PSIBLAST alignment of GI: 254781056 and protein with PDB id: 227l

>gi|157834482|pdb|227L|A Chain A, Generating Ligand Binding Sites In T4 Lysozyme Using Deficiency-Creating Substitutions Length = 164
>gi|157834483|pdb|228L|A Chain A, Generating Ligand Binding Sites In T4 Lysozyme Using Deficiency-Creating Substitutions Length = 164
 Score = 55.4 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 32/144 (22%), Positives = 53/144 (36%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A+ + V  +   G    +   + +  
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVAQMGETGVAGFTNSLRMLQQ 123

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W++AA      +W         
Sbjct: 124 KRWDEAAVNLAKSRWYNQTPNRAK 147