RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254781057|ref|YP_003065470.1| hypothetical protein CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62] (43 letters) >1xjt_A Lysozyme; open conformation, hydrolase; HET: CIT; 1.75A {Enterobacteria phage P1} SCOP: d.2.1.3 Length = 191 Score = 54.0 bits (129), Expect = 8e-09 Identities = 13/38 (34%), Positives = 19/38 (50%) Query: 2 NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 NG+ + A +E+ EG + Y P G WT G G+ Sbjct: 25 NGNVRTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGN 62 >1swy_A Lysozyme; RB+ binding sites, AB initio direct methods, hydrolase; 1.06A {Enterobacteria phage T4} SCOP: d.2.1.3 PDB: 1swz_A 1sx2_A 1sx7_A 3fad_A 3f9l_A 2nzn_A 3c8s_A 3cdr_A 2nzb_A 3c8q_A 3c7w_A 3cdq_A 3f8v_A 1l34_A 3c7y_A 2lzm_A 1t6h_A* 1lyd_A 3lzm_A 4lzm_A ... Length = 164 Score = 51.3 bits (122), Expect = 6e-08 Identities = 13/29 (44%), Positives = 19/29 (65%) Query: 11 LIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 + E+ + EGL+L Y+D G +TIG GH Sbjct: 3 IFEMLRIDEGLRLKIYKDTEGYYTIGIGH 31 >1xju_A Lysozyme; secreted inactive conformation, hydrolase; 1.07A {Enterobacteria phage P1} SCOP: d.2.1.3 Length = 163 Score = 49.8 bits (118), Expect = 1e-07 Identities = 11/34 (32%), Positives = 16/34 (47%) Query: 6 KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 + A +E+ EG + Y P G WT G G+ Sbjct: 1 RTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGN 34 >2anv_A Lysozyme; direct methods, lanthinide binding sites, hydrolase; 1.04A {Enterobacteria phage P22} PDB: 2anx_A Length = 146 Score = 49.7 bits (118), Expect = 2e-07 Identities = 17/37 (45%), Positives = 21/37 (56%) Query: 6 KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSGS 42 +I + I KR EG +L AY D G TIG GH+G Sbjct: 3 QISSNGITRLKREEGERLKAYSDSRGIPTIGVGHTGK 39 >3hde_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.95A {Enterobacteria phage P21} Length = 165 Score = 46.6 bits (110), Expect = 1e-06 Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 16 KRYEGLKLTAYRDPGGTWTIGYGHSGS 42 EG+ Y+D G WT+ +GH+G Sbjct: 32 DGLEGVSYIPYKDIVGVWTVCHGHTGK 58 >3hdf_A Lysozyme; antimicrobial, bacteriolytic enzyme, glycosidase, hydrolase, late protein; 1.70A {Enterobacteria phage P21} Length = 140 Score = 44.7 bits (105), Expect = 5e-06 Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 15 TKRYEGLKLTAYRDPGGTWTIGYGHSGS 42 EG+ Y+D G WT+ +GH+G Sbjct: 6 NDGLEGVSYIPYKDIVGVWTVCHGHTGK 33 >2o4w_A Lysozyme; protein folding, protein stability, protein engineering, hydrolase; 1.90A {Enterobacteria phage T4} Length = 171 Score = 39.3 bits (91), Expect = 2e-04 Identities = 10/19 (52%), Positives = 13/19 (68%) Query: 21 LKLTAYRDPGGTWTIGYGH 39 L+L Y+D G +TIG GH Sbjct: 2 LRLKIYKDTEGYYTIGIGH 20 >2qb0_B Telsam domain - lysozyme chimera; helical polymer, hydrolase regulator; 2.56A {Escherichia coli} Length = 241 Score = 38.1 bits (88), Expect = 5e-04 Identities = 13/35 (37%), Positives = 20/35 (57%) Query: 5 SKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39 + + E+ + EGL+L Y+D G +TIG GH Sbjct: 76 KQAGPNIFEMLRIDEGLRLKIYKDTEGYYTIGIGH 110 >1wth_A Protein GP5, tail-associated lysozyme; triple-stranded beta-helix, OB fold, pseudohexamer, T4 tail lysozyme, GP5-GP27; 2.80A {Enterobacteria phage T4} PDB: 2z6b_A 1k28_A 1pdl_A Length = 584 Score = 30.2 bits (67), Expect = 0.13 Identities = 13/24 (54%), Positives = 15/24 (62%) Query: 16 KRYEGLKLTAYRDPGGTWTIGYGH 39 +R EGL+L Y D G TIG GH Sbjct: 181 RRDEGLRLKVYWDTEGYPTIGIGH 204 >3nf5_A Nucleoporin NUP100; nuclear pore complex, structural genomics, PSI-2, PR structure initiative, NEW YORK structural genomix research consortium; 1.94A {Candida glabrata} Length = 164 Score = 23.7 bits (51), Expect = 9.6 Identities = 7/40 (17%), Positives = 15/40 (37%) Query: 2 NGSSKILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHSG 41 + + +I+ E K+ +Y GT+ H+ Sbjct: 117 DPNHRIMERYSEKLKKIPHTHFESYDPASGTYCFTVDHAL 156 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.315 0.136 0.424 Gapped Lambda K H 0.267 0.0609 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 393,990 Number of extensions: 11064 Number of successful extensions: 41 Number of sequences better than 10.0: 1 Number of HSP's gapped: 41 Number of HSP's successfully gapped: 10 Length of query: 43 Length of database: 5,693,230 Length adjustment: 16 Effective length of query: 27 Effective length of database: 5,305,326 Effective search space: 143243802 Effective search space used: 143243802 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.3 bits)