RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) >gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.. Length = 133 Score = 53.3 bits (128), Expect = 1e-08 Identities = 20/35 (57%), Positives = 26/35 (74%) Query: 7 ILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG 41 I A + + KR+EG +LT Y+DP G WTIGYGH+G Sbjct: 1 ISQAGLALIKRFEGCRLTPYKDPAGVWTIGYGHTG 35 >gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only]. Length = 152 Score = 50.3 bits (120), Expect = 1e-07 Identities = 19/41 (46%), Positives = 25/41 (60%) Query: 1 MNGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG 41 + + I I + K +EG +L YRDP G WTIGYGH+G Sbjct: 1 IGAMASISEIGIALIKEFEGCRLDPYRDPAGVWTIGYGHTG 41 >gnl|CDD|29559 cd00735, bacteriophage_T4-like_lysozyme, Bacteriophage T4-like lysozymes hydrolyse the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) in peptidoglycan heteropolymers of prokaryotic cell walls. Members include a variety of bacteriophages (T4, RB49, RB69, Aeh1) as well as Dictyostelium. . Length = 164 Score = 29.6 bits (66), Expect = 0.18 Identities = 13/27 (48%), Positives = 17/27 (62%) Query: 13 EITKRYEGLKLTAYRDPGGTWTIGYGH 39 E+ ++ EGL+L Y D G TIG GH Sbjct: 4 EMLRQDEGLRLKVYWDTEGYPTIGIGH 30 >gnl|CDD|185687 cd02178, GH16_beta_agarase, Beta-agarase, member of glycosyl hydrolase family 16. Beta-agarase is a glycosyl hydrolase family 16 (GH16) member that hydrolyzes the internal beta-1,4-linkage of agarose, a hydrophilic polysaccharide found in the cell wall of Rhodophyceaea, marine red algae. Agarose is a linear chain of galactose units linked by alternating L-alpha-1,3- and D-beta-1,4-linkages that are additionally modified by a 3,6-anhydro-bridge. Agarose forms thermo-reversible gels that are widely used in the food industry or as a laboratory medium. While beta-agarases are also found in two other families derived from the sequence-based classification of glycosyl hydrolases (GH50, and GH86) the GH16 members are most abundant. This domain adopts a curved beta-sandwich conformation, with a tunnel-shaped active site cavity, referred to as a jellyroll fold. Length = 258 Score = 25.0 bits (55), Expect = 4.1 Identities = 8/23 (34%), Positives = 10/23 (43%) Query: 21 LKLTAYRDPGGTWTIGYGHSGSC 43 L L+A R PG GY + Sbjct: 67 LVLSATRHPGTELGNGYKVTTGS 89 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.315 0.136 0.424 Gapped Lambda K H 0.267 0.0740 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 502,321 Number of extensions: 14342 Number of successful extensions: 50 Number of sequences better than 10.0: 1 Number of HSP's gapped: 50 Number of HSP's successfully gapped: 7 Length of query: 43 Length of database: 6,263,737 Length adjustment: 17 Effective length of query: 26 Effective length of database: 5,896,384 Effective search space: 153305984 Effective search space used: 153305984 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.4 bits)