PSIBLAST alignment of GI: 254781056 and protein with PDB id: 1l25

>gi|157831681|pdb|1L25|A Chain A, Replacements Of Pro86 In Phage T4 Lysozyme Extend An Alpha- Helix But Do Not Alter Protein Stability Length = 164
 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 54/144 (37%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLESSP---ALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L ++       S    R  A+ + VF +   G    +   + +  
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKAVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQ 123

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W++AA      +W         
Sbjct: 124 KRWDEAAVNLAKSRWYNQTPNRAK 147