HHsearch alignment for GI: 254781057 and conserved domain: cd00737

>cd00737 endolysin_autolysin Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.
Probab=99.65  E-value=6e-17  Score=102.47  Aligned_cols=36  Identities=56%  Similarity=1.137  Sum_probs=34.6

Q ss_pred             HHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCCC
Q ss_conf             439999999975285124303789970662026666
Q gi|254781057|r    7 ILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGS   42 (43)
Q Consensus         7 is~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg~   42 (43)
T Consensus         1 is~~gi~~ik~~EG~~~~~Y~D~~G~~TIGyGht~~   36 (133)
T cd00737           1 ISQAGLALIKRFEGCRLTPYKDPAGVWTIGYGHTGG   36 (133)
T ss_pred             CCHHHHHHHHHHHCCCCEEEECCCCCEEEEECCCCC
T ss_conf             998999999998388203277899984781086248