PSIBLAST alignment of GI: 254781056 and protein with PDB id: 3guj

>gi|256599701|pdb|3GUJ|A Chain A, T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN APOLAR Cavity--Benzene Binding Length = 164
>gi|256599702|pdb|3GUK|A Chain A, T4 Lysozyme M102eL99A MUTANT WITH BURIED CHARGE IN APOLAR Cavity--Toluene Binding Length = 164
 Score = 56.6 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 34/138 (24%), Positives = 54/138 (39%), Gaps = 23/138 (16%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 5   EMLRIDEGLRLKIYKDC-EGYYTIGIGHLLTKSPDLNAAKSELDKAIGRNCNGVITKDEA 63

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNLG-IGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A  + VF +G  G    +   + +  
Sbjct: 64  EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRXAAINEVFQMGVTGVAGFTNVLRMLQQ 123

Query: 134 QDWEKAAEEC--KKWTKA 149
           + W++AA      +W   
Sbjct: 124 KRWDEAAVNLAKSRWYNQ 141