HHsearch results for GI: 254781057 and protein with PDBid: 2anv_A

>2anv_A Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_A
Probab=99.62  E-value=9.7e-17  Score=100.46  Aligned_cols=38  Identities=45%  Similarity=0.577  Sum_probs=36.1

Q ss_pred             HHHHHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCCC
Q ss_conf             03439999999975285124303789970662026666
Q gi|254781057|r    5 SKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGS   42 (43)
Q Consensus         5 ~kis~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg~   42 (43)
                      |+||++++++||.|||+|++||+|+.|+||||||||..
T Consensus         2 m~~s~~~~~~ik~~EG~~~~~Y~D~~G~~TIGyGht~~   39 (146)
T 2anv_A            2 MQISSNGITRLKREEGERLKAYSDSRGIPTIGVGHTGK   39 (146)
T ss_dssp             CCCCHHHHHHHHHHHCCEEEEEECTTSCEEEETTBCSC
T ss_pred             CCCCHHHHHHHHHHCCCCCEEEECCCCCCEEEEEEEEC
T ss_conf             66379999999996088526678989998797604466