RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781057|ref|YP_003065470.1| hypothetical protein
CLIBASIA_04795 [Candidatus Liberibacter asiaticus str. psy62]
         (43 letters)



>d1swya_ d.2.1.3 (A:) Phage T4 lysozyme {Bacteriophage T4 [TaxId:
          10665]}
          Length = 164

 Score = 51.3 bits (122), Expect = 2e-08
 Identities = 13/29 (44%), Positives = 19/29 (65%)

Query: 11 LIEITKRYEGLKLTAYRDPGGTWTIGYGH 39
          + E+ +  EGL+L  Y+D  G +TIG GH
Sbjct: 3  IFEMLRIDEGLRLKIYKDTEGYYTIGIGH 31


>d1xjua_ d.2.1.3 (A:) Endolysin Lyz {Bacteriophage P1 [TaxId:
          10678]}
          Length = 158

 Score = 50.2 bits (119), Expect = 5e-08
 Identities = 11/35 (31%), Positives = 17/35 (48%)

Query: 6  KILNALIEITKRYEGLKLTAYRDPGGTWTIGYGHS 40
          +   A +E+    EG +   Y  P G WT G G++
Sbjct: 1  RTNQAGLELIGNAEGCRRDPYMCPAGVWTDGIGNT 35


>d1k28a3 d.2.1.3 (A:130-345) Tail-associated lysozyme gp5,
          catalytic domain {Bacteriophage T4 [TaxId: 10665]}
          Length = 216

 Score = 48.1 bits (114), Expect = 2e-07
 Identities = 14/30 (46%), Positives = 19/30 (63%)

Query: 10 ALIEITKRYEGLKLTAYRDPGGTWTIGYGH 39
          ++ E+ +R EGL+L  Y D  G  TIG GH
Sbjct: 46 SMAEMLRRDEGLRLKVYWDTEGYPTIGIGH 75


>d1k75a_ c.82.1.2 (A:) L-histidinol dehydrogenase HisD
          {Escherichia coli [TaxId: 562]}
          Length = 431

 Score = 23.1 bits (49), Expect = 7.1
 Identities = 5/18 (27%), Positives = 11/18 (61%)

Query: 10 ALIEITKRYEGLKLTAYR 27
          AL E + +++   +TA +
Sbjct: 47 ALREYSAKFDKTTVTALK 64


>d1nofa1 b.71.1.2 (A:31-43,A:321-413) Glycosyl hydrolase family 5
          xylanase {Erwinia chrysanthemi [TaxId: 556]}
          Length = 106

 Score = 23.0 bits (49), Expect = 7.4
 Identities = 6/17 (35%), Positives = 9/17 (52%)

Query: 19 EGLKLTAYRDPGGTWTI 35
            + LTAY++  G   I
Sbjct: 26 SNVHLTAYKNTDGKMVI 42


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.315    0.136    0.424 

Gapped
Lambda     K      H
   0.267   0.0501    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 169,473
Number of extensions: 4871
Number of successful extensions: 20
Number of sequences better than 10.0: 1
Number of HSP's gapped: 20
Number of HSP's successfully gapped: 6
Length of query: 43
Length of database: 2,407,596
Length adjustment: 16
Effective length of query: 27
Effective length of database: 2,187,916
Effective search space: 59073732
Effective search space used: 59073732
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 47 (22.4 bits)