HHsearch alignment for GI: 254781057 and conserved domain: COG3772

>COG3772 Phage-related lysozyme (muraminidase) [General function prediction only].
Probab=99.64  E-value=7.6e-17  Score=101.98  Aligned_cols=40  Identities=48%  Similarity=0.971  Sum_probs=36.5

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCC
Q ss_conf             8530343999999997528512430378997066202666
Q gi|254781057|r    2 NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG   41 (43)
Q Consensus         2 ~g~~kis~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg   41 (43)
T Consensus         2 ~~~~~~s~~gi~lIk~~EG~~~~pY~d~~GvwTIgyGhT~   41 (152)
T COG3772           2 GAMASISEIGIALIKEFEGCRLDPYRDPAGVWTIGYGHTG   41 (152)
T ss_pred             CCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEEEECCCC
T ss_conf             5100145888999999754677641679987788628857