PSIBLAST alignment of GI: 254781056 and protein with PDB id: 1l72

>gi|157831728|pdb|1L72|A Chain A, Multiple Stabilizing Alanine Replacements Within Alpha- Helix 126-134 Of T4 Lysozyme Have Independent, Additive Effects On Both Structure And Stability Length = 164
 Score = 57.3 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 52/144 (36%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A+ + VF +   G    +   + +  
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQ 123

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W  AA      +W         
Sbjct: 124 KRWAAAAVNLAKSRWYNQTPNRAK 147