PSIBLAST alignment of GI: 254781056 and protein with PDB id: 143l

>gi|157829573|pdb|143L|A Chain A, Role Of Backbone Flexibility In The Accommodation Of Variants That Repack The Core Of T4 Lysozyme Length = 164
 Score = 57.7 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 52/144 (36%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A+ + VF +   G    +   +    
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMAQQ 123

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W++ A      +W         
Sbjct: 124 KRWDEVAVNMAKSRWYNQTPNRAK 147