PSIBLAST alignment of GI: 254781056 and protein with PDB id: 1t8a

>gi|52695672|pdb|1T8A|A Chain A, Use Of Sequence Duplication To Engineer A Ligand-Triggered Long-Distance Molecular Switch In T4 Lysosyme Length = 175
>gi|52695705|pdb|1T97|A Chain A, Use Of Sequence Duplication To Engineer A Ligand-Triggered Long-Distance Molecular Switch In T4 Lysosyme Length = 175
 Score = 55.0 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 33/155 (21%), Positives = 54/155 (34%), Gaps = 34/155 (21%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD---------------------------V 66
           +ML+  EGLRL  Y+D   G +TIG GH  +                             
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSINAAKSELDKAINAAKSELDKAIGA 63

Query: 67  TEGMTITEKEAEDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNY 122
                IT+ EAE    +D   ++  +L +    P   S    R  A+ + VF +   G  
Sbjct: 64  NTNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVA 123

Query: 123 NKSTFKQRVDAQDWEKAAEEC--KKWTKAGGKVLP 155
             +   + +  + W++AA      +W         
Sbjct: 124 GFTNSLRMLQQKRWDEAAVNLAKSRWYNQTPNRAK 158