HHsearch results for GI: 254781057 and protein with PDBid: 2qb0_B

>2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli}
Probab=99.15  E-value=8.5e-12  Score=76.95  Aligned_cols=34  Identities=38%  Similarity=0.613  Sum_probs=30.5

Q ss_pred             HHHHHHHHHHHCCCCCCCEECCCCCEEEECCCCC
Q ss_conf             3999999997528512430378997066202666
Q gi|254781057|r    8 LNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG   41 (43)
Q Consensus         8 s~a~i~lIk~~EG~r~~aY~d~~G~wTIGyGHTg   41 (43)
                      ..+.+++||.+||+|++||+|++|+||||||||-
T Consensus        79 ~~~~~~~ik~~EG~r~~~Y~Ds~G~~TIG~Gh~i  112 (241)
T 2qb0_B           79 GPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGHLL  112 (241)
T ss_dssp             CCCCHHHHHHHHCCEEEEEECSSSCEEEETTEEE
T ss_pred             HHHHHHHHCCCCCCCEEEEECCCCCCEEECCCCC
T ss_conf             6777776434888431344589999435028776