RPSBLAST alignment of GI: 254781057 and MMDB domain: 1xju_A_

>1xju_A (A:) Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1}Length = 163
 Score = 49.3 bits (117), Expect = 2e-07
 Identities = 11/34 (32%), Positives = 16/34 (47%)

Query: 6  KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39
          +   A +E+    EG +   Y  P G WT G G+
Sbjct: 1  RTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGN 34