PSIBLAST alignment of GI: 254781056 and protein with PDB id: 1cx6

>gi|6730205|pdb|1CX6|A Chain A, T4 Lysozyme Substituted With Selenomethionine Length = 164
 Score = 46.9 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 47/138 (34%), Gaps = 23/138 (16%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEAEDFLLK 83
           EGLRL  Y+D   G +TIG GH  +                       IT+ EAE    +
Sbjct: 11  EGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQ 69

Query: 84  DASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDAQDWEKA 139
           D   ++  +L +    P   S    R  A  + VF     G    +   +    + W++A
Sbjct: 70  DVDAAVRGILRNAKXKPVYDSXDAVRRAAXINXVFQXGETGVAGFTNSXRXXQQKRWDEA 129

Query: 140 A--EECKKWTKAGGKVLP 155
           A      +W         
Sbjct: 130 AVNXAKSRWYNQTPNRAK 147