PSIBLAST alignment of GI: 254781056 and protein with PDB id: 3pds

>gi|317455410|pdb|3PDS|A Chain A, Irreversible Agonist-Beta2 Adrenoceptor Complex Length = 458
 Score = 59.6 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 33/144 (22%), Positives = 54/144 (37%), Gaps = 23/144 (15%)

Query: 34  KMLKEFEGLRLTAYRDIGGGAWTIGYGHTGSD----------------VTEGMTITEKEA 77
           +ML+  EGLRL  Y+D   G +TIG GH  +                       IT+ EA
Sbjct: 210 EMLRIDEGLRLKIYKDT-EGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNTNGVITKDEA 268

Query: 78  EDFLLKDASKSLNLLLES---SPALKSTSENRLVAVADFVFNL-GIGNYNKSTFKQRVDA 133
           E    +D   ++  +L +    P   S    R  A+ + VF +   G    +   + +  
Sbjct: 269 EKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRAALINMVFQMGETGVAGFTNSLRMLQQ 328

Query: 134 QDWEKAAEEC--KKWTKAGGKVLP 155
           + W++AA      +W         
Sbjct: 329 KRWDEAAVNLAKSRWYNQTPNRAK 352