PSIBLAST alignment of GI: 254781056 and protein with PDB id: 1swy

>gi|56966008|pdb|1SWY|A Chain A, Use Of A Halide Binding Site To Bypass The 1000-Atom Limit To Ab Initio Structure Determination Length = 164
>gi|56966009|pdb|1SX2|A Chain A, Use Of A Halide Binding Site To Bypass The 1000-Atom Limit To Structure Determination By Direct Methods Length = 164
 Score = 56.2 bits (134), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 55/144 (38%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D + ++  +L +    P   S    R  A+ + VF +   G    +   + +  
Sbjct: 64  EKLFNQDVAAAVRGILRNAKLKPVYDSLDAVRECALINMVFQMGETGVAGFTNSLRMLQQ 123

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W++AA      +W         
Sbjct: 124 KRWDEAAVNLAKSRWYNQTPNRAK 147