PSIBLAST alignment of GI: 254781056 and protein with PDB id: 191l

>gi|157829622|pdb|191L|A Chain A, A Helix Initiation Signal In T4 Lysozyme Identified By Polyalanine Mutagenesis Length = 164
 Score = 50.0 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 49/124 (39%), Gaps = 21/124 (16%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSDVT----------------EGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRACAGAITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A+ + VF +   G    +   + +  
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQ 123

Query: 134 QDWE 137
           + W+
Sbjct: 124 KRWD 127