BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] (171 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 351 bits (900), Expect = 4e-99, Method: Compositional matrix adjust. Identities = 171/171 (100%), Positives = 171/171 (100%) Query: 1 MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60 MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG Sbjct: 1 MCIINRIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYG 60 Query: 61 HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120 HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG Sbjct: 61 HTGSDVTEGMTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIG 120 Query: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES Sbjct: 121 NYNKSTFKQRVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLLES 171 >gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Score = 154 bits (388), Expect = 1e-39, Method: Compositional matrix adjust. Identities = 76/100 (76%), Positives = 82/100 (82%) Query: 70 MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129 MTIT KEAED LL D L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 Query: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169 RVDAQDWEKAAEECKKWTKAGG+ L G+ RR +LL Sbjct: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100 >gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] Length = 43 Score = 56.2 bits (134), Expect = 3e-10, Method: Compositional matrix adjust. Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 6/48 (12%) Query: 17 MNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHTGS 64 MNG K + NALI++ K +EGL+LTAYRD GG WTIGYGH+GS Sbjct: 1 MNGSSK-----ILNALIEITKRYEGLKLTAYRDP-GGTWTIGYGHSGS 42 >gi|254780928|ref|YP_003065341.1| histidyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 496 Score = 27.7 bits (60), Expect = 0.10, Method: Compositional matrix adjust. Identities = 36/130 (27%), Positives = 59/130 (45%), Gaps = 19/130 (14%) Query: 6 RIISFVKRMIGMNGDDKHNKIPVPNALIKMLKEFEGLRLTAYRDIGGGAWTIGYGHT--G 63 +I+ + IG++GDDK N+ + I L +F GL+ G +G G T Sbjct: 173 KILDGILEKIGLHGDDKLNERLIVLRAIDKLDKF-GLQ--------GVKLLLGEGRTDNS 223 Query: 64 SDVTEGMTITEKEAE---DFLLKDASKSLNLLLESSPALKSTSE--NRLVAVADFVFNLG 118 D T+G +T ++ + FL D KS++ L E + + N LV +++ V G Sbjct: 224 GDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSG 283 Query: 119 IGNYNKSTFK 128 YN + K Sbjct: 284 ---YNSNRIK 290 >gi|254780486|ref|YP_003064899.1| 8-amino-7-oxononanoate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 381 Score = 24.6 bits (52), Expect = 0.92, Method: Compositional matrix adjust. Identities = 10/19 (52%), Positives = 12/19 (63%) Query: 140 AEECKKWTKAGGKVLPGLV 158 AE KW K+GGK P +V Sbjct: 150 AENINKWRKSGGKGFPWIV 168 >gi|254780939|ref|YP_003065352.1| type I signal peptidase [Candidatus Liberibacter asiaticus str. psy62] Length = 248 Score = 21.6 bits (44), Expect = 7.3, Method: Compositional matrix adjust. Identities = 8/13 (61%), Positives = 11/13 (84%) Query: 8 ISFVKRMIGMNGD 20 I +VKR+IG+ GD Sbjct: 101 IDYVKRVIGLPGD 113 >gi|254780233|ref|YP_003064646.1| GTP-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 624 Score = 21.6 bits (44), Expect = 7.4, Method: Compositional matrix adjust. Identities = 11/30 (36%), Positives = 17/30 (56%) Query: 67 TEGMTITEKEAEDFLLKDASKSLNLLLESS 96 TEG +T + D L K+A ++ L +E S Sbjct: 336 TEGDKVTSRMIRDRLFKEAEGNIALKIEES 365 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 21.6 bits (44), Expect = 9.3, Method: Compositional matrix adjust. Identities = 20/77 (25%), Positives = 38/77 (49%), Gaps = 11/77 (14%) Query: 78 EDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWE 137 E L+K A K++ ++++S S +EN L D+ LG+ Y +++ +D + Sbjct: 562 ERALMKIARKAVTKIVKNSDTTVSINENNL---QDY---LGVPRYKYG----KIEGED-Q 610 Query: 138 KAAEECKKWTKAGGKVL 154 WT+ GG++L Sbjct: 611 VGIVTGLAWTEVGGEIL 627 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.316 0.135 0.389 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 104,515 Number of Sequences: 1233 Number of extensions: 3942 Number of successful extensions: 16 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 3 Number of HSP's that attempted gapping in prelim test: 7 Number of HSP's gapped (non-prelim): 11 length of query: 171 length of database: 328,796 effective HSP length: 68 effective length of query: 103 effective length of database: 244,952 effective search space: 25230056 effective search space used: 25230056 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 35 (18.1 bits)