PSIBLAST alignment of GI: 254781056 and protein with PDB id: 245l

>gi|157834502|pdb|245L|A Chain A, The Response Of T4 Lysozyme To Large-To-Small Substitutions Within The Core And Its Relation To The Hydrophobic Effect Length = 164
 Score = 56.9 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 31/138 (22%), Positives = 50/138 (36%), Gaps = 23/138 (16%)

Query: 40  EGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEAEDFLLK 83
           EGLRL  Y+D   G +TIG GH  +                       IT+ EAE    +
Sbjct: 11  EGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEAEKLFNQ 69

Query: 84  DASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDAQDWEKA 139
           D   ++  +L +    P   S    R  A+ + VF +   G    +   + +  + W++A
Sbjct: 70  DVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQKRWDEA 129

Query: 140 AEEC--KKWTKAGGKVLP 155
           A      +W         
Sbjct: 130 AVNLAKSRWYNQTPNRAK 147