PSIBLAST alignment of GI: 254781056 and protein with PDB id: 1l79

>gi|157831734|pdb|1L79|A Chain A, Design And Structural Analysis Of Alternative Hydrophobic Core Packing Arrangements In Bacteriophage T4 Lysozyme Length = 164
 Score = 58.1 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 53/144 (36%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A  + VF +   G    +   + +  
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAAFINMVFQMGETGIAGFTNSLRMLQQ 123

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W++AA      +W         
Sbjct: 124 KRWDEAAVNLAKSRWYNQTPNRAK 147