PSIBLAST alignment of GI: 254781056 and protein with PDB id: 214l

>gi|157834468|pdb|214L|A Chain A, Protein Structure Plasticity Exemplified By Insertion And Deletion Mutants In T4 Lysozyme Length = 165
 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 34/145 (23%), Positives = 54/145 (37%), Gaps = 24/145 (16%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNLGIGNYNKSTF--KQRVD 132
           E    +D   ++  +L +    P   S    R  A+ + VF +G       T   +  + 
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRAMLQ 123

Query: 133 AQDWEKAAEEC--KKWTKAGGKVLP 155
            + W++AA      +W         
Sbjct: 124 QKRWDEAAVNLAKSRWYNQTPNRAK 148