Query: 90  NLLLESSPALK 100
            LL    P L 
Sbjct: 69  MLLQNCLPELN 79


>gi|300714699|ref|YP_003739502.1| Lysozyme [Erwinia billingiae Eb661]
 gi|299060535|emb|CAX57642.1| Lysozyme [Erwinia billingiae Eb661]
          Length = 181

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 13/173 (7%)

Query: 7   IISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDV 66
           ++ FV  +IG+ G +   ++      ++++ + EG R   Y        T G G T +D+
Sbjct: 8   VVCFVTVIIGIVGVEYSGQVRTSPQGLELIGDAEGCRRDPY-ICPADKLTAGIGST-TDI 65

Query: 67  TEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNY---- 122
             G   T++E     ++D  ++    ++ +      ++ +  A+    FN+G  N     
Sbjct: 66  RAGHLYTDEEITAMWVEDIRRA-ERCIDRNFNGSLLNQGQFDAMTSAAFNMGCLNLMWFT 124

Query: 123 ------NKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
                  ++T  +   A+ W         +  A G+ LPGLVKRR+AE  + L
Sbjct: 125 DRQGVKQRTTIWRHAQARRWADMCNRLPDFVNAAGRKLPGLVKRREAERLICL 177


>gi|167549171|ref|ZP_02342930.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|205325677|gb|EDZ13516.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
          Length = 118

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 37/70 (52%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT ++AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHMLTPDETLTFITPEQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 69 ILLQNCLPEL 78


>gi|62182109|ref|YP_218526.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|62129742|gb|AAX67445.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|322716597|gb|EFZ08168.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
          Length = 118

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT  +AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 69 MLLQNCLPEL 78


>gi|213027870|ref|ZP_03342317.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. 404ty]
          Length = 135

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD  G  W IGYGH  +       IT  +AE FLL D +   
Sbjct: 27 SACIAFIKQWQGLSLEKYRDRQGN-WVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCD 85

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 86 MLLQNCLPEL 95


>gi|16762697|ref|NP_458314.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. CT18]
 gi|29144184|ref|NP_807526.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. Ty2]
 gi|213052819|ref|ZP_03345697.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. E00-7866]
 gi|213419229|ref|ZP_03352295.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. E01-6750]
 gi|213580127|ref|ZP_03361953.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. E98-0664]
 gi|213616369|ref|ZP_03372195.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. E98-2068]
 gi|213647459|ref|ZP_03377512.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. J185]
 gi|289812419|ref|ZP_06543048.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. AG3]
 gi|289824323|ref|ZP_06543916.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. E98-3139]
 gi|25380781|pir||AH0986 phage-like lysozyme [imported] - Salmonella enterica subsp.
          enterica serovar Typhi (strain CT18)
 gi|16505003|emb|CAD08020.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi]
 gi|29139821|gb|AAO71386.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhi str. Ty2]
          Length = 118

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT  +AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 69 MLLQNCLPEL 78


>gi|168235204|ref|ZP_02660262.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|168818574|ref|ZP_02830574.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|194738209|ref|YP_002116542.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|200388375|ref|ZP_03214987.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|224585402|ref|YP_002639201.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Paratyphi C strain RKS4594]
 gi|194713711|gb|ACF92932.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|197291290|gb|EDY30642.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. SL480]
 gi|199605473|gb|EDZ04018.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|205344577|gb|EDZ31341.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|224469930|gb|ACN47760.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Paratyphi C strain RKS4594]
 gi|320088024|emb|CBY97786.1| probable lysozyme Lysis protein; Muramidase; Endolysin; P13
          [Salmonella enterica subsp. enterica serovar
          Weltevreden str. 2007-60-3289-1]
          Length = 118

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT  +AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 69 MLLQNCLPEL 78


>gi|108811733|ref|YP_647500.1| phage lysozyme [Yersinia pestis Nepal516]
 gi|145598326|ref|YP_001162402.1| phage lysozyme [Yersinia pestis Pestoides F]
 gi|149365973|ref|ZP_01888008.1| putative phage lysozyme [Yersinia pestis CA88-4125]
 gi|162421375|ref|YP_001606632.1| lysozyme [Yersinia pestis Angola]
 gi|165927684|ref|ZP_02223516.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165939399|ref|ZP_02227947.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|166009418|ref|ZP_02230316.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166210952|ref|ZP_02236987.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|167420442|ref|ZP_02312195.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167424679|ref|ZP_02316432.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|167468193|ref|ZP_02332897.1| lysozyme [Yersinia pestis FV-1]
 gi|218929205|ref|YP_002347080.1| putative phage lysozyme [Yersinia pestis CO92]
 gi|229897517|ref|ZP_04512673.1| putative phage lysozyme [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|229898162|ref|ZP_04513310.1| putative phage lysozyme [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229902024|ref|ZP_04517145.1| putative phage lysozyme [Yersinia pestis Nepal516]
 gi|270490800|ref|ZP_06207874.1| phage lysozyme [Yersinia pestis KIM D27]
 gi|294503846|ref|YP_003567908.1| putative phage lysozyme [Yersinia pestis Z176003]
 gi|108775381|gb|ABG17900.1| phage lysozyme [Yersinia pestis Nepal516]
 gi|115347816|emb|CAL20734.1| putative phage lysozyme [Yersinia pestis CO92]
 gi|145210022|gb|ABP39429.1| phage lysozyme [Yersinia pestis Pestoides F]
 gi|149292386|gb|EDM42460.1| putative phage lysozyme [Yersinia pestis CA88-4125]
 gi|162354190|gb|ABX88138.1| lysozyme [Yersinia pestis Angola]
 gi|165912740|gb|EDR31369.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Orientalis str. IP275]
 gi|165920298|gb|EDR37575.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Orientalis str. F1991016]
 gi|165991973|gb|EDR44274.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Antiqua str. E1979001]
 gi|166208132|gb|EDR52612.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Antiqua str. B42003004]
 gi|166962137|gb|EDR58158.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Orientalis str. MG05-1020]
 gi|167056561|gb|EDR66330.1| lysozyme (Lysis protein) (Muramidase) (Endolysin)(Protein gp17)
           [Yersinia pestis biovar Mediaevalis str. K1973002]
 gi|229680920|gb|EEO77015.1| putative phage lysozyme [Yersinia pestis Nepal516]
 gi|229688728|gb|EEO80796.1| putative phage lysozyme [Yersinia pestis biovar Orientalis str.
           India 195]
 gi|229693854|gb|EEO83903.1| putative phage lysozyme [Yersinia pestis biovar Orientalis str.
           PEXU2]
 gi|262362035|gb|ACY58756.1| putative phage lysozyme [Yersinia pestis D106004]
 gi|262365829|gb|ACY62386.1| putative phage lysozyme [Yersinia pestis D182038]
 gi|270339304|gb|EFA50081.1| phage lysozyme [Yersinia pestis KIM D27]
 gi|294354305|gb|ADE64646.1| putative phage lysozyme [Yersinia pestis Z176003]
 gi|320015223|gb|ADV98794.1| putative phage lysozyme [Yersinia pestis biovar Medievalis str.
           Harbin 35]
          Length = 170

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 63/145 (43%), Gaps = 15/145 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE-AEDFLLKDASKSLNL 91
           ++++   E  R   Y     G  T G G+T   V  G+  T+ + AED+         N+
Sbjct: 35  LELIGNAESCRRDPY-ACPAGVLTDGIGNT-HGVKAGVIKTDTQIAEDW-------EKNI 85

Query: 92  LLESSPALKSTSENRLV-----AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
           L      ++  + N+L      A     FN G     KST  +   A +   A E+  +W
Sbjct: 86  LDAERCVIRYANGNKLPPSAFDAATSISFNAGCSLMQKSTMFKYFRAGNVTAACEQFPRW 145

Query: 147 TKAGGKVLPGLVKRRDAEVKLLLES 171
              GGK LPGLV RR+ E  L LES
Sbjct: 146 IYGGGKKLPGLVTRREKEKALCLES 170


>gi|226328104|ref|ZP_03803622.1| hypothetical protein PROPEN_01995 [Proteus penneri ATCC 35198]
 gi|225203808|gb|EEG86162.1| hypothetical protein PROPEN_01995 [Proteus penneri ATCC 35198]
          Length = 100

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 34/53 (64%), Gaps = 2/53 (3%)

Query: 33 IKMLKEFEG-LRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
          + ++  FEG +R   YRD+ G   T+ YGHTG+D+ +  T T++E ++ L KD
Sbjct: 20 LTVISYFEGGVRYEPYRDVAG-ILTVCYGHTGNDIIQSKTYTQQECDELLQKD 71


>gi|302383507|ref|YP_003819330.1| glycoside hydrolase family 24 [Brevundimonas subvibrioides ATCC
           15264]
 gi|302194135|gb|ADL01707.1| glycoside hydrolase family 24 [Brevundimonas subvibrioides ATCC
           15264]
          Length = 514

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 30/93 (32%), Positives = 49/93 (52%), Gaps = 4/93 (4%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG R  A R   GG W IGYGHT S   EG +++E +AE  L  D       +
Sbjct: 8   IILIKSFEGFRPRAIRREDGG-WVIGYGHTLS-AREGASVSEADAELLLRYDLLPVEKTV 65

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNKS 125
             +  A+   ++++  A+  F +++G+  +  S
Sbjct: 66  NHAGSAV--LNQHQFDALVSFAYSVGVDRFQTS 96


>gi|254192044|ref|ZP_04898544.1| phage lysozyme [Burkholderia pseudomallei Pasteur 52237]
 gi|157987866|gb|EDO95631.1| phage lysozyme [Burkholderia pseudomallei Pasteur 52237]
          Length = 168

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 63/161 (39%), Gaps = 26/161 (16%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D   G  T   G T  DV  G   +E E    L          
Sbjct: 9   LFSVVPKFEGVKLVGYLD-PVGIPTKCMGDT-RDVVVGRAYSEAECRSSLETQLIAHAEP 66

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P L+     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 67  VLRCTPGLRG-RPYQLAAAVSFAYNVGAHAYCNSTTAKRFNAGDLRGACRAINESDSGRP 125

Query: 145 KWTKAGGKV---------------LPGLVKRRDAEVKLLLE 170
           +W  A  +                LPGLVKRR AE + L E
Sbjct: 126 QWVFANCRTVIDPKTKKPLPVCDTLPGLVKRR-AEERALCE 165


>gi|161504512|ref|YP_001571624.1| hypothetical protein SARI_02625 [Salmonella enterica subsp. arizonae
            serovar 62:z4,z23:-- str. RSK2980]
 gi|160865859|gb|ABX22482.1| hypothetical protein SARI_02625 [Salmonella enterica subsp. arizonae
            serovar 62:z4,z23:--]
          Length = 1032

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 69/145 (47%), Gaps = 13/145 (8%)

Query: 34   KMLKEFEGLRLTAYRDIGGGAWTIGYGH-TGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
            + +KE+EGLR  AY D   G  TIGYGH    D  E +T+ ++ +     + A++     
Sbjct: 884  QFIKEWEGLRTEAYND-SEGYCTIGYGHLIARDRCESITLPDEFSHGITQERANELFEER 942

Query: 93   LESS-PALKSTSENRLV-----AVADFVFNLGIG--NYNKSTFKQRVDAQDWEKAAEECK 144
            L S    +KS+   +L      A+   +FN+G           + +++ +D+E AA+E  
Sbjct: 943  LPSYVDGVKSSVSVKLYQYEFDALVCLLFNIGSSGLRLKAPMLRNKLNQEDYEGAAQEFL 1002

Query: 145  KWTKAGGKVLPGLVKRRDAEVKLLL 169
              T  G     GLV RR +E  L L
Sbjct: 1003 DITNGGES---GLVARRISENNLFL 1024


>gi|282554633|ref|YP_003347650.1| endolysin [Klebsiella phage KP34]
 gi|262410466|gb|ACY66730.1| endolysin [Klebsiella phage KP34]
          Length = 202

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           A+  +++  EGL LTAY+D  G   TI YG T   V  G   +  + +  L++ A +   
Sbjct: 20  AITGVVQHNEGLSLTAYKDSAGIP-TICYGET-KGVKMGQRASLNDCQKQLIQSAGEHAK 77

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
            L +  P     S+  LV   DF++N+G+  +N S  K+ + + D+  A +    W
Sbjct: 78  AL-DGLPM--QLSDVALVGSIDFIYNVGVAGFNGSAVKRHLKSLDYAAAGKAVLDW 130


>gi|16766891|ref|NP_462506.1| phage endolysin [Salmonella enterica subsp. enterica serovar
          Typhimurium str. LT2]
 gi|56415509|ref|YP_152584.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Paratyphi A str. ATCC 9150]
 gi|167990826|ref|ZP_02571925.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|168241763|ref|ZP_02666695.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|194446112|ref|YP_002042853.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194450046|ref|YP_002047633.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|197265450|ref|ZP_03165524.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197364435|ref|YP_002144072.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Paratyphi A str. AKU_12601]
 gi|198245053|ref|YP_002217565.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|205354777|ref|YP_002228578.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Gallinarum str. 287/91]
 gi|207858843|ref|YP_002245494.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Enteritidis str. P125109]
 gi|16422167|gb|AAL22465.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|56129766|gb|AAV79272.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Paratyphi A str. ATCC 9150]
 gi|194404775|gb|ACF64997.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194408350|gb|ACF68569.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|197095912|emb|CAR61489.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Paratyphi A str. AKU_12601]
 gi|197243705|gb|EDY26325.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197939569|gb|ACH76902.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|205274558|emb|CAR39608.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Gallinarum str. 287/91]
 gi|205330696|gb|EDZ17460.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|205338925|gb|EDZ25689.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|206710646|emb|CAR35004.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Enteritidis str. P125109]
 gi|261248758|emb|CBG26608.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhimurium str. D23580]
 gi|267995840|gb|ACY90725.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|301160144|emb|CBW19664.1| bacteriophage-like lysozyme [Salmonella enterica subsp. enterica
          serovar Typhimurium str. SL1344]
 gi|312914629|dbj|BAJ38603.1| phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhimurium str. T000240]
 gi|321226656|gb|EFX51706.1| Phage-like lysozyme [Salmonella enterica subsp. enterica serovar
          Typhimurium str. TN061786]
 gi|323131965|gb|ADX19395.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|326625347|gb|EGE31692.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Dublin str. 3246]
 gi|326629918|gb|EGE36261.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
 gi|332990456|gb|AEF09439.1| putative phage endolysin [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
          Length = 118

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 36/70 (51%), Gaps = 1/70 (1%)

Query: 30 NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
          +A I  +K+++GL L  YRD   G W IGYGH  +       IT  +AE FLL D +   
Sbjct: 10 SACIAFIKQWQGLSLEKYRD-RQGNWVIGYGHMLTPDETLTFITPDQAEAFLLDDLNSCD 68

Query: 90 NLLLESSPAL 99
           LL    P L
Sbjct: 69 ILLQNCLPEL 78


>gi|153816824|ref|ZP_01969491.1| putative endolysin [Vibrio cholerae NCTC 8457]
 gi|126512627|gb|EAZ75221.1| putative endolysin [Vibrio cholerae NCTC 8457]
          Length = 195

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/142 (28%), Positives = 65/142 (45%), Gaps = 16/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL--LKDASKSLN 90
           ++M    EG RL  Y     G  T G G+T   V +     E+ A+D++  L++A + + 
Sbjct: 52  LEMTGNAEGCRLDPY-TCPSGLVTNGVGNT-HGVPDNPVSLEQVAKDWVRNLQEAERCVE 109

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ--------DWEKAAEE 142
            +  +S   K  ++ +  A   F FN G   Y +++   R   Q        ++ +A  E
Sbjct: 110 SVERASG--KPMTQGQFDAFTSFAFNTGCQRYKRNS--NRTATQIYRLSLEGNYPQACAE 165

Query: 143 CKKWTKAGGKVLPGLVKRRDAE 164
            K+W   GG   PGL+ RRD E
Sbjct: 166 LKRWVYGGGVKQPGLIIRRDIE 187


>gi|157370278|ref|YP_001478267.1| Phage-related lysozyme (muraminidase)-like protein [Serratia
           proteamaculans 568]
 gi|157322042|gb|ABV41139.1| Phage-related lysozyme (muraminidase)-like protein [Serratia
           proteamaculans 568]
          Length = 95

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 37/60 (61%), Gaps = 1/60 (1%)

Query: 110 VADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           VAD + NLG+ + + ST  Q+++  D + AA E  +W  AGG  L GLV RR AE +L L
Sbjct: 36  VADAI-NLGLRSLSISTLLQKLNVGDKQNAANEFGRWVNAGGVKLNGLVMRRAAERELFL 94


>gi|316933879|ref|YP_004108861.1| glycoside hydrolase family 24 [Rhodopseudomonas palustris DX-1]
 gi|315601593|gb|ADU44128.1| glycoside hydrolase family 24 [Rhodopseudomonas palustris DX-1]
          Length = 182

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 52/116 (44%), Gaps = 3/116 (2%)

Query: 53  GAWTIGYGHTGSD---VTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVA 109
           G  T+  G T  D   +  GM  T +E  + + +   +    +    P+ ++   +R  A
Sbjct: 56  GVITVCGGITNHDWPWLKAGMKFTPEECREAVAQLVPRYAEKVRACVPSFETMPPHRQAA 115

Query: 110 VADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEV 165
           +  FV NLG G    S+    ++A    +A +  +K+  A GK L GL  RR+  +
Sbjct: 116 ITSFVINLGPGRVCNSSIGPDLEAGRIRQACDAMRKYVYANGKYLKGLDNRRNDPI 171


>gi|299531684|ref|ZP_07045089.1| putative endolysin [Comamonas testosteroni S44]
 gi|298720400|gb|EFI61352.1| putative endolysin [Comamonas testosteroni S44]
          Length = 211

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/125 (32%), Positives = 55/125 (44%), Gaps = 22/125 (17%)

Query: 56  TIGYGHTGSDVTEGMTITEKEAEDFLLKD---------ASKSLNLLLESSPALKSTSENR 106
           T+  G TG DV  G   +   AE F L+          A +SL      +P  ++T    
Sbjct: 87  TVCNGLTGKDVIAGKWYSP--AECFRLEKKRYVQYEVIAKRSLTYWGGYNPFQQAT---- 140

Query: 107 LVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAG----GKVLPGLVKRRD 162
                DF+ N G GN+  ST ++  +A +W KA  E  +W K        VLPGL  R D
Sbjct: 141 ---FYDFLHNKGDGNFQTSTMRRDANAGNWAKACRENVRWNKGTVNGVSMVLPGLKIRGD 197

Query: 163 AEVKL 167
           A  +L
Sbjct: 198 ANAEL 202


>gi|153000606|ref|YP_001366287.1| glycoside hydrolase family protein [Shewanella baltica OS185]
 gi|151365224|gb|ABS08224.1| glycoside hydrolase family 24 [Shewanella baltica OS185]
          Length = 188

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 44/156 (28%), Positives = 70/156 (44%), Gaps = 23/156 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           ++  ++EG  L+ Y D   G  T   GHT  D+    T TE++      KD +++   LL
Sbjct: 23  QLTDKWEGNSLSVYID-AVGVLTACRGHTSKDLKLDQTFTEQQCMQIFAKDIARADKQLL 81

Query: 94  E-SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE---------- 142
           + ++P   +  E+   A   F+   G GN+  ST ++++   D   A +E          
Sbjct: 82  QLTAPVALTDGEH--AAYLSFMHWAGYGNFASSTLRKKLLVGDRVGACKELTQACSTNPQ 139

Query: 143 -----CKKW---TKAGGKV-LPGLVKRRDAEVKLLL 169
                C  W   T+ G KV L GL+KRR  E  + L
Sbjct: 140 TVERICNGWTYGTRLGVKVRLNGLIKRRAEEQTICL 175


>gi|167600491|ref|YP_001671990.1| endolysin [Pseudomonas phage LUZ19]
 gi|195546690|ref|YP_002117771.1| putative phage lysozyme [Pseudomonas phage PT5]
 gi|225626372|ref|YP_002727868.1| putative endolysin [Pseudomonas phage phikF77]
 gi|158187651|gb|ABW23128.1| putative phage lysozyme [Pseudomonas phage PT5]
 gi|161168354|emb|CAP45518.1| endolysin [Pseudomonas phage LUZ19]
 gi|225594881|emb|CAX63166.1| putative endolysin [Pseudomonas phage phikF77]
          Length = 160

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 67/139 (48%), Gaps = 17/139 (12%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG   TAYRDI G   TI  G T + V  G   T ++     LKD  +   ++L+   A+
Sbjct: 21  EGSETTAYRDIAGVP-TICSGTT-AGVKMGDKATPEQCYQMTLKDYQRFERIVLD---AI 75

Query: 100 K-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK---WTKA---GGK 152
           K   + N   A+  F +N+G      + FK+     +  +A E C+    W K    G K
Sbjct: 76  KVPLNVNEQTALTFFCYNVGPVCTTSTAFKRF----NQGRATEGCQALAMWNKVTINGQK 131

Query: 153 VLP-GLVKRRDAEVKLLLE 170
           V+  GLV RR+AE+K  LE
Sbjct: 132 VVSKGLVNRRNAEIKQCLE 150


>gi|161505854|ref|YP_001572966.1| hypothetical protein SARI_04031 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160867201|gb|ABX23824.1| hypothetical protein SARI_04031 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 116

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/71 (39%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSL 89
           +A I  +K+ +GL L  YRD   G W IGYGH  +       IT ++AE FLL D +   
Sbjct: 10  SACIAFIKQGQGLSLEKYRD-RQGKWVIGYGHILTPDETLTFITPEQAEAFLLDDLNNCD 68

Query: 90  NLLLESSPALK 100
            LL    P L 
Sbjct: 69  KLLQTCLPELH 79


>gi|288925611|ref|ZP_06419543.1| lysozyme-related protein [Prevotella buccae D17]
 gi|288337549|gb|EFC75903.1| lysozyme-related protein [Prevotella buccae D17]
          Length = 169

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 74/165 (44%), Gaps = 26/165 (15%)

Query: 13  RMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEG 69
           R+   +G +    +P     +  +K FEGL    ++D    A  +GYGH    G   T  
Sbjct: 19  RLSAQDGRNALLSLPPFERGVFCIKHFEGLH--GFKD----APYVGYGHQLQKGERFTAA 72

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFN------LGIGNYN 123
           MT  E++A+  L  D  K L +        K+  ++ L+ +A   +N      LG G + 
Sbjct: 73  MT--ERQADALLRADLMKRLMMF-------KNYGKDALL-LAVLSYNVGAGRLLGYGKHP 122

Query: 124 KSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           KS   +++++ D      E   + +  GKVL GLVKRR  E  L 
Sbjct: 123 KSRLLRKIESGD-RNFYHEFVSFCRYKGKVLRGLVKRRKVEFALF 166


>gi|291287050|ref|YP_003503866.1| glycoside hydrolase family 24 [Denitrovibrio acetiphilus DSM 12809]
 gi|290884210|gb|ADD67910.1| glycoside hydrolase family 24 [Denitrovibrio acetiphilus DSM 12809]
          Length = 153

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 38/137 (27%), Positives = 62/137 (45%), Gaps = 17/137 (12%)

Query: 30  NALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD-------VTEGMT--ITEKEAEDF 80
           + +IK +K +EG     Y     G WTIGYG+   D       +TE +    +   AE  
Sbjct: 2   DEIIKRIKVYEGYSEKPYV-CPAGKWTIGYGYNYEDRGFRTDEITEILRNGFSVGLAEKL 60

Query: 81  LLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQR---VDAQDWE 137
           L++D  + +  L    P  K   E R   +AD V+ LG+  + +  F++    V   D+ 
Sbjct: 61  LIRDVQECIRALGNIYPFFKKLDEVRHAVLADMVYQLGMNGFKE--FRKMLYAVQQGDYG 118

Query: 138 KAAEECKK--WTKAGGK 152
           +A+EE +   W    G+
Sbjct: 119 RASEEMRDSLWYGQSGR 135


>gi|160875242|ref|YP_001554558.1| glycoside hydrolase family protein [Shewanella baltica OS195]
 gi|160860764|gb|ABX49298.1| glycoside hydrolase family 24 [Shewanella baltica OS195]
 gi|315267435|gb|ADT94288.1| glycoside hydrolase family 24 [Shewanella baltica OS678]
          Length = 188

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 70/156 (44%), Gaps = 23/156 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLL 93
           ++  ++EG  L+ Y D   G  T   GHT  D+      TE++  +   KD +++   LL
Sbjct: 23  QLTDKWEGNSLSVYVD-AVGVLTACRGHTSKDLKLDQIFTEQQCMEIFAKDIARADKQLL 81

Query: 94  E-SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE---------- 142
           + ++P   +  E+   A   F+   G GN+  ST ++++   D   A +E          
Sbjct: 82  QLTAPVALTDGEH--AAYLSFMHWAGYGNFASSTLRKKLLVGDRVGACKELTQACSTNPQ 139

Query: 143 -----CKKW---TKAGGKV-LPGLVKRRDAEVKLLL 169
                C  W   T+ G KV L GL+KRR  E  + L
Sbjct: 140 TGERICNGWTYGTRLGAKVRLNGLIKRRAEEQTICL 175


>gi|146276501|ref|YP_001166660.1| glycoside hydrolase family protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145554742|gb|ABP69355.1| glycoside hydrolase, family 24 [Rhodobacter sphaeroides ATCC 17025]
          Length = 157

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 56/134 (41%), Gaps = 7/134 (5%)

Query: 38  EFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSP 97
           ++EG  LT Y D  G  WT+    TG    E    T  E  +       +    ++ + P
Sbjct: 24  KWEGTVLTPYWDRFGKVWTV---CTGETAVEMRPYTMTECMEMHEARVGQGYARVVAAFP 80

Query: 98  ALKSTSENRLVAVADFVFNLGIGNY--NKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP 155
            L S          D  +N G+G+    K+T     D + W         W+K+GG  +P
Sbjct: 81  RLASAPPEVAAMAVDLEYNAGLGSILRAKNTSAALRDGR-WRDFCNLLPSWSKSGGSFVP 139

Query: 156 GLVKRR-DAEVKLL 168
           GL+ RR +A+V  L
Sbjct: 140 GLLNRRKEAQVICL 153


>gi|915372|gb|AAC45169.1| lysozyme [Histophilus somni]
          Length = 178

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/175 (24%), Positives = 71/175 (40%), Gaps = 19/175 (10%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C +  II+ VK          H ++ +    + ++   EG R   Y        T+G G
Sbjct: 12  ICSVVAIIALVK--------ANHQELRISQQGLDLIGNVEGCRRDPYH-CPADVLTVGIG 62

Query: 61  HT---GSDVTEGMTITEKEAED---FLLKDASKSLNLLLESSPALKSTSENRLVAVADFV 114
            T   G ++      ++KE      + L+ A + +N         K+  +    A     
Sbjct: 63  STEANGKNIDPKKRYSDKEIAQRWAYDLRLAEQCVNRYGNG----KNLPQGAFDAFVSIT 118

Query: 115 FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           FN+G G   KST  ++ +     +   + ++W  AGGK L GLV RR  E  L L
Sbjct: 119 FNVGCGKMQKSTLFKQANQGFTPQLCHQFERWIYAGGKKLNGLVARRAKEKALCL 173


>gi|12276081|gb|AAG50252.1|AF311646_1 probable lysozyme [Phage GMSE-1]
          Length = 158

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 52/104 (50%), Gaps = 10/104 (9%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDAS---KSLNL 91
           ++   EG RL AY+    G WTIGYGHT   V  G  I+  +A +    D       +N 
Sbjct: 10  LIMRLEGGRLRAYQ-CRAGIWTIGYGHT-EGVKPGDKISLDQALELFNHDVQWVGGRVNA 67

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD 135
           L++        S+ +  A+  FVFN+G G + +S   ++++A D
Sbjct: 68  LVKV-----PLSQGQFEALCSFVFNVGRGAFAQSRLLKKLNAGD 106


>gi|71276168|ref|ZP_00652448.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71898331|ref|ZP_00680504.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
 gi|71163086|gb|EAO12808.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71731854|gb|EAO33912.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
          Length = 80

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEGLRL AY    G A TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGLRLQAY-ICEGSALTIGYGETGKHVTPDMCLANEQEADAMLRA-----RLA 62

Query: 93  LESSPALK 100
            E  PA++
Sbjct: 63  KEFEPAVR 70


>gi|256763415|ref|ZP_05503995.1| predicted protein [Enterococcus faecalis T3]
 gi|256684666|gb|EEU24361.1| predicted protein [Enterococcus faecalis T3]
          Length = 375

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/139 (26%), Positives = 66/139 (47%), Gaps = 11/139 (7%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMT-ITEKEAEDFLLKDASKSL 89
           ++K+FE  RLTAY D+G G  TIG+GH      + +  G+T  ++ +A+    KD     
Sbjct: 149 LIKKFEDCRLTAY-DLGDGMITIGWGHAEPKGQTSLIPGVTRWSQAQADSQFWKDIKVYE 207

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
           + +  +S  ++S ++N+  A+  F +N G G +    + +           E    +   
Sbjct: 208 SAV--NSYFIRSFNQNQFDAMVSFTYNNGTGVFANWNWDRNASNS---YITESFANYINK 262

Query: 150 GGKVLPGLVKRRDAEVKLL 168
           G +   GL +RR  E+ L 
Sbjct: 263 GTEYEEGLRRRRQEEINLF 281


>gi|27362894|gb|AAN87000.1| probable lysozyme [Pectobacterium carotovorum subsp. carotovorum]
          Length = 86

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 35/59 (59%), Gaps = 7/59 (11%)

Query: 33 IKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLKDASKS 88
          + ++K FEGL+LT YRD   G WTIGYGH   +  +   G+T+ E    D LL+   K+
Sbjct: 13 LALIKSFEGLKLTKYRDT-AGKWTIGYGHLILSNENFDNGITLQEA---DLLLRQDLKT 67


>gi|226328103|ref|ZP_03803621.1| hypothetical protein PROPEN_01994 [Proteus penneri ATCC 35198]
 gi|225203807|gb|EEG86161.1| hypothetical protein PROPEN_01994 [Proteus penneri ATCC 35198]
          Length = 56

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 32/51 (62%)

Query: 117 LGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKL 167
           +G   + +ST  ++++A D   A EE K+W  AGGKV  GLV RR+AE  L
Sbjct: 1   MGTTAFARSTLLKKLNAGDQYGACEEMKRWIYAGGKVWRGLVSRREAESAL 51


>gi|17981840|ref|NP_536831.1| lys [Haemophilus phage HP2]
 gi|13752213|gb|AAK37808.1| lys [Haemophilus phage HP2]
          Length = 179

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 73/162 (45%), Gaps = 22/162 (13%)

Query: 22  KHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT-GSDVTEGMTITEKEAEDF 80
           + N+I  P A + M+   EG     Y+      WT G G+T   D T+ +TI E  A D 
Sbjct: 24  QQNQIS-PKA-VSMIVNLEGCVRNPYK-CPADVWTNGVGNTYNVDKTKILTIDE-VATDL 79

Query: 81  L--LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN----YNKS-------TF 127
              +K+A   +N         +  ++++  A+    FN+G GN    Y+K+       T 
Sbjct: 80  RQNIKEAENCINADFNG----RKMNQDQYDAMTSLAFNVGCGNIKTYYSKTQGKRVATTI 135

Query: 128 KQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            +   A++W       + + K+GG+VL GL  RR  E  L L
Sbjct: 136 YRAAQAENWILMCNRIEDFNKSGGRVLKGLQNRRAKEKALCL 177


>gi|134288680|ref|YP_001111104.1| gp25, phage lysozyme [Burkholderia phage phi644-2]
 gi|134132065|gb|ABO60862.1| gp25, phage lysozyme [Burkholderia phage phi644-2]
          Length = 171

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/158 (27%), Positives = 63/158 (39%), Gaps = 26/158 (16%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++ +FEG++L  Y D   G  T   G T  DV  G   +E E    L          +L 
Sbjct: 15  VVPKFEGVKLVGYLD-PVGIPTKCMGDT-RDVVVGRAYSEAECRSSLETQLIAHAEPVLR 72

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------KKWT 147
            +P L+     +L A   F +N+G   Y  ST  +R +A D   A           ++W 
Sbjct: 73  CTPGLRG-RPYQLAAAVSFAYNVGAHAYCNSTTAKRFNAGDLRGACRAINESDSGRRQWV 131

Query: 148 KAGGKV---------------LPGLVKRRDAEVKLLLE 170
            A  +                LPGLVKRR AE + + E
Sbjct: 132 FANCRTVIDPKTKKPLPVCDTLPGLVKRR-AEERAICE 168


>gi|81343992|ref|YP_399008.1| putative endolysin [Enterobacteria phage RTP]
 gi|80750715|emb|CAJ42268.1| putative endolysin [Enterobacteria phage RTP]
          Length = 161

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 63/139 (45%), Gaps = 7/139 (5%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +++  EG+    Y DI G   T+  G TG DV  G   + +E    L K         +E
Sbjct: 21  LIELVEGVENKPYMDIAG-IPTVCAGVTGPDVVWGKNYSNRECRKLLEKHIQIH-GKYVE 78

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA---GG 151
            +       + R  A+  F +N+G  +  KST  + ++    E+  +    W KA   G 
Sbjct: 79  DAVTYPIAPQTR-AALISFSYNVGGSSMRKSTAVRLINQGKVEQGCKALGLWNKATVNGR 137

Query: 152 KVL-PGLVKRRDAEVKLLL 169
           KV+  GLV RR+ E+KL L
Sbjct: 138 KVVVKGLVNRRNEEIKLCL 156


>gi|167744471|ref|ZP_02417245.1| gp24 [Burkholderia pseudomallei 14]
          Length = 177

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/161 (28%), Positives = 63/161 (39%), Gaps = 26/161 (16%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L  ++ +FEG++L  Y D   G  T   G T  DV  G   +E E    L          
Sbjct: 18  LTVIVPKFEGVKLAGYLD-PVGIPTKCMGDT-RDVIVGRAYSEAECRASLETQLIAHAEP 75

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC-------K 144
           +L  +P LK     +L A   F +N+G   Y  ST  +R +A D   A            
Sbjct: 76  VLRCTPGLKD-RPYQLAAAVSFAYNVGANAYCASTTARRFNAGDLRGACRAINESDSGRP 134

Query: 145 KWTKAGGKV---------------LPGLVKRRDAEVKLLLE 170
           +W  A  +                LPGLVKRR AE + + E
Sbjct: 135 QWVFANCRTVIDPKTKKPLPVCDTLPGLVKRR-AEERAICE 174


>gi|145639494|ref|ZP_01795098.1| phage lysozyme lysis protein [Haemophilus influenzae PittII]
 gi|145271285|gb|EDK11198.1| phage lysozyme lysis protein [Haemophilus influenzae PittII]
 gi|309750523|gb|ADO80507.1| lysozyme [Haemophilus phage HP2]
          Length = 186

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 46/162 (28%), Positives = 74/162 (45%), Gaps = 22/162 (13%)

Query: 22  KHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-DVTEGMTITEKEAEDF 80
           + N+I  P A + M+   EG     Y+      WT G G+T + D T+ +TI E  A D 
Sbjct: 31  QQNQIS-PKA-VSMIVNLEGCVRNPYK-CPADVWTNGVGNTYNVDKTKILTIDE-VATDL 86

Query: 81  L--LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN----YNKS-------TF 127
              +K+A   +N         +  ++++  A+    FN+G GN    Y+K+       T 
Sbjct: 87  RQNIKEAENCINADFNG----RKMNQDQYDAMTSLAFNVGCGNIKTYYSKTQGKRVATTI 142

Query: 128 KQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            +   A++W       + + K+GG+VL GL  RR  E  L L
Sbjct: 143 YRAAQAENWILMCNRIEDFNKSGGRVLKGLQNRRAKEKALCL 184


>gi|17975138|ref|NP_536660.1| putative endolysin [Vibrio phage K139]
 gi|153213623|ref|ZP_01948896.1| putative endolysin [Vibrio cholerae 1587]
 gi|153820867|ref|ZP_01973534.1| putative endolysin [Vibrio cholerae B33]
 gi|165970268|ref|YP_001650899.1| putative endolysin [Vibrio phage kappa]
 gi|229512044|ref|ZP_04401523.1| phage-related lysozyme (muraminidase) [Vibrio cholerae B33]
 gi|229519180|ref|ZP_04408623.1| phage-related lysozyme (muraminidase) [Vibrio cholerae RC9]
 gi|229607265|ref|YP_002877913.1| phage-related lysozyme (muraminidase) [Vibrio cholerae MJ-1236]
 gi|254849282|ref|ZP_05238632.1| conserved hypothetical protein [Vibrio cholerae MO10]
 gi|17865420|gb|AAL47527.1|AF125163_33 orf28 [Vibrio phage K139]
 gi|124115822|gb|EAY34642.1| putative endolysin [Vibrio cholerae 1587]
 gi|126521659|gb|EAZ78882.1| putative endolysin [Vibrio cholerae B33]
 gi|165292245|dbj|BAF98827.1| putative endolysin [Vibrio phage kappa]
 gi|229343869|gb|EEO08844.1| phage-related lysozyme (muraminidase) [Vibrio cholerae RC9]
 gi|229352009|gb|EEO16950.1| phage-related lysozyme (muraminidase) [Vibrio cholerae B33]
 gi|229369920|gb|ACQ60343.1| phage-related lysozyme (muraminidase) [Vibrio cholerae MJ-1236]
 gi|254844987|gb|EET23401.1| conserved hypothetical protein [Vibrio cholerae MO10]
          Length = 195

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/147 (26%), Positives = 67/147 (45%), Gaps = 16/147 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL--LKDASKSLN 90
           ++M    EG RL  Y     G  T G G+T   V +     E+ A+D++  L++A + + 
Sbjct: 52  LEMTGNAEGCRLDPY-TCPSGLVTNGVGNT-HGVPDNPVSLEQVAKDWVRNLQEAERCVE 109

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ--------DWEKAAEE 142
            +  +S   K  ++ +  A   F FN G   Y +++   R   Q        ++ +A  E
Sbjct: 110 SVERASG--KPMTQGQFDAFTSFAFNTGCQRYKRNS--NRTATQIYRLSLEGNYPQACAE 165

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            K+W   GG   PGL+ RR+ E +  +
Sbjct: 166 LKRWVYGGGVKQPGLIIRRNVEYERCM 192


>gi|254286527|ref|ZP_04961484.1| putative endolysin [Vibrio cholerae AM-19226]
 gi|150423476|gb|EDN15420.1| putative endolysin [Vibrio cholerae AM-19226]
          Length = 195

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/142 (27%), Positives = 65/142 (45%), Gaps = 16/142 (11%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFL--LKDASKSLN 90
           ++M    EG RL  Y     G  T G G+T   V +     E+ A+D++  L++A + + 
Sbjct: 52  LEMTGNAEGCRLDPY-TCPSGLVTNGVGNT-HGVPDNPVSLEQVAKDWVRNLQEAERCVE 109

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ--------DWEKAAEE 142
            +  +S   K  ++ +  A   F FN G   Y +++   R   Q        ++ +A  E
Sbjct: 110 SVERASG--KPMTQGQFDAFTSFAFNTGCQRYKRNS--NRTATQIYRLSLEGNYPQACAE 165

Query: 143 CKKWTKAGGKVLPGLVKRRDAE 164
            K+W   GG   PGL+ RR+ E
Sbjct: 166 LKRWVYGGGVKQPGLIIRRNVE 187


>gi|30062423|ref|NP_836594.1| putative lysozyme protein R of prophage CP-933K [Shigella
          flexneri 2a str. 2457T]
 gi|30040669|gb|AAP16400.1| putative lysozyme protein R of prophage CP-933K [Shigella
          flexneri 2a str. 2457T]
          Length = 142

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 39 FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD
Sbjct: 34 LEGVSYIPYKDIIG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKD 78


>gi|33300856|ref|NP_877484.1| putative phage lysozyme [Pseudomonas phage phiKMV]
 gi|195546752|ref|YP_002117830.1| hypothetical protein PT2_gp51 [Pseudomonas phage PT2]
 gi|33284827|emb|CAD44236.1| putative phage lysozyme [Enterobacteria phage phiKMV]
 gi|165880761|gb|ABY71016.1| conserved hypothetical phage protein [Pseudomonas phage PT2]
          Length = 160

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 67/139 (48%), Gaps = 17/139 (12%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG   TAYRDI G   TI  G T + V  G   T ++     +KD  +   ++L+   A+
Sbjct: 21  EGSETTAYRDIAG-VPTICSGTT-AGVKMGDKATPEQCYQMTIKDFQRFERIVLD---AI 75

Query: 100 K-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK---WTKA---GGK 152
           K   + N   A+  F +N+G      + FK+     +  +A E C+    W K    G K
Sbjct: 76  KVPLNVNEQTALTFFCYNVGPVCTTSTAFKRF----NQGRATEGCQALAMWNKVTINGQK 131

Query: 153 VLP-GLVKRRDAEVKLLLE 170
           V+  GLV RR+AE+K  LE
Sbjct: 132 VVSKGLVNRRNAEIKQCLE 150


>gi|329119051|ref|ZP_08247743.1| phage lysozyme [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464790|gb|EGF11083.1| phage lysozyme [Neisseria bacilliformis ATCC BAA-1200]
          Length = 156

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 66/146 (45%), Gaps = 21/146 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYG--------HTGSDVTEGMTITEKEAEDFLLKDA 85
           +++   EG +  AY D   G  TIG G          G  V  G TI    A+D      
Sbjct: 13  ELIARLEGTKTRAYSD-SAGIPTIGIGFIRYTLGARAGQRVKMGDTIG---ADDIR---- 64

Query: 86  SKSLNLLLESSPALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAA 140
           ++ LN +     A++       ++++  A     +N+G+  + KS+  + ++ + ++ A 
Sbjct: 65  AEFLNQVQGYEAAVRQYVRAPLTQSQFNACVSLCYNIGVAAFAKSSVVRLLNEKRYKAAC 124

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVK 166
                W KAGG+V+ GL  RR AE K
Sbjct: 125 AAFALWNKAGGRVVQGLANRRAAEQK 150


>gi|303237537|ref|ZP_07324101.1| phage lysozyme [Prevotella disiens FB035-09AN]
 gi|302482256|gb|EFL45287.1| phage lysozyme [Prevotella disiens FB035-09AN]
          Length = 141

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/147 (31%), Positives = 64/147 (43%), Gaps = 19/147 (12%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWT-IGYGH---TGSDVTEGMTITEKEAEDFLL 82
           P   A++ ++K FEGL        G G +  +GYGH    G   +  MT  E++A+  L 
Sbjct: 6   PFERAVV-IVKYFEGLH-------GKGCYPYVGYGHQLQPGEHFSSNMT--ERQADSLLR 55

Query: 83  KDASKSLNLLLESSP-ALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE 141
            D  K      E    AL  +     V V      LG G Y KS   ++++A D      
Sbjct: 56  ADLWKCFEHFKEYGKDALLLSLLAYNVGVGRL---LGYGKYPKSKLLRKIEAGD-RNFYR 111

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           E   + +  GKVL GLVKRR  E  L 
Sbjct: 112 EYSSFCQYKGKVLNGLVKRRKIEFTLF 138


>gi|229496976|ref|ZP_04390681.1| phage lysozyme [Porphyromonas endodontalis ATCC 35406]
 gi|229316078|gb|EEN82006.1| phage lysozyme [Porphyromonas endodontalis ATCC 35406]
          Length = 141

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 47/148 (31%), Positives = 63/148 (42%), Gaps = 19/148 (12%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWT-IGYGH---TGSDVTEGMTITEKEAEDFLL 82
           P   A++ ++K FEGL        G G +  +GYGH    G   +  MT  E++A+  L 
Sbjct: 6   PFERAVV-VVKYFEGLH-------GKGCYPYVGYGHQLQPGEHFSSNMT--ERQADSLLR 55

Query: 83  KDASKSLNLLL-ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE 141
            D  K           AL  T     V V      LG G + KS   Q+++A D      
Sbjct: 56  ADLWKCFEYFKGYGKDALLLTLLAYNVGVGRL---LGYGKHPKSRLLQKIEAGD-RNIYR 111

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           E   + +  GKVL GLVKRR  E  L  
Sbjct: 112 EYVSFCRHKGKVLRGLVKRRHVEYALFF 139


>gi|9628630|ref|NP_043495.1| lysozyme [Haemophilus phage HP1]
 gi|1708889|sp|P51728|LYS_BPHP1 RecName: Full=Lysozyme; AltName: Full=Endolysin; AltName:
           Full=Lysis protein; AltName: Full=Muramidase; Flags:
           Precursor
 gi|1046253|gb|AAB09211.1| lysozyme [Haemophilus phage HP1]
          Length = 186

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 42/151 (27%), Positives = 67/151 (44%), Gaps = 20/151 (13%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-DVTEGMTITEKEAEDFL--LKDASKSL 89
           + M+   EG     Y+      WT G G+T + D T+ +TI E  A D    +K+A   +
Sbjct: 40  VSMIVNLEGCVRNPYK-CPADVWTNGVGNTHNVDKTKILTIDE-VATDLRRNIKEAENCI 97

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGN----YNKS-------TFKQRVDAQDWEK 138
           N         +  ++ +  A+    FN+G GN    Y+K+       T  +   A++W  
Sbjct: 98  NTYFNG----EKMNQGQYDAMVSLAFNVGCGNIKTYYSKTQGKRVATTIYRAAQAENWIL 153

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
                + + K+GG+VL GL  RR  E  L L
Sbjct: 154 MCNRIEDFNKSGGRVLKGLQNRRAKEKALCL 184


>gi|32453612|ref|NP_861818.1| e Lysozyme murein hydrolase [Enterobacteria phage RB69]
 gi|32350431|gb|AAP76030.1| e Lysozyme murein hydrolase [Enterobacteria phage RB69]
          Length = 157

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 57/126 (45%), Gaps = 21/126 (16%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGS------------DVTEGM----TITEKEAE 78
           ML+  EGLRLT Y+D   G WTIG GH  +            D   G     TIT  EAE
Sbjct: 1   MLRNDEGLRLTLYKDT-EGFWTIGIGHLVTKNPSLAVAKAELDRMIGRKCNGTITLDEAE 59

Query: 79  DFLLKDASKSLNLLLESS---PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD 135
               +D  K++  +L ++   P   S    R  A+ + VF +G+      T   R+  Q 
Sbjct: 60  KLFNEDVDKAVRGILGNAKLKPVYDSLDAVRRCALVNMVFQMGVSGVAGFTNSLRMLQQK 119

Query: 136 -WEKAA 140
            W++AA
Sbjct: 120 RWDEAA 125


>gi|66820883|ref|XP_643993.1| glycoside hydrolase family 24 protein [Dictyostelium discoideum
           AX4]
 gi|74857621|sp|Q556F2|LYST1_DICDI RecName: Full=Probable T4-type lysozyme 1; AltName: Full=Muramidase
 gi|60472355|gb|EAL70308.1| glycoside hydrolase family 24 protein [Dictyostelium discoideum
           AX4]
          Length = 170

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 44/145 (30%), Positives = 66/145 (45%), Gaps = 39/145 (26%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMT----------------------I 72
           MLK  EG +L  Y+D   G +TIG GH  + + E                         I
Sbjct: 8   MLKYDEGEKLEMYKD-TEGYYTIGIGHLITRIKERNAAILSLEEKIGHKVKMDSKNEPII 66

Query: 73  TEKEAEDFLLKD---ASKSLNLLLESSPALKSTSEN----RLVAVADFVFNLGIGNYNKS 125
           T  E+E    KD   A+KS+    ES+P L +  +N    R +A+ + VF +G+ N    
Sbjct: 67  TSSESEALFEKDLSVATKSI----ESNPTLSTIYKNLDNIRKMAIINMVFQMGVNNV--L 120

Query: 126 TFK---QRVDAQDWEKAAEECKKWT 147
           TFK   + ++ + W +AA+E K  T
Sbjct: 121 TFKMSLKLIEEKKWAEAAKEMKNST 145


>gi|240140485|ref|YP_002964964.1| Phage-related lysozyme (Muramidase, Endolysin) [Methylobacterium
           extorquens AM1]
 gi|240010461|gb|ACS41687.1| Phage-related lysozyme (Muramidase, Endolysin) [Methylobacterium
           extorquens AM1]
          Length = 203

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 63/141 (44%), Gaps = 27/141 (19%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----VTEGMTITEKEAEDFLLKDASKS-- 88
           +LK  EG  LTAY+D   G  TIG G T +     VT G+TIT   + D L  +A K+  
Sbjct: 10  VLKSREGEVLTAYKD-SVGILTIGVGITTASGLIKVTPGLTITAATS-DALFTEAVKAYA 67

Query: 89  -----LNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEEC 143
                L + LE         +++  A+    FN+G   + +ST  +R+   +   AAE  
Sbjct: 68  KPVSDLGVKLE---------QHQFDALVSLCFNIGQPAFTRSTVAKRLREGNVAGAAEAI 118

Query: 144 KKWTKAGGKVLPGLVKRRDAE 164
             W K        ++ RR  E
Sbjct: 119 LMWNKPA-----AIISRRQGE 134


>gi|292491116|ref|YP_003526555.1| glycoside hydrolase family 24 [Nitrosococcus halophilus Nc4]
 gi|291579711|gb|ADE14168.1| glycoside hydrolase family 24 [Nitrosococcus halophilus Nc4]
          Length = 138

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 8/102 (7%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           L + LK  EGLRL  YRD  G   T+GYG       E   I+E+EAE  L+ D     + 
Sbjct: 4   LFQQLKRHEGLRLKPYRDTVGKM-TVGYGRN----LEDRGISEQEAELMLMNDVLHFQSR 58

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDA 133
           L + S  L   +E R   + +  +NLG+G     +FK+ + A
Sbjct: 59  LSQYSWFL-VMNETRQGVIINMAYNLGMGGL--LSFKRMIAA 97


>gi|170717385|ref|YP_001784490.1| glycoside hydrolase family protein [Haemophilus somnus 2336]
 gi|168825514|gb|ACA30885.1| glycoside hydrolase family 24 [Haemophilus somnus 2336]
          Length = 178

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 42/175 (24%), Positives = 70/175 (40%), Gaps = 19/175 (10%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C +  II+ VK          H ++ +    + ++   EG R   Y        T+G G
Sbjct: 12  ICSVVAIIALVK--------TNHQELRISQQGLDLIGNVEGCRRDPYH-CPADVLTVGIG 62

Query: 61  HT---GSDVTEGMTITEKEAED---FLLKDASKSLNLLLESSPALKSTSENRLVAVADFV 114
            T   G ++      ++KE      + L+ A + +N         K+  +    A     
Sbjct: 63  STEANGKNIDPKKRYSDKEIAQRWAYDLRLAEQCVNRYGNG----KNLPQGAFDAFVSIT 118

Query: 115 FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           FN+G G   KST  ++ +     +   + ++W  AGGK L GLV RR  E    L
Sbjct: 119 FNVGCGKMQKSTLFKQANQGFTPQLCHQFERWIYAGGKKLNGLVARRAKEKAFCL 173


>gi|224285|prf||1101273F ORF 4
          Length = 176

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 18/150 (12%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-DVTEGMTITEKEAE-DFLLKDASKSLN 90
           + M+   EG     Y+      WT G G+T + D T+ +TI E   +    +K+A   +N
Sbjct: 30  VSMIVNLEGCVRNPYK-CPADVWTNGVGNTHNVDKTKILTIDEVRTDLRRNIKEAENCIN 88

Query: 91  LLLESSPALKSTSENRLVAVADFVFNLGIGN----YNKS-------TFKQRVDAQDWEKA 139
                    +  ++ +  A+    FN+G GN    Y+K+       T  +   A++W   
Sbjct: 89  TYFNG----EKMNQGQYDAMVSLAFNVGCGNIKTYYSKTQGKRVATTIYRAAQAENWILM 144

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
               + + K+GG+VL GL  RR  E  L L
Sbjct: 145 CNRIEDFNKSGGRVLKGLQNRRAKEKALCL 174


>gi|254362866|ref|ZP_04978941.1| bacteriophage lysozyme [Mannheimia haemolytica PHL213]
 gi|153094503|gb|EDN75337.1| bacteriophage lysozyme [Mannheimia haemolytica PHL213]
          Length = 189

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 46/185 (24%), Positives = 76/185 (41%), Gaps = 29/185 (15%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C I  II+ V+         +H +I    A ++++   EG R   Y+       T+G G
Sbjct: 12  VCGIAAIITLVQY--------QHPEIRTNQAGLEIIGNAEGCRRDPYK-CPADVITVGIG 62

Query: 61  HT---GSDVTEGMTITEKEAEDFLLKD---ASKSLNLLLESSPALKSTSENRLVAVADFV 114
            T   G  +      ++KE  +   KD   A   +N         K  ++N+   +   V
Sbjct: 63  STEFGGEKIDPNRIYSDKEIAERWAKDLKIAESCVNRHFNG----KDMNDNQFSGMTSAV 118

Query: 115 FNLGI----------GNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
           FN+G           G Y ++T  +    + +E+       + +A GKVL GLV RR+ E
Sbjct: 119 FNMGCYNMRFYRNKQGQYVQTTIHKLAVNKQFEEMCHRLPDFIRASGKVLNGLVIRREKE 178

Query: 165 VKLLL 169
             L L
Sbjct: 179 KALCL 183


>gi|261492624|ref|ZP_05989177.1| endolysin [Mannheimia haemolytica serotype A2 str. BOVINE]
 gi|261311783|gb|EEY12933.1| endolysin [Mannheimia haemolytica serotype A2 str. BOVINE]
          Length = 188

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 61/146 (41%), Gaps = 21/146 (14%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD---ASKSLNLLL 93
           EG R   Y+       T+G G T   G  +      T+KE  +  +KD   A + +N   
Sbjct: 43  EGCRRDPYK-CPADVITVGIGSTEASGEKINVNHKYTDKEIAERWIKDLKIAERCINRYF 101

Query: 94  ESSPALKSTSENRLVAVADFVFNLGI----------GNYNKSTFKQRVDAQDWEKAAEEC 143
                    +EN+  A+    FN+G           G Y ++T  +   A+D++      
Sbjct: 102 NGD----KMNENQFSAMVSAAFNMGCYNLRFYPNENGKYIQTTIHKYAMAKDFKAMCNRI 157

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLL 169
             + ++GGKVL GL  RR+ E  L L
Sbjct: 158 PDFNRSGGKVLRGLKIRREKEKALCL 183


>gi|109289945|ref|YP_655477.1| endolysin [Mannheimia phage phiMHaA1]
 gi|261494626|ref|ZP_05991107.1| endolysin [Mannheimia haemolytica serotype A2 str. OVINE]
 gi|90110551|gb|ABD90561.1| endolysin [Mannheimia phage phiMhaA1-PHL101]
 gi|90110601|gb|ABD90610.1| lysozyme [Mannheimia phage phiMhaA1-BAA410]
 gi|261309738|gb|EEY10960.1| endolysin [Mannheimia haemolytica serotype A2 str. OVINE]
          Length = 188

 Score = 44.3 bits (103), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 39/146 (26%), Positives = 61/146 (41%), Gaps = 21/146 (14%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKD---ASKSLNLLL 93
           EG R   Y+       T+G G T   G  +      T+KE  +  +KD   A + +N   
Sbjct: 43  EGCRRDPYK-CPADVITVGIGSTEASGEKINVNHKYTDKEIAERWIKDLKIAERCINRYF 101

Query: 94  ESSPALKSTSENRLVAVADFVFNLGI----------GNYNKSTFKQRVDAQDWEKAAEEC 143
                    +EN+  A+    FN+G           G Y ++T  +   A+D++      
Sbjct: 102 NGD----KMNENQFSAMVSAAFNMGCYNLRFYPNENGKYIQTTIHKYAMAKDFKAMCNRI 157

Query: 144 KKWTKAGGKVLPGLVKRRDAEVKLLL 169
             + ++GGKVL GL  RR+ E  L L
Sbjct: 158 PDFNRSGGKVLRGLKIRREKEKALCL 183


>gi|261492413|ref|ZP_05988970.1| bacteriophage lysozyme [Mannheimia haemolytica serotype A2 str.
           BOVINE]
 gi|261495948|ref|ZP_05992366.1| bacteriophage lysozyme [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261308408|gb|EEY09693.1| bacteriophage lysozyme [Mannheimia haemolytica serotype A2 str.
           OVINE]
 gi|261311942|gb|EEY13088.1| bacteriophage lysozyme [Mannheimia haemolytica serotype A2 str.
           BOVINE]
          Length = 189

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 76/185 (41%), Gaps = 29/185 (15%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C I  II+ V+         +H +I    A ++++   EG R   Y+       T+G G
Sbjct: 12  VCGIAAIIALVQY--------QHPEIRTNQAGLEIIGNAEGCRRDPYK-CPADVITVGIG 62

Query: 61  HT---GSDVTEGMTITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENRLVAVADFV 114
            T   G  +      ++KE  D     LK A   +N         K  ++N+   +   V
Sbjct: 63  STEFSGDKINPYHLYSDKEIADRWAKGLKIAESCVNRHFNG----KDMNDNQFSGMTSAV 118

Query: 115 FNLGI----------GNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
           FN+G           G Y ++T  +    + +E+       + +A GKVL GLV RR+ E
Sbjct: 119 FNMGCYNMRFYRNKQGQYVQTTIHKLAVNKQFEEMCHRLPDFIRASGKVLNGLVIRREKE 178

Query: 165 VKLLL 169
             L L
Sbjct: 179 KALCL 183


>gi|323160797|gb|EFZ46728.1| lysozyme [Escherichia coli E128010]
          Length = 122

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 21/46 (45%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 39 FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           EG+    Y+DI G  WT+ +GHTG D+  G T TE E +  L KD
Sbjct: 34 LEGVSYIPYKDIVG-VWTVCHGHTGKDIMPGKTYTEAECKALLNKD 78


>gi|161503405|ref|YP_001570517.1| hypothetical protein SARI_01479 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|169647109|ref|YP_001716111.1| lysozyme [Salmonella enterica subsp. enterica serovar Dublin]
 gi|160864752|gb|ABX21375.1| hypothetical protein SARI_01479 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|169246242|gb|ACA51216.1| possible lysozyme [Salmonella enterica subsp. enterica serovar
           Dublin]
 gi|312915738|dbj|BAJ39711.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. T000240]
 gi|323133016|gb|ADX20445.1| lysozyme [Salmonella enterica subsp. enterica serovar Typhimurium
           str. 4/74]
 gi|326626301|gb|EGE32645.1| lysozyme [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 9]
 gi|327536777|gb|AEA95608.1| Gifsy-2 prophage lysozyme [Salmonella enterica subsp. enterica
           serovar Dublin]
          Length = 54

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 32/53 (60%)

Query: 117 LGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           +GI     +T  ++++  D++ AA E  KW  A G+V+PGL +RR AE  L L
Sbjct: 1   MGINALAHATLLKKLNNGDYDGAANEFLKWDHASGQVVPGLTRRRSAERCLFL 53


>gi|301161314|emb|CBW20854.1| putative lysozyme protein found in a conjugation transposase
           [Bacteroides fragilis 638R]
          Length = 171

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 44/163 (26%), Positives = 69/163 (42%), Gaps = 22/163 (13%)

Query: 13  RMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEG 69
           R+    G      +P     +  +K FEGL   +++D       +GYGH    G   T  
Sbjct: 21  RLSAQEGGKALFSLPPFERAVVCIKYFEGLH--SWKDYP----YVGYGHRLLPGERFTAA 74

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFN----LGIGNYNKS 125
           MT  E++A+  L  D  K L +  +         +  ++AV  +       LG G + KS
Sbjct: 75  MT--ERQADSLLRADLMKRLMMFKDYG------RDALMLAVLSYNIGAGRLLGYGKHPKS 126

Query: 126 TFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              +++++ D      E   + +  GKVL GLVKRR  E  L 
Sbjct: 127 QLLRKIESGD-RNFYHEFVSFCRYKGKVLRGLVKRRKVEFALF 168


>gi|229495821|ref|ZP_04389549.1| lysozyme-related protein [Porphyromonas endodontalis ATCC 35406]
 gi|229317395|gb|EEN83300.1| lysozyme-related protein [Porphyromonas endodontalis ATCC 35406]
          Length = 169

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 70/163 (42%), Gaps = 22/163 (13%)

Query: 13  RMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEG 69
           R+   +G +    +P     +  +K FE L    ++D    A  +GYGH    G   T  
Sbjct: 19  RLSAQDGRNALLSLPPFERGVVCIKHFESLH--GFKD----APYVGYGHQLQKGERFTAA 72

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFN----LGIGNYNKS 125
           MT  E++A+  L  D  K L +  +         +  L+AV  +       LG G + KS
Sbjct: 73  MT--ERQADSLLRADLMKRLMMFKDYG------KDALLLAVLSYNVGTGRLLGYGRHPKS 124

Query: 126 TFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              +++++ D     E    + +  GKVL GLVKRR  E  L 
Sbjct: 125 RLLRKIESGDRNFYCEFVS-FCRYKGKVLRGLVKRRKVEFALF 166


>gi|126175800|ref|YP_001051949.1| glycoside hydrolase family protein [Shewanella baltica OS155]
 gi|125999005|gb|ABN63080.1| glycoside hydrolase, family 24 [Shewanella baltica OS155]
          Length = 177

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 57/127 (44%), Gaps = 16/127 (12%)

Query: 56  TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVF 115
           T   GHTG ++      +E++  +   KD  K+   L   +  ++ T E    A    ++
Sbjct: 47  TACLGHTGPELEINQFFSEQQCIEMFAKDLGKADRQLRRLTYPVQLT-EGEHAAYLSLIY 105

Query: 116 NLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV------------LPGLVKRRDA 163
           N G GN+  ST ++ +     E+ A  C + T A GK             LPGLV+RR  
Sbjct: 106 NFGAGNFQTSTLRKLL--LRGERVAA-CHQLTDACGKHGCTGFVYAADIKLPGLVERRKE 162

Query: 164 EVKLLLE 170
           E K+ L+
Sbjct: 163 ERKICLK 169


>gi|300717765|ref|YP_003742568.1| Lysozyme [Erwinia billingiae Eb661]
 gi|299063601|emb|CAX60721.1| Lysozyme [Erwinia billingiae Eb661]
          Length = 98

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/104 (32%), Positives = 56/104 (53%), Gaps = 13/104 (12%)

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKST----SENRLVAVADFVFNLGIGNYNKS 125
           MTIT+ ++   LL D +      +ESS   KS     ++N+  A+  FVFN+G   +  S
Sbjct: 1   MTITQNQSTALLLSDIA-----WVESSIG-KSVKVPLTQNQYDALCSFVFNVGKSAFENS 54

Query: 126 TFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV-KRRDAEVKLL 168
           T  ++++A D+  AA++   W +AG   +P L+  RR  E +L 
Sbjct: 55  TLLKKLNASDYAGAADQLLLWKRAGN--IPDLLFPRRKRERELF 96


>gi|71274671|ref|ZP_00650959.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71901600|ref|ZP_00683681.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
 gi|71164403|gb|EAO14117.1| phage-related lysozyme [Xylella fastidiosa Dixon]
 gi|71728648|gb|EAO30798.1| phage-related lysozyme [Xylella fastidiosa Ann-1]
          Length = 80

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           I ++K FEG +L++Y    GG  TIGYG TG  VT  M +  ++  D +L+       L 
Sbjct: 9   IALIKFFEGCKLSSY-TCPGGVLTIGYGETGKHVTPDMCLANEQEADAMLRA-----RLA 62

Query: 93  LESSPALK 100
            E  PA++
Sbjct: 63  KEFEPAVR 70


>gi|66391655|ref|YP_239180.1| gp5 baseplate lysozyme [Enterobacteria phage RB43]
 gi|62288743|gb|AAX78726.1| gp5 baseplate lysozyme [Enterobacteria phage RB43]
          Length = 589

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 78/177 (44%), Gaps = 36/177 (20%)

Query: 7   IISFVKRMIGMNGDDKH-NKIPVPN-------ALIKMLKEFEGLRLTAYRDIGGGAWTIG 58
           +I      + +N DD+  ++IP  N        + KM++  EG+RLT Y D+ G  +TIG
Sbjct: 147 VIRDANSTLAVNPDDRPLDEIPEDNRPDTGGFTIEKMIRGDEGIRLTWYYDVKG--YTIG 204

Query: 59  YGH------TGSD--------------VTEGM--TITEKEAEDFLLKDASKSLNLLLESS 96
            GH       G+D                 G+  +IT +EA     +D +K  N +  +S
Sbjct: 205 IGHFFLTAPQGTDPAVVNAALSKQIGRTVTGVPGSITAEEAGVLFQQDLAKVRNDIQNNS 264

Query: 97  PALK---STSENRLVAVADFVFNLGIGNYNKSTFK-QRVDAQDWEKAAEECKKWTKA 149
              +     +  R +A+ +  F +G+G   K T     + AQDW+ A  E +  T A
Sbjct: 265 KVREVYVGLNRPRQMAIENMCFQMGVGGVAKFTNALAAMKAQDWKTAYNELRNSTWA 321


>gi|146310457|ref|YP_001175531.1| glycoside hydrolase family protein [Enterobacter sp. 638]
 gi|145317333|gb|ABP59480.1| glycoside hydrolase, family 24 [Enterobacter sp. 638]
          Length = 178

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 33/73 (45%), Gaps = 2/73 (2%)

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQ--RVDAQDWEKAAEECKKWTKAGGKVLPGL 157
           K  S++   A     F  G GN  KST     R     ++ A  +  +W   GG+VLPGL
Sbjct: 103 KMLSDDTFSAAVSVTFRAGCGNMRKSTMFSFFREGPAAYKSACNQFSRWVYGGGRVLPGL 162

Query: 158 VKRRDAEVKLLLE 170
           V R   E  L L+
Sbjct: 163 VTRAGKEEALCLD 175


>gi|317132271|ref|YP_004091585.1| glycoside hydrolase family 24 [Ethanoligenens harbinense YUAN-3]
 gi|315470250|gb|ADU26854.1| glycoside hydrolase family 24 [Ethanoligenens harbinense YUAN-3]
          Length = 244

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 40/148 (27%), Positives = 67/148 (45%), Gaps = 7/148 (4%)

Query: 25  KIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           ++ + +  ++ + E EG   TAYR +     TIGYGH          +T+ +A   L  D
Sbjct: 95  EMRISDTGLQFVAEHEGYSATAYRGVDTQNLTIGYGHVLQPEETYSDLTQPQAMGLLKSD 154

Query: 85  ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKS-TFKQRVD---AQDWEKAA 140
            S   + +       K T +N+  A+  F +NLG   ++K+  F   V    + D  KA 
Sbjct: 155 LSTYEDAVNREFSGTKLT-QNQFDALVSFSYNLGANIWSKAPQFTSDVKNGASADVLKA- 212

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLL 168
            + ++ +   G  + GLV RR  E +L 
Sbjct: 213 -DFERISYCNGHQVQGLVNRRLDEFRLF 239


>gi|303237900|ref|ZP_07324454.1| phage lysozyme [Prevotella disiens FB035-09AN]
 gi|302481908|gb|EFL44949.1| phage lysozyme [Prevotella disiens FB035-09AN]
          Length = 168

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 64/148 (43%), Gaps = 19/148 (12%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWT-IGYGHT---GSDVTEGMTITEKEAEDFLL 82
           P   A++ ++K FEGL        G G +  +GYGH    G   +  MT  E++A+  L 
Sbjct: 33  PFERAVV-VVKYFEGLH-------GKGCYPYVGYGHQLQLGEHFSSNMT--ERQADSLLR 82

Query: 83  KDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE 141
            D  K   +       AL  T     V V      LG G + KS   ++++A D      
Sbjct: 83  ADLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGKHPKSRLLKKIEAGD-RNIYH 138

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           E   + +  GKVL GLVKRR  E  L  
Sbjct: 139 EYVAFCRYKGKVLRGLVKRRQVEYALFF 166


>gi|160873902|ref|YP_001553218.1| glycoside hydrolase family protein [Shewanella baltica OS195]
 gi|160859424|gb|ABX47958.1| glycoside hydrolase family 24 [Shewanella baltica OS195]
 gi|315266134|gb|ADT92987.1| glycoside hydrolase family 24 [Shewanella baltica OS678]
          Length = 177

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 58/127 (45%), Gaps = 16/127 (12%)

Query: 56  TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVF 115
           T  +GHT  ++      +E++  +   KD  K+   L   +  ++ T E    A    ++
Sbjct: 47  TACFGHTDPELEINQFFSEQQCIEMFAKDLGKADRQLRRLTYPVQLT-EGEHAAYLSLIY 105

Query: 116 NLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV------------LPGLVKRRDA 163
           N G GN+  ST ++ +     E+ A  C + T+A GK             LPGLV+RR  
Sbjct: 106 NFGAGNFQTSTLRKLL--LRGERVAA-CHQLTEACGKKGCNGFVYARDIKLPGLVERRKK 162

Query: 164 EVKLLLE 170
           E K+ L+
Sbjct: 163 ERKICLK 169


>gi|323968979|gb|EGB64298.1| phage lysozyme [Escherichia coli TA007]
          Length = 181

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 55/135 (40%), Gaps = 18/135 (13%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE--SSP 97
           E  R T YRDI G   T+G G TG    E     EKE     + D   + N + +  S  
Sbjct: 39  EECRATPYRDIAG-VMTVGCGSTGG--VENRVYGEKEVARRWVNDLRHAENCINQNFSGA 95

Query: 98  ALKSTSENRLVAVADFVFNLGI----------GNYNKSTFKQRVDAQDWEKAAEECKKWT 147
           A+  ++     A+ D  FN+G           GN  ++T  +   A  W         + 
Sbjct: 96  AMPQSA---FEAMTDAAFNVGCTGLMWYRDRSGNRQRTTIWKHAQAHRWVAMCGRLTDFV 152

Query: 148 KAGGKVLPGLVKRRD 162
            +GG+   GLV RR+
Sbjct: 153 NSGGRRSQGLVNRRE 167


>gi|158345072|ref|YP_001522837.1| putative lysozyme [Pseudomonas phage LKD16]
 gi|114796425|emb|CAK25981.1| putative lysozyme [Pseudomonas phage LKD16]
          Length = 160

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 47/139 (33%), Positives = 65/139 (46%), Gaps = 17/139 (12%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG   TAYRDI G   TI  G T + V  G   T ++     LKD  +   ++L    A+
Sbjct: 21  EGSETTAYRDIAG-VPTICSGTT-AGVKMGDKATPEQCYQMTLKDYQRFERIVLG---AI 75

Query: 100 K-STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK---WTKA---GGK 152
           K   + N   A+  F +N+G      + FK+     +  +A E C     W K    G K
Sbjct: 76  KVPLNVNEQTALTFFCYNVGPVCTTSTAFKRF----NQGRATEGCHALAMWNKVTINGQK 131

Query: 153 VLP-GLVKRRDAEVKLLLE 170
           V+  GLV RR+AE+K  LE
Sbjct: 132 VVSNGLVNRRNAEIKKCLE 150


>gi|332524447|ref|ZP_08400659.1| glycoside hydrolase family 24 [Rubrivivax benzoatilyticus JA2]
 gi|332107768|gb|EGJ08992.1| glycoside hydrolase family 24 [Rubrivivax benzoatilyticus JA2]
          Length = 256

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 54/173 (31%), Positives = 80/173 (46%), Gaps = 37/173 (21%)

Query: 28  VPNALIKMLKEFEGL--------RLTAYRDIGGGAWTIGYGHTGSD-------------- 65
           +P+  ++++K FEG+         + AY D  G  WTIG+GH  +D              
Sbjct: 8   MPDEGLELVKSFEGIPDGDPSTVNVDAYLDPVG-IWTIGWGHAIADHAGRWLRGPAAREQ 66

Query: 66  --VTEGMTITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120
                   IT  +AE  L   L DA + +  L+         S+ +  A+  FVFNLG G
Sbjct: 67  ARAAYPGGITRAQAETLLRADLLDACRDVQRLVTVP-----LSDAQFGALVSFVFNLGAG 121

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGG----KVLPGLVKRRDAEVKLLL 169
           +  KST  ++++A D   AA++   W KA      + LPGL +RR AE  L L
Sbjct: 122 SLLKSTLLKKLNAGDAAGAADQFLVWDKARVDGVLQPLPGLTRRRRAERALFL 174


>gi|237728834|ref|ZP_04559315.1| conserved hypothetical protein [Citrobacter sp. 30_2]
 gi|226909456|gb|EEH95374.1| conserved hypothetical protein [Citrobacter sp. 30_2]
          Length = 118

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 28/93 (30%), Positives = 47/93 (50%), Gaps = 4/93 (4%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH-TGSDVTEGMTITEKEAEDFLLKDASKSL 89
           A I  +K+++GL L  Y+D   G W IGYGH   ++ +    IT  +AE  LL D S   
Sbjct: 13  ACIAFIKQWQGLSLEKYQD-KKGIWVIGYGHEITANESFDTPITVMQAETLLLADMSICE 71

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNY 122
             + +    +K     +L  +  ++F++GI  +
Sbjct: 72  AFIHKEMTQIK--DRFQLEVLITWIFSVGITQF 102


>gi|299133539|ref|ZP_07026733.1| glycoside hydrolase family 24 [Afipia sp. 1NLS2]
 gi|298591375|gb|EFI51576.1| glycoside hydrolase family 24 [Afipia sp. 1NLS2]
          Length = 175

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 13/118 (11%)

Query: 53  GAWTIGYGHTGSDV---TEGMTITEKEAEDFLLKDA---SKSLNLLLESSPALKSTSENR 106
           G  TIG+GHT   +     G   +  E +  L  D     + ++ L +         ++ 
Sbjct: 48  GVLTIGWGHTNHHLPRFASGAIWSRAECDAALAGDMMTFERHVHDLCQIH-----LEQHE 102

Query: 107 LVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAE 164
             A+  + FN   G    +T  ++++A D      E  KW +AGG+VL GL +RR AE
Sbjct: 103 FDALVSWSFN--TGGPAHATLWRKLNAGDRAAVPRELAKWNRAGGRVLAGLTRRRKAE 158


>gi|304382625|ref|ZP_07365119.1| probable lysozyme [Prevotella marshii DSM 16973]
 gi|304336250|gb|EFM02492.1| probable lysozyme [Prevotella marshii DSM 16973]
          Length = 168

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 66/156 (42%), Gaps = 35/156 (22%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGH---TGSDVTEGMTITEKEAED 79
           P   A++ ++K FEGL            W     +GYGH    G   T  MT  E++A+ 
Sbjct: 33  PFERAVV-VVKYFEGLH----------GWKNYPYVGYGHQLQPGERFTADMT--ERQADS 79

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN------YNKSTFKQRVDA 133
            L  D  K            K   ++ L+ ++   +N+G+G       + KS   Q+++A
Sbjct: 80  LLRADLWKCFE-------HFKGYGKDALL-LSLLAYNVGVGRLLGYGKHPKSRLLQKIEA 131

Query: 134 QDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            D      E   + K  GKVL GLVKRR  E  L  
Sbjct: 132 GD-RNIYREYVSFCKYKGKVLKGLVKRRQVEFTLFF 166


>gi|317133386|ref|YP_004092700.1| hypothetical protein Ethha_2475 [Ethanoligenens harbinense YUAN-3]
 gi|315471365|gb|ADU27969.1| hypothetical protein Ethha_2475 [Ethanoligenens harbinense YUAN-3]
          Length = 222

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 69/153 (45%), Gaps = 7/153 (4%)

Query: 24  NKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTG---SDVTEGMTITE-KEAED 79
             +P+    +  ++++EG     Y D G G  TIGYGHTG   +  T  +T      AE 
Sbjct: 65  TNLPISKMGLVFIEQWEGAYSNWYDD-GYGNMTIGYGHTGPLPTGFTSPLTTGPGGTAEQ 123

Query: 80  FLLKD-ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV-DAQDWE 137
            L++D +S      ++      + ++N++ A+    +N+G   +N  +  Q V      +
Sbjct: 124 LLIQDLSSGGYCSSVQKEFQGVALNQNQMDALISLAYNIGGNAWNSLSLTQAVKTGAPPD 183

Query: 138 KAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
               + +K   AG    PGL +RR AE  L  +
Sbjct: 184 IITADFEKICYAGTTYSPGLYRRRVAEALLYTQ 216


>gi|209885704|ref|YP_002289561.1| lysozyme [Oligotropha carboxidovorans OM5]
 gi|209873900|gb|ACI93696.1| lysozyme [Oligotropha carboxidovorans OM5]
          Length = 176

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 14/124 (11%)

Query: 47  YRDIGGGAWTIGYGHTGSDV---TEGMTITEKEAEDFLLKDA---SKSLNLLLESSPALK 100
           YRD   G  TIG+GHT   +   T     T+ E +  L  D     + +  L +   A  
Sbjct: 44  YRD-RAGILTIGWGHTNHHLPHFTRDAVWTQAECDAALAGDMITFERYVQRLCKIELA-- 100

Query: 101 STSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKR 160
              ++   A+  + FN   G    +T  ++++A + +    E  KW +AGG+VL GL +R
Sbjct: 101 ---QHEFDALVSWAFN--TGGPATATLWKKLNAGNKKAVPIELAKWNRAGGRVLAGLTRR 155

Query: 161 RDAE 164
           R AE
Sbjct: 156 RKAE 159


>gi|183448228|pdb|2Z6B|A Chain A, Crystal Structure Analysis Of (Gp27-Gp5)3 Conjugated With
           Fe(Iii) Protoporphyrin
          Length = 584

 Score = 43.1 bits (100), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 44/153 (28%), Positives = 70/153 (45%), Gaps = 31/153 (20%)

Query: 17  MNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---------- 61
           +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH          
Sbjct: 156 INPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRDM 214

Query: 62  ----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENRL 107
                      G ++T    +IT +EA       L D  + +    +  P  ++ + +R 
Sbjct: 215 AQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSRQ 274

Query: 108 VAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
           +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 275 MALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|325292881|ref|YP_004278745.1| Lysozyme [Agrobacterium sp. H13-3]
 gi|325060734|gb|ADY64425.1| Lysozyme [Agrobacterium sp. H13-3]
          Length = 307

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 66/152 (43%), Gaps = 20/152 (13%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHT-GSD-------------VTEGMTITEKEAEDF 80
            ++  EG  LT Y D  G   TIG G T GSD             +  G T       D 
Sbjct: 13  FVRLHEGNPLTCYLDPVGIP-TIGTGFTMGSDSVRRELAKIGITKLVPGKTKITAAQSDV 71

Query: 81  LLKD--ASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
           +L    A++ +  ++  SP  ++  ++ L A A   FNLG+G  N +        Q  + 
Sbjct: 72  ILDAVLAAEYVPAVVAGSP--ENRKQHELDAAASVTFNLGVGAMNWTWADLWRKGQIKKA 129

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
           AA     +  A GK LPGLV+RR  E  LL E
Sbjct: 130 AAHLASNYNTAKGKKLPGLVRRRKEEA-LLFE 160


>gi|302346958|ref|YP_003815256.1| phage lysozyme [Prevotella melaninogenica ATCC 25845]
 gi|302151063|gb|ADK97324.1| phage lysozyme [Prevotella melaninogenica ATCC 25845]
          Length = 168

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 62/150 (41%), Gaps = 25/150 (16%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEG+            W     +GYGH    G   T  MT  E++A+ 
Sbjct: 33  PFERAVV-VVKYFEGMH----------GWKNYPYVGYGHQLQLGEHFTADMT--ERQADS 79

Query: 80  FLLKDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
            L  D  K   +       AL  T     V V      LG G Y KS   ++++A D   
Sbjct: 80  LLRADLWKCFEHFKCYGKDALLLTLLAYNVGVGRL---LGYGKYPKSRLLRKIEAGD-RN 135

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              E   + +  GKVL GLVKRR  E  L 
Sbjct: 136 FYREYVSFCRYKGKVLNGLVKRRQVEFLLF 165


>gi|228861084|ref|YP_002854107.1| gp5 base plate hub subunit and lysozyme [Enterobacteria phage RB51]
 gi|227438758|gb|ACP31070.1| gp5 base plate hub subunit and lysozyme [Enterobacteria phage RB51]
          Length = 575

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|330858669|ref|YP_004415044.1| putative baseplate hub subunit and tail lysozyme [Shigella phage
           Shfl2]
 gi|327397603|gb|AEA73105.1| putative baseplate hub subunit and tail lysozyme [Shigella phage
           Shfl2]
          Length = 575

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|116326372|ref|YP_803092.1| base plate hub subunit and lysozyme [Enterobacteria phage RB32]
 gi|115343965|gb|ABI94974.1| base plate hub subunit and lysozyme [Enterobacteria phage RB32]
          Length = 575

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|9632651|ref|NP_049757.1| gp5 baseplate hub subunit and tail lysozyme [Enterobacteria phage
           T4]
 gi|137895|sp|P16009|VG05_BPT4 RecName: Full=Tail-associated lysozyme; AltName: Full=Protein Gp5;
           Contains: RecName: Full=Gp5*; Contains: RecName:
           Full=Gp5C
 gi|34809729|pdb|1PDL|A Chain A, Fitting Of Gp5 In The Cryoem Reconstruction Of The
           Bacteriophage T4 Baseplate
 gi|34809730|pdb|1PDL|B Chain B, Fitting Of Gp5 In The Cryoem Reconstruction Of The
           Bacteriophage T4 Baseplate
 gi|34809731|pdb|1PDL|C Chain C, Fitting Of Gp5 In The Cryoem Reconstruction Of The
           Bacteriophage T4 Baseplate
 gi|5354275|gb|AAD42482.1|AF158101_69 gp5 baseplate hub subunit and tail lysozyme [Enterobacteria phage
           T4]
 gi|15227|emb|CAA33749.1| unnamed protein product [Enterobacteria phage T4]
 gi|299780503|gb|ADJ39865.1| baseplate hub subunit and tail lysozyme [Enterobacteria phage T4T]
          Length = 575

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|18655470|pdb|1K28|A Chain A, The Structure Of The Bacteriophage T4 Cell-Puncturing
           Device
          Length = 584

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|291290368|dbj|BAI83163.1| tail-associated lysozyme [Enterobacteria phage AR1]
          Length = 575

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|62738309|pdb|1WTH|A Chain A, Crystal Structure Of Gp5-S351l Mutant And Gp27 Complex
          Length = 584

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MAQINKVLSKQVGREITGNPGSITMEEATTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|323160798|gb|EFZ46729.1| lysozyme [Escherichia coli E128010]
          Length = 57

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 19/53 (35%), Positives = 34/53 (64%)

Query: 117 LGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           +G GN+  ST  ++++  D + A ++ ++WT AGGK   GL+ RR+ E ++ L
Sbjct: 1   MGAGNFRTSTLLRKINQGDIKSACDQLRRWTYAGGKQWKGLMTRREIEREVCL 53


>gi|258543066|ref|YP_003188499.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-01]
 gi|256634144|dbj|BAI00120.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-01]
 gi|256637204|dbj|BAI03173.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-03]
 gi|256640256|dbj|BAI06218.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-07]
 gi|256643313|dbj|BAI09268.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-22]
 gi|256646368|dbj|BAI12316.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-26]
 gi|256649421|dbj|BAI15362.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-32]
 gi|256652407|dbj|BAI18341.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655465|dbj|BAI21392.1| phage related lysozyme [Acetobacter pasteurianus IFO 3283-12]
          Length = 152

 Score = 42.7 bits (99), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 61/142 (42%), Gaps = 12/142 (8%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGH----TGSDVTEGMT-ITEKEAEDFLLKDASKSL 89
           + +  EGLRL  Y     G WTIGYG      G+ VT     IT++ A   L     K L
Sbjct: 11  LCRRSEGLRLCPY-VCPAGYWTIGYGSRFLANGATVTASTAPITDEYANALLQGTLGKLL 69

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
             +L       +  +    A+ DF +NLG+     ST  + ++A     A  +   W   
Sbjct: 70  PQILRLVRVPLTPGQQ--AALLDFTYNLGLPALAGSTLLKLLNAGQGNAARNQLLLWNHM 127

Query: 150 --GGKVL--PGLVKRRDAEVKL 167
              G+++   GL  RR AE +L
Sbjct: 128 HRNGQLITVAGLTLRRRAEWQL 149


>gi|217971966|ref|YP_002356717.1| glycoside hydrolase family 24 [Shewanella baltica OS223]
 gi|217497101|gb|ACK45294.1| glycoside hydrolase family 24 [Shewanella baltica OS223]
          Length = 174

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 35/127 (27%), Positives = 57/127 (44%), Gaps = 16/127 (12%)

Query: 56  TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVF 115
           T   GHTG ++      +E++  +   KD  K+   L   +  ++ T E    A    ++
Sbjct: 47  TACLGHTGPELEINQFFSEQQCIEMFAKDLGKADRQLRRLTYPVQLT-EGEHAAYLSLIY 105

Query: 116 NLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK------------VLPGLVKRRDA 163
           N G GN+  ST ++ +     E+ A  C + T+A GK             LPGLV+RR  
Sbjct: 106 NFGAGNFQTSTLRKLL--LRGERVA-ACHQLTEACGKKGCNGFVYARDIKLPGLVERRAK 162

Query: 164 EVKLLLE 170
           E  + L+
Sbjct: 163 EQSICLK 169


>gi|329115474|ref|ZP_08244222.1| Lysozyme [Acetobacter pomorum DM001]
 gi|326695184|gb|EGE46877.1| Lysozyme [Acetobacter pomorum DM001]
          Length = 153

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 62/142 (43%), Gaps = 12/142 (8%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGH----TGSDVTEGMT-ITEKEAEDFLLKDASKSL 89
           + +  EGLRL  Y     G WTIGYG      G+ VT     IT + A   L    +K L
Sbjct: 12  LCRRSEGLRLRPY-VCPAGYWTIGYGSRFLANGAAVTASTAPITAEYANALLQGTLAKLL 70

Query: 90  NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA 149
             +L       ++ +    A+ DF +NLG+     ST  + ++A     A  +   W   
Sbjct: 71  PQILRLVRVPLTSGQQ--AALLDFTYNLGLPALAGSTLLKLLNAGQGNAARNQLLLWNHM 128

Query: 150 --GGKVL--PGLVKRRDAEVKL 167
              G+++   GL  RR AE +L
Sbjct: 129 HRNGQLITVAGLTLRRRAEWQL 150


>gi|304373745|ref|YP_003858490.1| gp5 baseplate hub subunit and tail lysozyme [Enterobacteria phage
           RB16]
 gi|299829701|gb|ADJ55494.1| gp5 baseplate hub subunit and tail lysozyme [Enterobacteria phage
           RB16]
          Length = 588

 Score = 42.4 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 46/177 (25%), Positives = 74/177 (41%), Gaps = 36/177 (20%)

Query: 7   IISFVKRMIGMNGDDKH-NKIPVPN-------ALIKMLKEFEGLRLTAYRDIGGGAWTIG 58
           II      + +N DD+  ++IP  N        + KM++  EG+RLT Y D+ G  +TIG
Sbjct: 147 IIRDANSSLAVNPDDRPLDEIPEDNRPDTGGFTIEKMIRGDEGIRLTWYYDVKG--YTIG 204

Query: 59  YGHTGSDVTEGM----------------------TITEKEAEDFLLKDASKSLNLLLESS 96
            GH      +G                       +IT  EA     +D +K  N +  +S
Sbjct: 205 IGHFFLTAPQGTDPAVVNAALSRQIGRTVTGVPGSITADEASVLFQQDLAKVHNDIQNNS 264

Query: 97  PALK---STSENRLVAVADFVFNLGIGNYNKSTFK-QRVDAQDWEKAAEECKKWTKA 149
              +   + +  R +A+ +  F +G+G   K T     +  QDW+ A  E +  T A
Sbjct: 265 KVREVYVTLNRPRQMAIENMCFQMGVGGVAKFTNALAAMKRQDWKTAYNELRNSTWA 321


>gi|228861464|ref|YP_002854485.1| gp5 base plate hub subunit and lysozyme [Enterobacteria phage RB14]
 gi|227438480|gb|ACP30793.1| gp5 base plate hub subunit and lysozyme [Enterobacteria phage RB14]
          Length = 575

 Score = 42.4 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 44/154 (28%), Positives = 70/154 (45%), Gaps = 31/154 (20%)

Query: 16  GMNGDDKH-NKIPV---PN-ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH--------- 61
            +N DD+  ++IP    PN ++ +ML+  EGLRL  Y D  G   TIG GH         
Sbjct: 155 AINPDDRPLSEIPTDDNPNMSMAEMLRRDEGLRLKVYWDTEGYP-TIGIGHLIMKQPVRD 213

Query: 62  -----------TGSDVTEGM-TITEKEAEDFL---LKDASKSLNLLLESSPALKSTSENR 106
                       G ++T    +IT +EA       L D  + +    +  P  ++ + +R
Sbjct: 214 MTQINKVLSKQVGREITGNPGSITMEEAVTLFERDLADMQRDIKSHSKVGPVWQAVNRSR 273

Query: 107 LVAVADFVFNLGIGNYNK-STFKQRVDAQDWEKA 139
            +A+ +  F +G+G   K +T    + A DWEKA
Sbjct: 274 QMALENMAFQMGVGGVAKFNTMLTAMLAGDWEKA 307


>gi|282881017|ref|ZP_06289707.1| conserved hypothetical protein [Prevotella timonensis CRIS 5C-B1]
 gi|281305093|gb|EFA97163.1| conserved hypothetical protein [Prevotella timonensis CRIS 5C-B1]
          Length = 143

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 47/155 (30%), Positives = 63/155 (40%), Gaps = 32/155 (20%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGH---TGSDVTEGMTITEKEAE 78
           +P     I ++K FEGL            W     +GYGH    G   T  MT  E++A+
Sbjct: 6   LPPFERAIVVVKYFEGLH----------GWKSYPYVGYGHQLQAGEHFTADMT--ERQAD 53

Query: 79  DFLLKDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD-- 135
             L  D  K   +       AL  T     V V      LG G + KS   Q+++A D  
Sbjct: 54  SLLRADLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGKHQKSRLLQKIEAGDRN 110

Query: 136 --WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
             WE  +     + +  GKVL GLVKRR  E  + 
Sbjct: 111 IYWEYVS-----FCRYKGKVLRGLVKRRQVEFAVF 140


>gi|45686348|ref|YP_003933.1| endolysin [Enterobacteria phage T1]
 gi|37787983|gb|AAP49987.1| endolysin [Enterobacteria phage T1]
          Length = 162

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 50/112 (44%), Gaps = 3/112 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +L+  EG+    Y DI G   T+  G TG DV  G   T++E +  L+K    +   + +
Sbjct: 22  LLERIEGIEYEVYYDIAGVP-TVCSGITGPDVIPGKKYTKRECDALLIKHIGVAQRYVDK 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
                         ++  F FN+G G +  ST  + ++ +  ++A  +  +W
Sbjct: 81  KVKV--DIPVTMRASLYSFTFNVGTGAFGSSTMLKLINQRKHKEACNQLWRW 130


>gi|329297391|ref|ZP_08254727.1| NucD2 [Plautia stali symbiont]
          Length = 106

 Score = 42.0 bits (97), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 21/61 (34%), Positives = 27/61 (44%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           A   F FN+G+     STF + +  Q W  A  E ++W    G    GL  RR AE    
Sbjct: 42  ATVSFAFNVGVRAACASTFARYIRLQHWYAACSELRRWVYVNGVKNRGLENRRAAETAYC 101

Query: 169 L 169
           L
Sbjct: 102 L 102


>gi|282858477|ref|ZP_06267652.1| phage lysozyme [Prevotella bivia JCVIHMP010]
 gi|282588727|gb|EFB93857.1| phage lysozyme [Prevotella bivia JCVIHMP010]
          Length = 168

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 46/147 (31%), Positives = 63/147 (42%), Gaps = 19/147 (12%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWT-IGYGHT---GSDVTEGMTITEKEAEDFLL 82
           P   A++ ++K FEGL        G G +  +GYGH    G   +  MT  E++A   L 
Sbjct: 33  PFERAVV-VVKYFEGLH-------GKGCYPYVGYGHQLQPGEHFSSNMT--ERQAASLLR 82

Query: 83  KDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE 141
            D  K   +       AL  T     V V      LG G + KS   ++++A D      
Sbjct: 83  ADLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGKHPKSRLLRKIEAGD-RNFYR 138

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           E   + +  GKVL GLVKRR  E  L 
Sbjct: 139 EYVSFCRYKGKVLNGLVKRRQVEFALF 165


>gi|213855834|ref|ZP_03384074.1| DLP12 prophage; lysozyme [Salmonella enterica subsp. enterica
          serovar Typhi str. M223]
          Length = 79

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 39 FEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKD 84
           EG+    Y+DI G  WT+ +GHTG D+  G T T+ E +  L KD
Sbjct: 34 LEGVSYIPYKDIVG-VWTVCHGHTGKDIMLGKTYTKAECKALLNKD 78


>gi|282877441|ref|ZP_06286264.1| phage lysozyme [Prevotella buccalis ATCC 35310]
 gi|281300493|gb|EFA92839.1| phage lysozyme [Prevotella buccalis ATCC 35310]
          Length = 168

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 65/147 (44%), Gaps = 19/147 (12%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWT-IGYGHT---GSDVTEGMTITEKEAEDFLL 82
           P   A++ ++K FEGL        G G +  +GYGH    G   +  MT  E++A+  L 
Sbjct: 33  PFERAVV-IVKYFEGLH-------GNGCYPYVGYGHQLQPGEHFSSNMT--ERQADSLLR 82

Query: 83  KDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAE 141
            D  K   +       AL  T     V V      LG G + KS   +++++ D      
Sbjct: 83  ADLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGKHPKSKLLRKIESGD-RNFYR 138

Query: 142 ECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           E   + +  GKVL GLVKRR  E+ L 
Sbjct: 139 EYFSFCRYKGKVLRGLVKRRKMELILF 165


>gi|158997736|ref|YP_001531197.1| Bcep22gp79 [Burkholderia phage Bcep22]
 gi|158605313|gb|AAQ55011.2| Bcep22gp79 [Burkholderia phage Bcep22]
          Length = 174

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 48/107 (44%), Gaps = 4/107 (3%)

Query: 56  TIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVA 111
           TIG+G T    G+ V  G TIT + A++      +K    L  S PA     +       
Sbjct: 42  TIGHGSTRYEDGTPVKMGDTITRQRADELARNLMAKDERDLRASLPADTRLYQAEYDVYL 101

Query: 112 DFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLV 158
           DFV   GIGN+ KS+ ++ V A ++  A +    +  A G     LV
Sbjct: 102 DFVGQYGIGNWRKSSMRRHVIAGEYAAACKALLNYRFAAGYDCSTLV 148


>gi|309780972|ref|ZP_07675711.1| phage lysozyme [Ralstonia sp. 5_7_47FAA]
 gi|330824631|ref|YP_004387934.1| glycoside hydrolase family 24 [Alicycliphilus denitrificans K601]
 gi|308920275|gb|EFP65933.1| phage lysozyme [Ralstonia sp. 5_7_47FAA]
 gi|329310003|gb|AEB84418.1| glycoside hydrolase family 24 [Alicycliphilus denitrificans K601]
          Length = 166

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 39/141 (27%), Positives = 66/141 (46%), Gaps = 22/141 (15%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG    A   + G   TIG+G T +DV  G T T  +A        +++L  + +   AL
Sbjct: 27  EGYTDRAVIPVKGDVPTIGFGTT-TDVKLGDTTTPPKA-------LARALTDVQQFEGAL 78

Query: 100 KST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK-- 152
           K+      +++   A+  F +N+G   + +ST  ++++A+D+  A  E  +W    GK  
Sbjct: 79  KTCVTVPLAQHEYDALVSFSYNVGSRAFCQSTLVRKLNAEDYAGACSELLRWRFFQGKDC 138

Query: 153 VLP-------GLVKRRDAEVK 166
            LP       GL  RR +E +
Sbjct: 139 ALPANVRLCGGLATRRQSEYR 159


>gi|188993919|ref|YP_001928171.1| probable lysozyme [Porphyromonas gingivalis ATCC 33277]
 gi|188995150|ref|YP_001929402.1| probable lysozyme [Porphyromonas gingivalis ATCC 33277]
 gi|188593599|dbj|BAG32574.1| probable lysozyme [Porphyromonas gingivalis ATCC 33277]
 gi|188594830|dbj|BAG33805.1| probable lysozyme [Porphyromonas gingivalis ATCC 33277]
          Length = 171

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 43/163 (26%), Positives = 68/163 (41%), Gaps = 22/163 (13%)

Query: 13  RMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEG 69
           R+    G      +P     +  +K FEGL   +++D       +GYGH        T  
Sbjct: 21  RLFAQEGGKALFSLPPFERAVVCIKHFEGLH--SWKDYP----YVGYGHRLLPCEHFTAA 74

Query: 70  MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFN----LGIGNYNKS 125
           MT  E++A+  L  D  K L +  +         +  L+AV  +       LG G + KS
Sbjct: 75  MT--ERQADSLLRVDLMKRLMMFKDYG------KDALLLAVLSYNVGTGRLLGYGKHPKS 126

Query: 126 TFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              +++++ +      E   + +  GKVL GLVKRR  E  L 
Sbjct: 127 RLLRKIESGN-RNFYREFVSFCRYKGKVLRGLVKRRKVEFALF 168


>gi|251779325|ref|ZP_04822245.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243083640|gb|EES49530.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
          Length = 261

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 39/148 (26%), Positives = 62/148 (41%), Gaps = 6/148 (4%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKDAS 86
           V +  I  +K +EG     Y D  G   T GYG TG ++      I+E EA   L K  +
Sbjct: 108 VSSKGIDFIKSWEGFYPNKYYDCVG-VLTQGYGLTGDEIKNLPEQISESEAAALLKKVVN 166

Query: 87  KSLNLLLESSPALKSTS--ENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QDWEKAAEE 142
                 ++     K     ++   A+  F +N G      ST  + V A  ++ +     
Sbjct: 167 NKYAKAIKDDLDSKGICLKQHEFDALVSFAYNCGTAGLLGSTLYKNVIAGIRNKDTITSN 226

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLLE 170
            + W+  GGK + GL +RR  E  + L+
Sbjct: 227 FQAWSNGGGKRIEGLYRRRTKEAAMFLD 254


>gi|209542745|ref|YP_002274974.1| lysozyme [Gluconacetobacter diazotrophicus PAl 5]
 gi|209530422|gb|ACI50359.1| lysozyme [Gluconacetobacter diazotrophicus PAl 5]
          Length = 92

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 37/67 (55%)

Query: 103 SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRD 162
           ++++L A+  F +N+G   +  ST  + + A +   AA +   W KA G+V+ GL+ RR 
Sbjct: 25  TDSQLTALTSFAYNVGFDAFRGSTLHRFILAGNMTGAAGQFVLWDKADGEVVQGLLDRRI 84

Query: 163 AEVKLLL 169
            E  + L
Sbjct: 85  KERDIFL 91


>gi|302035514|ref|YP_003795836.1| phage lysozyme [Candidatus Nitrospira defluvii]
 gi|300603578|emb|CBK39908.1| Phage lysozyme [Candidatus Nitrospira defluvii]
          Length = 166

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 62/139 (44%), Gaps = 12/139 (8%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG    A   + G   TIG+G T S V  G T T  +A    L D  +    L +     
Sbjct: 27  EGYTERAVIPVKGDVPTIGFGTT-SGVKIGDTTTPTKALARALTDVQQFEGALKQCVTV- 84

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK--VLP-- 155
              +++   A+  F +N+G   + +ST  ++++A+D+  A  E  +W    GK   LP  
Sbjct: 85  -PLAQHEYDALVSFSYNVGSRAFCQSTLVRKLNAEDYAGACAELLRWRFFQGKDCALPTN 143

Query: 156 -----GLVKRRDAEVKLLL 169
                GL  RR+AE +  +
Sbjct: 144 ARLCGGLATRREAEYRQCI 162


>gi|56750786|ref|YP_171487.1| chain A, D20c mutant of T4 lysozyme [Synechococcus elongatus PCC
           6301]
 gi|81299567|ref|YP_399775.1| chain A, D20c mutant of T4 lysozyme [Synechococcus elongatus PCC
           7942]
 gi|56685745|dbj|BAD78967.1| chain A, D20c mutant of T4 lysozyme [Synechococcus elongatus PCC
           6301]
 gi|81168448|gb|ABB56788.1| chain A, D20c mutant of T4 lysozyme [Synechococcus elongatus PCC
           7942]
          Length = 154

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 10/114 (8%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           LI+ L   EGLRL  YR    G  TIG G    D      I+E EA   L+ D   ++  
Sbjct: 19  LIRQLTLHEGLRLKPYR-CTAGRLTIGIGRNLDD----RGISEAEARLLLVSDIDHAMRQ 73

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ---RVDAQDWEKAAEE 142
           L    P ++  S  R   + D   NLGI    +  F++    ++A  + +AA+E
Sbjct: 74  LESRLPWVRQLSWVRQRVLIDMAINLGIDGLLR--FRKTLGHIEAGRYAEAADE 125


>gi|319896511|ref|YP_004134704.1| lysozyme precursor phage protein [Haemophilus influenzae F3031]
 gi|317432013|emb|CBY80361.1| lysozyme precursor phage protein [Haemophilus influenzae F3031]
          Length = 186

 Score = 41.2 bits (95), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 38/149 (25%), Positives = 65/149 (43%), Gaps = 16/149 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS-DVTEGMTITEKEAEDFLLKDASKSLNL 91
           + M+   EG     Y+      WT G G+T + D T+ +TI E   +   L+   K    
Sbjct: 40  VSMIVNLEGCVRNPYK-CPADVWTNGVGNTHNVDKTKILTIDEVAVD---LRQNIKQAEN 95

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIGN----YNKS-------TFKQRVDAQDWEKAA 140
            + +    +  ++++  A+    FN+G GN    Y+K+       T  +   A++W    
Sbjct: 96  CINADFNGRKMNQDQYDAMISLAFNVGCGNIKTYYSKTQGKRVATTLYRAAQAENWILMC 155

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
              + + K+ G+VL GL  RR  E  L L
Sbjct: 156 NRIEDFNKSAGRVLKGLQIRRAKEKALCL 184


>gi|117618756|ref|YP_856580.1| phage lysozyme [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560163|gb|ABK37111.1| phage lysozyme [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 163

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 61/137 (44%), Gaps = 23/137 (16%)

Query: 40  EGLRLTAYRDIGGGAW--TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSP 97
           EG   TAY D   GA   TIG+G T   V  G TIT   A +  L++       + E   
Sbjct: 25  EGFEPTAYPDPVHGARLPTIGFGST-EGVKMGDTITPVAAVNRSLREVR-----IFED-- 76

Query: 98  ALKST-----SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--- 149
           ALK+       +    A  +   N+G G + +ST  +R++A D+  A E    + +A   
Sbjct: 77  ALKACIKVPLHQYEFDAYVELSHNIGPGAFCRSTIVKRLNAGDYPGACEAILLFKRAGNQ 136

Query: 150 -----GGKVLPGLVKRR 161
                G +V PGL K R
Sbjct: 137 DCSAPGNRVCPGLWKDR 153


>gi|288802089|ref|ZP_06407530.1| lysozyme-related protein [Prevotella melaninogenica D18]
 gi|288335524|gb|EFC73958.1| lysozyme-related protein [Prevotella melaninogenica D18]
          Length = 169

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 45/156 (28%), Positives = 66/156 (42%), Gaps = 37/156 (23%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEG+            W     +GYGH    G   T  MT  E++A+ 
Sbjct: 34  PFERAVV-VVKYFEGMH----------GWKNYPYVGYGHQLQRGERFTADMT--ERQADS 80

Query: 80  FLLKDASKSLNLLL---ESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD- 135
            L  D  K         + +P L   + N  V V   +   G G + KS   ++++A D 
Sbjct: 81  LLRADLWKCFEHFKGYGKDAPLLTLLAYN--VGVGRLI---GYGKHPKSRLLRKIEAGDR 135

Query: 136 ---WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              WE  +     + +  GKVL GLVKRR  E  L 
Sbjct: 136 NFYWEYVS-----FCRYKGKVLNGLVKRRKVEFALF 166


>gi|22126102|ref|NP_669525.1| hypothetical protein y2216 [Yersinia pestis KIM 10]
 gi|21959060|gb|AAM85776.1|AE013825_3 hypothetical [Yersinia pestis KIM 10]
          Length = 51

 Score = 40.8 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 22/48 (45%), Positives = 27/48 (56%)

Query: 124 KSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
           KST  +   A +   A E+  +W   GGK LPGLV RR+ E  L LES
Sbjct: 4   KSTMFKYFRAGNVTAACEQFPRWIYGGGKKLPGLVTRREKEKALCLES 51


>gi|307565483|ref|ZP_07627969.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
 gi|307345814|gb|EFN91165.1| conserved hypothetical protein [Prevotella amnii CRIS 21A-A]
          Length = 168

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 41/154 (26%), Positives = 66/154 (42%), Gaps = 28/154 (18%)

Query: 26  IPVPNALIKMLKEFEGL-RLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFL 81
           +P     + ++K FEGL R + Y         +GYGH    G   +  MT  E++A+  L
Sbjct: 31  LPPFERAVSVVKYFEGLHRESCYP-------YVGYGHQLQPGEHFSSNMT--ERQADSLL 81

Query: 82  LKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN------YNKSTFKQRVDAQD 135
             D  K            K   ++ L+ +    +N+G+G       + KS   ++++A D
Sbjct: 82  RADLWKCFE-------HFKGYGKDALL-LTLLAYNVGVGRLLGYGKHPKSRLLKKIEAGD 133

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
                 E   + +  GK+L GLVKRR  E  L  
Sbjct: 134 -RNIYPEYVSFCRYKGKILKGLVKRRQVEYALFF 166


>gi|288927233|ref|ZP_06421094.1| lysozyme-related protein [Prevotella buccae D17]
 gi|288335995|gb|EFC74415.1| lysozyme-related protein [Prevotella buccae D17]
          Length = 166

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 46/150 (30%), Positives = 63/150 (42%), Gaps = 25/150 (16%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEGL            W     +GYGH    G + T  MT  E++A+ 
Sbjct: 33  PFERAVV-VVKYFEGLH----------GWKNYPYVGYGHQLQPGENFTADMT--ERQADS 79

Query: 80  FLLKDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEK 138
            L  D  K   +       AL  T     V V      LG G + KS   ++++A D   
Sbjct: 80  LLRADLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGKHPKSKLLRKIEAGD-RN 135

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
              E   + +  GKVL GLVKRR  E  L 
Sbjct: 136 FYREYVSFCRYKGKVLSGLVKRRKVEFALF 165


>gi|20065978|ref|NP_612844.1| Gp15 protein [Clostridium phage phi3626]
 gi|168211287|ref|ZP_02636912.1| Gp15 protein [Clostridium perfringens B str. ATCC 3626]
 gi|19908309|gb|AAL96785.1| Gp15 protein [Clostridium phage phi3626]
 gi|170710714|gb|EDT22896.1| Gp15 protein [Clostridium perfringens B str. ATCC 3626]
          Length = 983

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 47/170 (27%), Positives = 68/170 (40%), Gaps = 20/170 (11%)

Query: 15  IGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVT------E 68
           IG    D  N +   N   + +K +EGL    Y D GG A TIGYG T S+ T       
Sbjct: 644 IGGGDGDWQNGVISSNGF-RFMKGYEGLGRYLYYDSGGIA-TIGYGVTMSEPTVFNKLKA 701

Query: 69  GMTITE----KEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNK 124
              + E    KE+ +  ++D  K    +++    L  T + +  A+ D  FN G G    
Sbjct: 702 NQPVPEEMAAKESYNLKIRDYGKP---IIQRCKELGITRQQQFDALCDLAFNAGTGRILA 758

Query: 125 STFKQRVDAQDWEKAAEECKKWTK-----AGGKVLPGLVKRRDAEVKLLL 169
           +        ++    A     W K     A G +L GL  RR AE  +  
Sbjct: 759 NNSLTNAIMRNPNDEAYIRPIWEKFIIKDAAGNILNGLKARRKAECDIYF 808


>gi|307946479|ref|ZP_07661814.1| peptidoglycan binding domain-containing protein [Roseibium sp.
           TrichSKD4]
 gi|307770143|gb|EFO29369.1| peptidoglycan binding domain-containing protein [Roseibium sp.
           TrichSKD4]
          Length = 305

 Score = 40.8 bits (94), Expect = 0.075,   Method: Compositional matrix adjust.
 Identities = 42/147 (28%), Positives = 58/147 (39%), Gaps = 12/147 (8%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----------GSDVTEGMTITEKEAEDFLL 82
           +  ++  EG    AY D  G   TIG G T          G  +  G  IT  + +  +L
Sbjct: 8   VAFIEGHEGFVARAYLDPAG-VLTIGTGFTNRSGVFREFWGGKLKPGDRITRDQNKK-VL 65

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           K A K        +   K   ++   A    VFNLG        F+     +    A   
Sbjct: 66  KAALKGEYEPPVKAAMPKGAKQHEFDAAVSAVFNLGPKFVTWKAFQLWKAGEHQAAANHW 125

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            K + KAGG+ L GLV+RR+ E  L L
Sbjct: 126 AKNYNKAGGRKLAGLVRRREEEAHLFL 152


>gi|326782716|ref|YP_004322912.1| lysozyme murein [Synechococcus phage S-SM1]
 gi|310002930|gb|ADO97329.1| lysozyme murein [Synechococcus phage S-SM1]
          Length = 918

 Score = 40.4 bits (93), Expect = 0.077,   Method: Composition-based stats.
 Identities = 39/117 (33%), Positives = 50/117 (42%), Gaps = 14/117 (11%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLNLL 92
           M+KE EGLRL  Y D   G  TIGYGH    SD     TI+   A     KD +   +  
Sbjct: 403 MIKEHEGLRLNKYND-SKGYPTIGYGHLVRPSDNIPN-TISRSYANKLFDKDYAHHAS-A 459

Query: 93  LESSPALKSTSENRLVAVADFVFNLGIGNYNK-----STFKQRVDAQDWEKAAEECK 144
               P   + S  +  A+ D  FN+G   Y       + FK+     D+E A  E K
Sbjct: 460 ASKIPGFHNASAQQKAALIDLTFNMGPSWYKDFPRMMTAFKK----GDYETAGAELK 512


>gi|222148724|ref|YP_002549681.1| phage related lysozyme protein [Agrobacterium vitis S4]
 gi|221735710|gb|ACM36673.1| phage related lysozyme protein [Agrobacterium vitis S4]
          Length = 192

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 36/138 (26%), Positives = 60/138 (43%), Gaps = 14/138 (10%)

Query: 33  IKMLKEFEGLRLTAYRDIGG--GAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLN 90
           +K+++ +EG  L AY D       WTI  G T   V+ GM  T++     L+    K   
Sbjct: 44  VKIIQPWEGRSLKAYYDTIARPPVWTICDGDT-DKVSPGMVETQEGCNKRLVVKLVKDYR 102

Query: 91  LLLESSPALKSTSE------NRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
                +P  K   +      +    +    +N+G+G    ST  +      + ++ E   
Sbjct: 103 -----APVAKCVGDWDRKPLSWRATMLTLSWNVGVGATCNSTAVRLAKVGKFRESCEAAT 157

Query: 145 KWTKAGGKVLPGLVKRRD 162
            + +AGGKV+ GLV RR+
Sbjct: 158 AFNRAGGKVITGLVNRRE 175


>gi|327314353|ref|YP_004329790.1| hypothetical protein HMPREF9137_2136 [Prevotella denticola F0289]
 gi|326945057|gb|AEA20942.1| conserved hypothetical protein [Prevotella denticola F0289]
          Length = 141

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 40/153 (26%), Positives = 65/153 (42%), Gaps = 26/153 (16%)

Query: 26  IPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLL 82
           +P    ++ ++K FEGL         G    +GYGH    G   T  MT  E++A+  L 
Sbjct: 4   LPPFERVVVVVKYFEGLHRK------GCYPYVGYGHQLQPGEHFTADMT--ERQADSLLR 55

Query: 83  KDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN------YNKSTFKQRVDAQDW 136
            D  K            K   ++ L+ ++   +N+G+G       + KS   ++++  D 
Sbjct: 56  ADLWKCFE-------HFKGYGKDALL-LSLLAYNVGVGRLLGYGKHPKSRLLRKIEVGD- 106

Query: 137 EKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
                E   + +  GKV+ GLVKRR  E  L  
Sbjct: 107 RNIYREYVSFCRYKGKVVRGLVKRRQVEFALFF 139


>gi|288802649|ref|ZP_06408087.1| lysozyme-related protein [Prevotella melaninogenica D18]
 gi|299141701|ref|ZP_07034837.1| lysozyme-related protein [Prevotella oris C735]
 gi|288334799|gb|EFC73236.1| lysozyme-related protein [Prevotella melaninogenica D18]
 gi|298577037|gb|EFI48907.1| lysozyme-related protein [Prevotella oris C735]
          Length = 169

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 51/116 (43%), Gaps = 10/116 (8%)

Query: 57  IGYGH---TGSDVTEGMTITEKEAEDFLLKDASKSL-NLLLESSPALKSTSENRLVAVAD 112
           +GYGH    G   T  MT  E++A+  L  D  K   +       AL  T     V V  
Sbjct: 57  VGYGHQLLPGEHFTAAMT--ERQADSLLRADLWKCFEHFKGYGKDALLLTLLAYNVGVGR 114

Query: 113 FVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
               LG GN+ KS   +++++ D      E   + +  GKVL GLVKRR  E  L 
Sbjct: 115 L---LGYGNHPKSRLIRKIESGD-RNYYREFVSFCRYKGKVLRGLVKRRKVEFALF 166


>gi|281425497|ref|ZP_06256410.1| lysozyme-related protein [Prevotella oris F0302]
 gi|281400490|gb|EFB31321.1| lysozyme-related protein [Prevotella oris F0302]
          Length = 169

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 46/146 (31%), Positives = 63/146 (43%), Gaps = 17/146 (11%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKEAEDFLLK 83
           P   A++  +K FEGL     +D       +GYGH    G   T  MT  E++A+  L  
Sbjct: 34  PFERAVV-CIKYFEGLH--GRKDYP----YVGYGHQLLPGEHFTAAMT--ERQADSLLRA 84

Query: 84  DASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEE 142
           D  K   +       AL  T     V V      LG GN+ KS   +++++ D      E
Sbjct: 85  DLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGNHPKSRLIRKIESGD-RNFYRE 140

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLL 168
              + +  GKVL GLVKRR  E  L 
Sbjct: 141 FVSFCRHKGKVLRGLVKRRKVEFALF 166


>gi|330858509|ref|YP_004414884.1| putative endolysin [Shigella phage Shfl1]
 gi|327397443|gb|AEA72946.1| putative endolysin [Shigella phage Shfl1]
          Length = 162

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 48/112 (42%), Gaps = 3/112 (2%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           +L+  EG+    Y DI G   T+  G TG DV  G   T++E +  L+K    +   + +
Sbjct: 22  LLERIEGIEYEVYYDIAG-VPTVCSGITGPDVIPGKKYTKRECDALLIKHIGVAQRYVDK 80

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKW 146
                         ++  F FN+G G +  ST  + ++     +A  +  +W
Sbjct: 81  KVKV--DIPVTMRASLYSFTFNVGTGAFGSSTMLKLINQGKHREACNQLWRW 130


>gi|158345181|ref|YP_001522888.1| putative C-terminus lysozyme motif internal virion protein
           [Enterobacteria phage LKA1]
 gi|114796477|emb|CAK25015.1| putative C-terminus lysozyme motif internal virion protein
           [Pseudomonas phage LKA1]
          Length = 854

 Score = 40.4 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 17/126 (13%)

Query: 29  PNALIKMLKEF---EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDA 85
           P+A+++  ++    EG+RLTAY+D  G A  +G   TG  +  G TIT +EAE   L  +
Sbjct: 710 PDAVLQWRRDLVQQEGIRLTAYKDRNGVAIGVGENVTGR-MKVGDTITREEAELAFLDSS 768

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLG-------------IGNYNKSTFKQRVD 132
            ++L      +  L  T+    +A+   V+ LG             I N +  TF+++V 
Sbjct: 769 DRALLEGERIAQELGVTAVWSKLALGSAVYQLGPQGARGFEKTFEAIRNKDFDTFEKQVR 828

Query: 133 AQDWEK 138
              W K
Sbjct: 829 KSKWYK 834


>gi|325859529|ref|ZP_08172670.1| phage lysozyme [Prevotella denticola CRIS 18C-A]
 gi|325482972|gb|EGC85964.1| phage lysozyme [Prevotella denticola CRIS 18C-A]
          Length = 168

 Score = 40.0 bits (92), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 45/155 (29%), Positives = 67/155 (43%), Gaps = 33/155 (21%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEG+           +W     +GYGH    G   T  MT  E++A+ 
Sbjct: 33  PFERAVV-VVKYFEGMH----------SWKNYPYVGYGHQLQRGERFTADMT--ERQADS 79

Query: 80  FLLKDASKSL-NLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQD--- 135
            L  D  K   +       AL  T     V V      LG G ++KS   ++++A D   
Sbjct: 80  LLRADLWKCFEHFKGYGKDALLLTLLAYNVGVGRL---LGYGKHSKSRLLRKIEAGDRNF 136

Query: 136 -WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
            WE  +     + +  GKVL GLV+RR  E+ L  
Sbjct: 137 YWEYVS-----FCRYKGKVLRGLVRRRQVELALFF 166


>gi|83945477|ref|ZP_00957824.1| lysozyme family protein [Oceanicaulis alexandrii HTCC2633]
 gi|83851053|gb|EAP88911.1| lysozyme family protein [Oceanicaulis alexandrii HTCC2633]
          Length = 596

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 38/141 (26%), Positives = 66/141 (46%), Gaps = 9/141 (6%)

Query: 35  MLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLE 94
           ++K  E    TA R   G  W +GYGHT +   EG+T+  ++A+  L+ D  ++    L+
Sbjct: 14  LIKAHEPFLATAERR--GKRWVVGYGHTAA-AKEGVTLKPEDADLLLIYDVMRA-EQTLD 69

Query: 95  SSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKA--GGK 152
           +S   +  +  R  A+  F  ++G+  +  S   +        +AA     W +A   G+
Sbjct: 70  ASVGAEMAAPMR-DALVSFALSVGLRAFKVSDVARLARDGRHREAAAAIDTWVRAEQDGR 128

Query: 153 VLPG--LVKRRDAEVKLLLES 171
           ++    LV RR AE  L L +
Sbjct: 129 LVVSDRLVARRAAEKALYLSA 149


>gi|167583572|ref|YP_001671762.1| lysis protein [Enterobacteria phage phiEco32]
 gi|164375410|gb|ABY52818.1| lysis protein [Enterobacteria phage phiEco32]
          Length = 163

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 66/150 (44%), Gaps = 15/150 (10%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT----GSDVTEGMTITEKEAEDFLLKDAS 86
           A ++ + + EG+R  AY+D   G WTI  G T    G  V +G+T + ++    L +D  
Sbjct: 16  AGMEFIMKHEGMRTKAYKD-SAGIWTICVGATRDMNGYPVRQGLTYSIEDCLALLDRDTQ 74

Query: 87  KSLNLLLES--SPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECK 144
            S+    ++   P L     +   A+  F FN+G G  + S  ++ ++ +       E  
Sbjct: 75  DSVRATQKNIKVPLLV----HEFDALTSFNFNVGSGALSTSKLRKVINGEVKGDVYSEFL 130

Query: 145 KW----TKAGGKVLPGLVKRRDAEVKLLLE 170
           +W     K   +   GL  RR AE  L  E
Sbjct: 131 RWDKITVKGEKQRSQGLHNRRVAEADLYTE 160


>gi|187934624|ref|YP_001886430.1| phage lysozyme [Clostridium botulinum B str. Eklund 17B]
 gi|187722777|gb|ACD23998.1| phage lysozyme [Clostridium botulinum B str. Eklund 17B]
          Length = 266

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/152 (26%), Positives = 68/152 (44%), Gaps = 10/152 (6%)

Query: 28  VPNALIKMLKEFEGLRLTA--YRDIGGGAWTIGYGHTGSDVTEGM--TITEKEAEDFLLK 83
           V ++ I  +K +EG       Y D+ G   T GYG TG ++ E +   I+E EA   L +
Sbjct: 111 VSDSCIDFIKLWEGFPEEGRKYYDMVG-VLTQGYGMTGKEI-ENLPDQISEYEATKLLKE 168

Query: 84  DASKSLNLLLESSPALKSTS--ENRLVAVADFVFNLGIGNYNKSTFKQRVDA--QDWEKA 139
             +K    +++     K     +N   ++  F +N G      ST  + + A  +D +  
Sbjct: 169 WINKKYAPVIKKDLDSKGICLKQNEFDSLVSFAYNCGTSGLLGSTLYRNIVAGIRDKDTI 228

Query: 140 AEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
               + W+  GGK + GL +RR  E  + L +
Sbjct: 229 TSNFQAWSNGGGKRIEGLYRRRTKEADMFLNA 260


>gi|301307305|ref|ZP_07213317.1| phage lysozyme [Escherichia coli MS 124-1]
 gi|300837498|gb|EFK65258.1| phage lysozyme [Escherichia coli MS 124-1]
          Length = 131

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 57/126 (45%), Gaps = 13/126 (10%)

Query: 53  GAWTIGYGHT---GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVA 109
           G WTI  G T   G  V   M +++++ +     +  K+L  +  +       +E +   
Sbjct: 1   GIWTICRGATVVDGKTVFPNMKLSKEKCDQVNAIERDKALAWVERNIKV--PLTEPQKAG 58

Query: 110 VADFV-FNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP-------GLVKRR 161
           +A F  +N+G G    STF +R++A D + A E  + W K GG+          G V RR
Sbjct: 59  IASFCPYNIGPGKCFPSTFYKRLNAGDRKGACEAIRWWIKDGGRDCRIRSNNCYGQVIRR 118

Query: 162 DAEVKL 167
           D E  L
Sbjct: 119 DQESAL 124


>gi|331035451|gb|AEC53008.1| hypothetical cyanophage protein [Synechococcus phage S-CRM01]
          Length = 864

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 52/121 (42%), Gaps = 12/121 (9%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT--------GSDVTEGMTITEKEAE 78
           P    L K+LK +EGLR +AY+D   G  TIG G T           V  G  ITE EAE
Sbjct: 610 PFDKNLAKLLKNYEGLRTSAYKD-AVGIPTIGIGATYYPKGFRLSGKVQMGQKITETEAE 668

Query: 79  DFLLKDASKSLNLLLE--SSPALKSTSENRLVAVADFVFNLG-IGNYNKSTFKQRVDAQD 135
               +   +    LL   SS       +N   A+    FN G +G       KQ V +++
Sbjct: 669 FIKEQHIKEHRGRLLREISSSEYSKVPDNVKAALESKTFNYGSLGGPLSKLVKQGVQSKE 728

Query: 136 W 136
           +
Sbjct: 729 Y 729


>gi|281424477|ref|ZP_06255390.1| lysozyme-related protein [Prevotella oris F0302]
 gi|281401314|gb|EFB32145.1| lysozyme-related protein [Prevotella oris F0302]
          Length = 143

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 43/158 (27%), Positives = 67/158 (42%), Gaps = 35/158 (22%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEGL            W     +GYGH    G   T  MT  E++A+ 
Sbjct: 8   PFERAVV-VVKYFEGLH----------GWKNYPYVGYGHQLQRGERFTADMT--ERQADS 54

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN------YNKSTFKQRVDA 133
            L  D  K            K   ++ L+ +    +N+G+G       + KS+  ++++A
Sbjct: 55  LLRADLWKCFE-------HFKGYGKDALL-LTLLAYNVGVGRLIGYSKHPKSSLLRKIEA 106

Query: 134 QDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
            D      E   + +  GKVL GL+KRR  E  L   S
Sbjct: 107 GD-RSFYREYVSFCRYKGKVLNGLIKRRQVEFVLFFIS 143


>gi|66820887|ref|XP_643994.1| glycoside hydrolase family 24 protein [Dictyostelium discoideum
           AX4]
 gi|74860415|sp|Q86AA1|LYST2_DICDI RecName: Full=Probable T4-type lysozyme 2; AltName: Full=Muramidase
 gi|60472085|gb|EAL70038.1| glycoside hydrolase family 24 protein [Dictyostelium discoideum
           AX4]
          Length = 170

 Score = 40.0 bits (92), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 45/146 (30%), Positives = 66/146 (45%), Gaps = 33/146 (22%)

Query: 31  ALIKMLKEFEGLRLTAYRDIGGGAWTIGYGH---TGSDVTEGMTITEKE----------- 76
           +L  MLK  EG +L  Y+D  G  +TIG GH      D  E + I E E           
Sbjct: 4   SLKDMLKYDEGEKLEMYKDTEGN-YTIGIGHLITKNKDKNEAIKILEGEIGHTVKLNSKK 62

Query: 77  --------AEDFLLKDASKSLNLLLESSPALKST----SENRLVAVADFVFNLGIGNYNK 124
                   +E    KD S ++N  +E+S  L +       NR +A+A+ VF +G  N +K
Sbjct: 63  EPEISSSESESLFEKDKSVAIN-SIENSSTLSTIYNNLDSNRKMALANMVFQMGASNVSK 121

Query: 125 STFKQR---VDAQDWEKAAEECKKWT 147
             FK+    ++ + W +AA E K  T
Sbjct: 122 --FKKSLKLIEEKKWAEAAIELKNST 145


>gi|281306693|ref|YP_003345499.1| predicted phage lysozyme [Pseudomonas phage phi-2]
 gi|271277998|emb|CBH51604.1| predicted phage lysozyme [Pseudomonas phage phi-2]
          Length = 860

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 37/128 (28%), Positives = 57/128 (44%), Gaps = 6/128 (4%)

Query: 26  IPVPNA--LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLK 83
           IPV  A    K L  FE  R T Y+D  G A  IG+  TG  + EG  I++ +AE +  +
Sbjct: 715 IPVRAAYNFRKELAGFESYRDTVYKDRNGLAVGIGHNVTGQ-MKEGDKISKAQAEQWFRE 773

Query: 84  DASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQ-DWEKAAEE 142
           D   ++ +  + +  L         A+A  VF LG   ++         A+ DW    +E
Sbjct: 774 DTDTAMQVGSQLAGQLGVRDGRAKAALAGAVFQLGAAGFDDHQRTADAIAKVDWNSFVKE 833

Query: 143 CK--KWTK 148
            +  KW +
Sbjct: 834 VRSSKWAE 841


>gi|56553847|pdb|1T8G|A Chain A, Crystal Structure Of Phage T4 Lysozyme Mutant
           L32aL33AT34AC54TC97AE108V
          Length = 164

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 38/135 (28%), Positives = 59/135 (43%), Gaps = 23/135 (17%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDV-----------------TEGMTITE 74
           + +ML+  EGLRL  Y+D   G +TIG GH  +                   T G+ IT+
Sbjct: 3   IFEMLRIDEGLRLKIYKDT-EGYYTIGIGHAATKSPSLNAAKSELDKAIGRNTNGV-ITK 60

Query: 75  KEAEDFLLKDASKSLNLLLESS---PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV 131
            EAE    +D   ++  +L ++   P   S    R  A+ + VF +G+      T   R+
Sbjct: 61  DEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGVTGVAGFTNSLRM 120

Query: 132 DAQD-WEKAAEECKK 145
             Q  W++AA    K
Sbjct: 121 LQQKRWDEAAVNLAK 135


>gi|117623492|ref|YP_852405.1| putative phage lysozyme [Escherichia coli APEC O1]
 gi|115512616|gb|ABJ00691.1| putative phage lysozyme [Escherichia coli APEC O1]
          Length = 146

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 10/113 (8%)

Query: 63  GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGN 121
           G  V  GM +++++ +     +  K+L  + ++       SE +   +A F  +N+G G 
Sbjct: 29  GKPVFPGMKLSKEKCDQVNAIERDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGK 86

Query: 122 YNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP-------GLVKRRDAEVKL 167
              STF +R++A D   A E  + W K GG+          G V RRD E  L
Sbjct: 87  CFPSTFYKRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESAL 139


>gi|323949600|gb|EGB45486.1| phage lysozyme [Escherichia coli H252]
          Length = 134

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 52/115 (45%), Gaps = 10/115 (8%)

Query: 63  GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFV-FNLGIGN 121
           G  V  GM +++++ +     +  K+L  + ++       SE +   +A F  +N+G G 
Sbjct: 17  GKPVFPGMKLSKEKCDQVNAIERDKALAWVEKNIKV--PLSEPQKAGIASFCPYNIGPGK 74

Query: 122 YNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLP-------GLVKRRDAEVKLLL 169
              STF +R++A D   A E  + W K GG+          G V RRD E  L  
Sbjct: 75  CFPSTFYKRINAGDRRGACEAIRWWIKDGGRDCRIRSNNCYGQVSRRDQESALAC 129


>gi|190573833|ref|YP_001971678.1| putative glycosidase [Stenotrophomonas maltophilia K279a]
 gi|190011755|emb|CAQ45375.1| putative glycosidase [Stenotrophomonas maltophilia K279a]
          Length = 167

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 60/136 (44%), Gaps = 12/136 (8%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPAL 99
           EG    A   + G   TIG+G T S V  G T T  +A    L D  +    L   +   
Sbjct: 27  EGYTDRAVIPVKGDVPTIGFGTT-SGVKIGDTTTPPKALARALTDVQQFEGAL--KTCVT 83

Query: 100 KSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGK--VLP-- 155
              +++   A+  F +N+G   + +ST  ++++A D+  A  E  +W    GK   LP  
Sbjct: 84  VPLAQHEYDALVSFSYNVGSRAFCQSTLVRKLNAGDYAGACSELLRWRFFQGKDCALPAN 143

Query: 156 -----GLVKRRDAEVK 166
                GL  RR+AE +
Sbjct: 144 TRLCGGLATRREAEYR 159


>gi|323172075|gb|EFZ57715.1| lysozyme [Escherichia coli LT-68]
          Length = 111

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/81 (35%), Positives = 43/81 (53%), Gaps = 7/81 (8%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT---GSDVTEGMTITEKEAEDFLLK 83
           P P+ L + L E EG   TAYRD G G WTI  G T   G  V  GM +++++ +     
Sbjct: 22  PAPDILDQFLDEKEGNHTTAYRD-GSGIWTICRGATMVDGKPVFPGMKLSKEKCDQVNAI 80

Query: 84  DASKSLNLLLESSPALKSTSE 104
           +  K+L  +  +   +KSTS+
Sbjct: 81  ERDKALAWVERN---IKSTSD 98


>gi|238801690|ref|YP_002922746.1| gp74 [Burkholderia phage BcepIL02]
 gi|237688065|gb|ACR15067.1| gp74 [Burkholderia phage BcepIL02]
          Length = 174

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 45/100 (45%), Gaps = 4/100 (4%)

Query: 56  TIGYGHT----GSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVA 111
           TIG+G T    G+ V  G TIT K A++      +K    L  S P      +       
Sbjct: 42  TIGHGSTRYEDGTPVKMGDTITRKRADELARNLMAKDERDLRASLPPDTRLYQAEYDVYL 101

Query: 112 DFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGG 151
           DFV   GIGN+ KS+ ++ + A ++  A +    +  A G
Sbjct: 102 DFVGQYGIGNWRKSSMRRNIVAGEYAAACKALLNYRFAAG 141


>gi|307258164|ref|ZP_07539914.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
 gi|306863349|gb|EFM95282.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 10 str. D13039]
          Length = 135

 Score = 39.3 bits (90), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 36/110 (32%), Positives = 53/110 (48%), Gaps = 19/110 (17%)

Query: 72  ITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGN----YNKSTF 127
           I E+   D  LK A   +N         +  ++N+  A++   FN+G  N    Y+K+  
Sbjct: 27  IAERWVHD--LKIAQNCINTYFNG----RRMNDNQFSAMSSLAFNIGCTNIRSYYSKAQG 80

Query: 128 KQRVDAQDWEKAA-----EECKK---WTKAGGKVLPGLVKRRDAEVKLLL 169
           K RV    ++ AA       C++   + KAGG VL GLV RR+AE  L L
Sbjct: 81  K-RVFTTIYKYAALNQFDAMCQRIIDFNKAGGVVLRGLVTRREAERDLCL 129


>gi|195546681|ref|YP_002117762.1| putative injection needle component [Pseudomonas phage PT5]
 gi|195546743|ref|YP_002117821.1| internal virion protein [Pseudomonas phage PT2]
 gi|158187642|gb|ABW23119.1| putative injection needle component [Pseudomonas phage PT5]
 gi|165880752|gb|ABY71007.1| internal virion protein [Pseudomonas phage PT2]
          Length = 898

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           K L +FE  R  AY+D  G  +++G GH     +   G T+T ++A  +  +D  ++L+ 
Sbjct: 747 KELAQFEAYRGEAYKDADG--YSVGLGHYLGSGNAGAGTTVTPEQAAQWFAEDTDRALDQ 804

Query: 92  LLESSPALKSTSENRLVAVADFVFNLG-------------IGNYNKSTFKQRVDAQDW 136
            +  +  L  T+   ++ +A   F +G             I + NK  F+  V    W
Sbjct: 805 GVRLADELGVTNNASILGLAGMAFQMGEGRARQFRNTFQAIKDRNKEAFEAGVRNSKW 862


>gi|167600482|ref|YP_001671981.1| internal virion protein [Pseudomonas phage LUZ19]
 gi|161168345|emb|CAP45509.1| internal virion protein [Pseudomonas phage LUZ19]
          Length = 898

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           K L +FE  R  AY+D  G  +++G GH     +   G T+T ++A  +  +D  ++L+ 
Sbjct: 747 KELAQFEAYRGEAYKDADG--YSVGLGHYLGSGNAGAGTTVTPEQAAQWFAEDTDRALDQ 804

Query: 92  LLESSPALKSTSENRLVAVADFVFNLG-------------IGNYNKSTFKQRVDAQDW 136
            +  +  L  T+   ++ +A   F +G             I + NK  F+  V    W
Sbjct: 805 GVRLADELGVTNNASILGLAGMAFQMGEGRARQFRNTFQAIKDRNKEAFEAGVRNSKW 862


>gi|158345063|ref|YP_001522828.1| putative internal virion protein [Pseudomonas phage LKD16]
 gi|114796416|emb|CAK25972.1| putative internal virion protein [Pseudomonas phage LKD16]
          Length = 898

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           K L +FE  R  AY+D  G  +++G GH     +   G T+T ++A  +  +D  ++L+ 
Sbjct: 747 KELAQFEAYRGEAYKDADG--YSVGLGHYLGSGNAGAGTTVTPEQAAQWFAEDTDRALDQ 804

Query: 92  LLESSPALKSTSENRLVAVADFVFNLG-------------IGNYNKSTFKQRVDAQDW 136
            +  +  L  T+   ++ +A   F +G             I + NK  F+  V    W
Sbjct: 805 GVRLADELGVTNNASILGLAGMAFQMGEGRARQFRNTFQAIKDRNKEAFEAGVRNSKW 862


>gi|33300847|ref|NP_877475.1| structural protein containing C-terminal lysozyme domain
           [Pseudomonas phage phiKMV]
 gi|33284818|emb|CAD44227.1| structural protein containing C-terminal lysozyme domain
           [Enterobacteria phage phiKMV]
          Length = 898

 Score = 39.3 bits (90), Expect = 0.17,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           K L +FE  R  AY+D  G  +++G GH     +   G T+T ++A  +  +D  ++L+ 
Sbjct: 747 KELAQFEAYRGEAYKDADG--YSVGLGHYLGSGNAGAGTTVTPEQAAQWFAEDTDRALDQ 804

Query: 92  LLESSPALKSTSENRLVAVADFVFNLG-------------IGNYNKSTFKQRVDAQDW 136
            +  +  L  T+   ++ +A   F +G             I + NK  F+  V    W
Sbjct: 805 GVRLADELGVTNNASILGLAGMAFQMGEGRARQFRNTFQAIKDRNKEAFEAGVRNSKW 862


>gi|225626363|ref|YP_002727859.1| putative internal virion protein [Pseudomonas phage phikF77]
 gi|225594872|emb|CAX63157.1| putative internal virion protein [Pseudomonas phage phikF77]
          Length = 898

 Score = 39.3 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 52/118 (44%), Gaps = 17/118 (14%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGH--TGSDVTEGMTITEKEAEDFLLKDASKSLNL 91
           K L +FE  R  AY+D  G  +++G GH     +   G T+T ++A  +  +D  ++L+ 
Sbjct: 747 KELAQFEAYRGEAYKDADG--YSVGLGHYLGSGNAGAGTTVTPEQAAQWFAEDTDRALDQ 804

Query: 92  LLESSPALKSTSENRLVAVADFVFNLGIG-------------NYNKSTFKQRVDAQDW 136
            +  +  L  T+   ++ +A   F +G G             + NK  F+  V    W
Sbjct: 805 GVRLADELGVTNNASILGLAGMAFQMGEGRARQFRNTFQAIRDRNKEAFEAGVRNSKW 862


>gi|282860024|ref|ZP_06269108.1| conserved hypothetical protein [Prevotella bivia JCVIHMP010]
 gi|282587230|gb|EFB92451.1| conserved hypothetical protein [Prevotella bivia JCVIHMP010]
          Length = 168

 Score = 39.3 bits (90), Expect = 0.20,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 63/154 (40%), Gaps = 31/154 (20%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEG+           +W     +GYGH    G   T  MT  E +A+ 
Sbjct: 33  PFERAVV-VVKYFEGMH----------SWKNYPYVGYGHQLQPGERFTADMT--EWQADS 79

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFN----LGIGNYNKSTFKQRVDAQD 135
            L  D  K +    E         +  L+AV  +       LG G + KS   ++++  D
Sbjct: 80  LLRADLWKCIECFKEYG------KDALLLAVLSYNVGVGRLLGYGKHPKSKLLKKIEGGD 133

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
                 E   + +  GKVL GLVKRR  E  L  
Sbjct: 134 -RSIYREYVSFCRYKGKVLRGLVKRRQVEFALFF 166


>gi|157833964|pdb|1TLA|A Chain A, Hydrophobic Core Repacking And Aromatic-Aromatic
           Interaction In The Thermostable Mutant Of T4 Lysozyme
           Ser 117 (Right Arrow) Phe
          Length = 164

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 36/134 (26%), Positives = 61/134 (45%), Gaps = 21/134 (15%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGH----------TGSDVTEGM------TITEK 75
           + +ML+  EGLRL  Y+D   G +TIG GH            S++ + +       IT+ 
Sbjct: 3   IFEMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKD 61

Query: 76  EAEDFLLKDASKSLNLLLESS---PALKSTSENRLVAVADFVFNLG-IGNYNKSTFKQRV 131
           EAE    +D   ++  +L ++   P   S    R  A+ + VF +G  G    + F + +
Sbjct: 62  EAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNFLRML 121

Query: 132 DAQDWEKAAEECKK 145
             + W++AA    K
Sbjct: 122 QQKRWDEAAVNLAK 135


>gi|295097110|emb|CBK86200.1| hypothetical protein ENC_27150 [Enterobacter cloacae subsp. cloacae
           NCTC 9394]
          Length = 112

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 42/89 (47%), Gaps = 2/89 (2%)

Query: 28  VPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKDAS 86
           + +A I ++K+ +GL L  YRD   G W IGYGH      +    IT  EAE+ L  D  
Sbjct: 8   ISSAAIALIKKQQGLSLEKYRD-EKGIWVIGYGHVIRQWEKFNSLITPIEAENLLFNDIQ 66

Query: 87  KSLNLLLESSPALKSTSENRLVAVADFVF 115
               LL E +    +  ++  + +  F F
Sbjct: 67  LCEALLREMNKRPLTQQQHDALILTLFSF 95


>gi|152999288|ref|YP_001364969.1| glycoside hydrolase family protein [Shewanella baltica OS185]
 gi|151363906|gb|ABS06906.1| glycoside hydrolase family 24 [Shewanella baltica OS185]
          Length = 174

 Score = 39.3 bits (90), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 56/127 (44%), Gaps = 16/127 (12%)

Query: 56  TIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVF 115
           T  +GHT  ++      +E++  +   KD  K+   L   +  ++ T E    A    ++
Sbjct: 47  TACFGHTDPELEINQFFSEQQCIEMFAKDLGKADRQLRRLTYPVQLT-EGEHAAYLSLIY 105

Query: 116 NLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKV------------LPGLVKRRDA 163
           N G GN+  ST ++ +     E+ A  C + T+A GK              PGLV+RR  
Sbjct: 106 NFGAGNFQTSTLRKLL--LRGERVA-ACHQLTEACGKHGCNGFVYARDIKQPGLVERRAK 162

Query: 164 EVKLLLE 170
           E  + L+
Sbjct: 163 EQSICLK 169


>gi|328545614|ref|YP_004305723.1| Lysozyme [polymorphum gilvum SL003B-26A1]
 gi|326415355|gb|ADZ72418.1| Lysozyme [Polymorphum gilvum SL003B-26A1]
          Length = 313

 Score = 39.3 bits (90), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 45/143 (31%), Positives = 56/143 (39%), Gaps = 17/143 (11%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHT--------------GSDVTEGMTITEKEAEDFLLKDA 85
           EG    AYRD  G   TIG G+T              G  +  G TIT +E    L K  
Sbjct: 19  EGFVSRAYRDPVG-VLTIGTGYTNRSKVFRGYWIATRGRQLKPGDTITREECLKILPKIV 77

Query: 86  SKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKK 145
            +     +     ++   ++     A   FNLG G       K          AA   K 
Sbjct: 78  DEEYGAAVVRH--IRPKFQHHYDGAASVCFNLGPGAATWKWAKALAAGDAAGSAALLRKT 135

Query: 146 WTKAGGKVLPGLVKRRDAEVKLL 168
            T AGG+ LPGLVKRR AE  L+
Sbjct: 136 GTTAGGRRLPGLVKRRQAEALLV 158


>gi|7246018|pdb|1D9W|A Chain A, Bacteriophage T4 Lysozyme Mutant
          Length = 164

 Score = 38.9 bits (89), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 37/129 (28%), Positives = 59/129 (45%), Gaps = 21/129 (16%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGH----------TGSDVTEGM------TITEK 75
           + +ML+  EGLRL  Y+D   G +TIG GH            S++ + +       IT+ 
Sbjct: 3   IFEMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKD 61

Query: 76  EAEDFLLKDASKSLNLLLESS---PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD 132
           EAE    +D   ++  +L ++   P   S    R  A+ + VF +G       T   R+ 
Sbjct: 62  EAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRML 121

Query: 133 AQD-WEKAA 140
            QD W++AA
Sbjct: 122 QQDRWDEAA 130


>gi|251780627|ref|ZP_04823547.1| phage lysozyme, putative [Clostridium botulinum E1 str. 'BoNT E
           Beluga']
 gi|243084942|gb|EES50832.1| phage lysozyme [Clostridium botulinum E1 str. 'BoNT E Beluga']
          Length = 263

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 40/151 (26%), Positives = 66/151 (43%), Gaps = 8/151 (5%)

Query: 28  VPNALIKMLKEFEGLRLTA--YRDIGGGAWTIGYGHTGSDVTE-GMTITEKEAEDFLLKD 84
           V +  I  +K +EG       Y D  G   T GYG TG ++ +    I+E EA   L + 
Sbjct: 108 VSDKCINFIKSWEGFEKEGKKYYDCVG-VLTQGYGMTGKEIEKLPDQISECEATKLLKEW 166

Query: 85  ASKSLNLLLESSPALKSTSENR--LVAVADFVFNLGIGNYNKSTFKQRV--DAQDWEKAA 140
            +K    +++     K+ + N+    A+  F +N G      ST  + V    +D +   
Sbjct: 167 INKKYAPVVKKDLDSKAINLNQHEFDALVSFAYNCGTSGLLGSTLYKNVCNGIRDKDTII 226

Query: 141 EECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
              + W+  GGK + GL +RR  E  + L +
Sbjct: 227 ANFQAWSNGGGKRIEGLYRRRTKEAAMFLNA 257


>gi|307245362|ref|ZP_07527450.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|307254317|ref|ZP_07536155.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261]
 gi|307258775|ref|ZP_07540507.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
 gi|306853703|gb|EFM85920.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 1 str. 4074]
 gi|306862616|gb|EFM94572.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 9 str. CVJ13261]
 gi|306867126|gb|EFM98982.1| Lysozyme [Actinobacillus pleuropneumoniae serovar 11 str. 56153]
          Length = 73

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 103 SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRD 162
           ++++  A+    FN+G G + +ST  + ++  D++ A+ +   W  AGG+  P L+ RR 
Sbjct: 4   TQHQFDALVSLAFNIGNGAFRRSTLLKLLNRSDYKGASAQFLVWKNAGGR--PILLNRRK 61

Query: 163 AEVKLLLE 170
            E +L  E
Sbjct: 62  REKRLFDE 69


>gi|261341998|ref|ZP_05969856.1| putative phage-related lysozyme [Enterobacter cancerogenus ATCC
           35316]
 gi|288315913|gb|EFC54851.1| putative phage-related lysozyme [Enterobacter cancerogenus ATCC
           35316]
          Length = 112

 Score = 38.9 bits (89), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 50/115 (43%), Gaps = 6/115 (5%)

Query: 17  MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE 76
           MNG      + +  A ++++K+ +GL L  YRD     W IGYGH          I   +
Sbjct: 1   MNG----YSLQISLAAVELIKKQQGLSLEKYRD-AQDVWVIGYGHVIRAWERFDIIITPD 55

Query: 77  AEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRV 131
             D LL++  +    LL  +     T       VA ++F+LG    +++   Q V
Sbjct: 56  DADMLLENDLRICEALLRENITRPLTQRQHDTLVA-WIFSLGDTPLSETALHQAV 109


>gi|325854904|ref|ZP_08171644.1| hypothetical protein HMPREF9303_1932 [Prevotella denticola CRIS
           18C-A]
 gi|325484030|gb|EGC86969.1| hypothetical protein HMPREF9303_1932 [Prevotella denticola CRIS
           18C-A]
          Length = 141

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 43/154 (27%), Positives = 63/154 (40%), Gaps = 31/154 (20%)

Query: 27  PVPNALIKMLKEFEGLRLTAYRDIGGGAW----TIGYGHT---GSDVTEGMTITEKEAED 79
           P   A++ ++K FEG+           +W     +GYGH    G   T  MT  E +A+ 
Sbjct: 6   PFERAVV-VVKYFEGMH----------SWKNYPYVGYGHQLQPGERFTADMT--EWQADS 52

Query: 80  FLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFN----LGIGNYNKSTFKQRVDAQD 135
            L  D  K +    E         +  L+AV  +       LG G + KS   ++++  D
Sbjct: 53  LLRADLWKCIECFKEYG------KDALLLAVLSYNVGVGRLLGYGKHPKSKLLKKIEGGD 106

Query: 136 WEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
                 E   + +  GKVL GLVKRR  E  L  
Sbjct: 107 -RSIYREYVSFCRYKGKVLRGLVKRRQVEFALFF 139


>gi|218688701|ref|YP_002396913.1| prophage lysozyme [Escherichia coli ED1a]
 gi|218426265|emb|CAR07090.1| Prophage lysozyme responsible for host cell lysis (Muramidase)
           (Endolysin) [Escherichia coli ED1a]
          Length = 183

 Score = 38.9 bits (89), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/137 (23%), Positives = 56/137 (40%), Gaps = 14/137 (10%)

Query: 36  LKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLES 95
           +  +E  R   YRD+ G   T+G G TG+   E    T++E     + D  ++ N + ++
Sbjct: 37  IATWEECRARPYRDLVGVG-TVGCGSTGN--VENRLYTQEEVAGRWINDMRRAENCITQN 93

Query: 96  SPALKSTSENRLVAVADFVFNLGI----------GNYNKSTFKQRVDAQDWEKAAEECKK 145
               +   ++   A+ D  FNLG           G   ++T  +    + W         
Sbjct: 94  FRG-QQMPQSAFEAMTDAAFNLGCRNLMWFKNKNGTPQRTTIWKHAQTRQWRLMCYRLTD 152

Query: 146 WTKAGGKVLPGLVKRRD 162
           +  +GG    GLV RR+
Sbjct: 153 FVNSGGTRTQGLVNRRN 169


>gi|157830905|pdb|1DYG|A Chain A, Determination Of Alpha-Helix Propensity Within The Context
           Of A Folded Protein: Sites 44 And 131 In Bacteriophage
           T4 Lysozyme
          Length = 164

 Score = 38.9 bits (89), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGH----------TGSDVTEGM------TITEK 75
           + +ML+  EGLRL  Y+D   G +TIG GH            S++ + +       IT+ 
Sbjct: 3   IFEMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKD 61

Query: 76  EAEDFLLKDASKSLNLLLESS---PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD 132
           EAE    +D   ++  +L ++   P   S    R  A+ + VF +G       T   R+ 
Sbjct: 62  EAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRML 121

Query: 133 AQD-WEKAAEECKK 145
            Q  W++AAE   K
Sbjct: 122 QQKRWDEAAENLAK 135


>gi|312983634|gb|ADR30490.1| lysozyme-peptidase [Clostridium phage CpV1]
          Length = 542

 Score = 38.9 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 39/153 (25%), Positives = 67/153 (43%), Gaps = 16/153 (10%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVTEGMTITEKE--AEDFLLKDASKSLNL 91
           + +K +EG     Y+D  GG  TIGYG T S+ +E   +  ++  +E++  + + K    
Sbjct: 210 RFMKGYEGFGAYLYKD-SGGVPTIGYGVTKSEPSEFDDLVARQPVSEEYASQVSYKLKQT 268

Query: 92  -----LLESSPALKSTSENRLVAVADFVFNLGIG------NYNKSTFKQRVDA--QDWEK 138
                ++     +  T +N+  A+ D  FN G+G       Y       R D   + + +
Sbjct: 269 NYGKPIVNFCKEIGITKQNQFDALCDLAFNAGVGAVVGTPTYTSLPSALRKDPFNESYIR 328

Query: 139 AAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171
              E    + A G VL GL  RR AE  +  ++
Sbjct: 329 PIWENYIISDAVGNVLNGLKARRKAECDIYFKN 361


>gi|325853887|ref|ZP_08171403.1| hypothetical protein HMPREF9303_1982 [Prevotella denticola CRIS
           18C-A]
 gi|325484224|gb|EGC87154.1| hypothetical protein HMPREF9303_1982 [Prevotella denticola CRIS
           18C-A]
          Length = 180

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 64/146 (43%), Gaps = 28/146 (19%)

Query: 33  IKMLKEFEGLRLTAYRDIGGGAWT-IGYGHT---GSDVTEGMTITEKEAEDFLLKDASKS 88
           ++ +K FEG         G G +  IGYGH    G  +T  MT  E++A+  L  D    
Sbjct: 50  VRCVKYFEGWH-------GCGRYPYIGYGHRLLKGERLTADMT--ERQADSLLRAD---- 96

Query: 89  LNLLLESSPALKSTSENRLVAVADFVFNLGIG------NYNKSTFKQRVDAQDWEKAAEE 142
              LL      +   ++ L+ +    +N+G G      N  KS   ++++  D      E
Sbjct: 97  ---LLSRYALFRRFGKDALL-LTVLSYNVGTGTLLGGRNRPKSRLIRKLERGD-RNILPE 151

Query: 143 CKKWTKAGGKVLPGLVKRRDAEVKLL 168
              + +  G+VLPGL+KRR  E  L 
Sbjct: 152 YLSFCRYKGRVLPGLLKRRRMEFALF 177


>gi|294661579|ref|YP_003580033.1| gp5 baseplate hub subunit and tail lysozyme [Klebsiella phage KP15]
 gi|292660740|gb|ADE34988.1| gp5 baseplate hub subunit and tail lysozyme [Klebsiella phage KP15]
          Length = 589

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 44/165 (26%), Positives = 72/165 (43%), Gaps = 34/165 (20%)

Query: 7   IISFVKRMIGMNGDDKH-NKIPVPN-------ALIKMLKEFEGLRLTAYRDIGGGAWTIG 58
           II     +I +N DD+  ++IP  N        + KMLK+ EG+R   Y D   G  TIG
Sbjct: 147 IIRDSNTIIAVNPDDRPLDEIPEDNRPDTGGFTIEKMLKQDEGIRTRWYTD-SEGYPTIG 205

Query: 59  YGH--------------------TGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPA 98
            GH                     G +VT G TIT +E      +D +K  + +  ++  
Sbjct: 206 IGHLLIREKTRDTAKINAAISKAVGREVTNG-TITAEEVSTLFAQDLAKVRSDIQRTANV 264

Query: 99  LK---STSENRLVAVADFVFNLGIGNYNKSTFKQR-VDAQDWEKA 139
            +   + +  R +A+ +  F +G+G   K T   + +  +DW+ A
Sbjct: 265 REVYVNLNRPRQMAIENMSFQMGVGGVAKFTNTLKAMKNEDWQAA 309


>gi|5822381|pdb|1QUG|A Chain A, E108v Mutant Of T4 Lysozyme
          Length = 162

 Score = 38.5 bits (88), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 60/134 (44%), Gaps = 21/134 (15%)

Query: 32  LIKMLKEFEGLRLTAYRDIGGGAWTIGYGH----------TGSDVTEGM------TITEK 75
           + +ML+  EGLRL  Y+D   G +TIG GH            S++ + +       IT+ 
Sbjct: 3   IFEMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKD 61

Query: 76  EAEDFLLKDASKSLNLLLESS---PALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVD 132
           EAE    +D   ++  +L ++   P   S    R  A+ + VF +G+      T   R+ 
Sbjct: 62  EAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGVTGVAGFTNSLRML 121

Query: 133 AQD-WEKAAEECKK 145
            Q  W++AA    K
Sbjct: 122 QQKRWDEAAVNLAK 135


>gi|261258640|ref|ZP_05951173.1| predicted endolysin [Escherichia coli O157:H7 str. FRIK966]
          Length = 53

 Score = 38.5 bits (88), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 31/49 (63%)

Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169
           N+  ST  ++++  D + A ++ ++WT AGGK   GL+ RR+ E ++ L
Sbjct: 1   NFRTSTLLRKINQGDIKGACDQLRRWTYAGGKQWKGLMTRREIEREVCL 49


>gi|213582168|ref|ZP_03363994.1| putative lysozyme [Salmonella enterica subsp. enterica serovar
           Typhi str. E98-0664]
          Length = 85

 Score = 38.5 bits (88), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 29/62 (46%)

Query: 109 AVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLL 168
           AV  F FN+G GN   ST  + ++ + W  A  +  +W    G    GL  RR  E+   
Sbjct: 22  AVVSFAFNVGTGNACSSTLVKLLNQRRWADACHQLPRWVYVKGVFNQGLDNRRAREMAWC 81

Query: 169 LE 170
           L+
Sbjct: 82  LK 83


>gi|312964214|ref|ZP_07778526.1| phage lysozyme family protein [Escherichia coli 2362-75]
 gi|312291042|gb|EFR18915.1| phage lysozyme family protein [Escherichia coli 2362-75]
          Length = 185

 Score = 38.5 bits (88), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 74/183 (40%), Gaps = 29/183 (15%)

Query: 1   MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60
           +C I  +I+ V      NG+ + N+     A ++++   EG R