RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] (102 letters) >gnl|CDD|29561 cd00737, endolysin_autolysin, Endolysins and autolysins are found in viruses and bacteria, respectively. The ds DNA phages of eubacteria use endolysins or muralytic enzymes in conjunction with hollin, a small membrane protein, to degrade the peptidoglycan found in bacterial cell walls. Similarly, bacteria produce autolysins to facilitate the biosynthesis of its cell wall hetropolymer peptidoglycan and cell division. Both endolysin and autolysin enzymes cleave the glycosidic beta 1,4-bonds between the N-acetylmuramic acid and the N-acetylglucosamine of the peptidoglycan.. Length = 133 Score = 74.9 bits (184), Expect = 5e-15 Identities = 32/94 (34%), Positives = 50/94 (53%), Gaps = 2/94 (2%) Query: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTIT ++A+ LL DL + A ++N+ A+ F FN+G G + ST + Sbjct: 41 MTITEEQADALLAKDLAKAERAVNRAVK--VPLTQNQFDALVSFAFNVGAGAFRTSTLLR 98 Query: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAE 94 +++A DW A + +W KAGG+ L G+ RR Sbjct: 99 KLNAGDWAGACAQLPRWVKAGGKVLPGLVRRREA 132 >gnl|CDD|33567 COG3772, COG3772, Phage-related lysozyme (muraminidase) [General function prediction only]. Length = 152 Score = 60.7 bits (147), Expect = 8e-11 Identities = 28/102 (27%), Positives = 45/102 (44%), Gaps = 4/102 (3%) Query: 2 TITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQR 61 +A L + + L + + A+ F +N+G GN+ ST +R Sbjct: 52 KEECDQANALERDLAEAERAVNRYIKVPLT---QPQFDALVSFAYNIGAGNFFSSTLLRR 108 Query: 62 VDAQDWEKAAEECKKWTKAGGQS-LRGIENRRAEGATMLLNG 102 ++A DW A E+ ++W KAGG L G+ RR + L G Sbjct: 109 INAGDWSGACEQLRRWIKAGGGKVLPGLVRRREAERALFLWG 150 >gnl|CDD|144526 pfam00959, Phage_lysozyme, Phage lysozyme. This family includes lambda phage lysozyme and E. coli endolysin. Length = 108 Score = 55.5 bits (134), Expect = 3e-09 Identities = 25/94 (26%), Positives = 35/94 (37%), Gaps = 2/94 (2%) Query: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 IT A DL + + S NR A+ FN+G G ST + Sbjct: 17 PRITKSTAAGRYQFDLDTAERGIKQYGK--VDFSPNRQDALVSLAFNVGCGARGFSTLLR 74 Query: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAE 94 + W A K KAGG+ G++ RR + Sbjct: 75 AGNQGQWVLACSAIWKSLKAGGKEYNGLKRRREK 108 >gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 1070 Score = 27.2 bits (60), Expect = 0.95 Identities = 12/36 (33%), Positives = 17/36 (47%), Gaps = 1/36 (2%) Query: 43 DFVFNLGIGNYNKSTFKQRVD-AQDWEKAAEECKKW 77 D V +GI YN K + + +WEK E +W Sbjct: 105 DDVMKMGIDKYNNECRKIVMRYSSEWEKTVERLGRW 140 >gnl|CDD|153385 cd07373, 2A5CPDO_A, The alpha subunit of the Class III extradiol dioxygenase, 2-amino-5-chlorophenol 1,6-dioxygenase, which catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol. 2-amino-5-chlorophenol 1,6-dioxygenase (2A5CPDO) catalyzes the oxidization and subsequent ring-opening of 2-amino-5-chlorophenol, which is an intermediate during p-chloronitrobenzene degradation. This enzyme is a member of the class III extradiol dioxygenase family, a group of enzymes which use a non-heme Fe(II) to cleave aromatic rings between a hydroxylated carbon and an adjacent non-hydroxylated carbon. The active enzyme is probably a heterotetramer, composed of two alpha and two beta subunits. The alpha and beta subunits share significant sequence similarity and may have evolved by gene duplication. This model describes the alpha subunit, which does not contain a potential metal binding site and may not possess catalytic activity. Length = 271 Score = 26.4 bits (58), Expect = 2.0 Identities = 14/45 (31%), Positives = 25/45 (55%), Gaps = 6/45 (13%) Query: 35 ENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTK 79 +N+ VAV +G+G + S F++ +D ++ A EE KW + Sbjct: 165 QNKRVAV------VGVGGLSGSLFREEIDPREDHIANEEDDKWNR 203 >gnl|CDD|36002 KOG0783, KOG0783, KOG0783, Uncharacterized conserved protein, contains ankyrin and BTB/POZ domains [Function unknown]. Length = 1267 Score = 26.2 bits (57), Expect = 2.2 Identities = 15/55 (27%), Positives = 21/55 (38%), Gaps = 9/55 (16%) Query: 10 DLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFV-FNLGIGNYNKSTFKQRVD 63 L L S + +LD N + V LGIGN + + +RVD Sbjct: 124 QFLSRVLSSTIHPVLD--------LPNDVYGWGTNVNNTLGIGNGKEPSSPERVD 170 >gnl|CDD|176858 cd07816, Bet_v1-like, Ligand-binding bet_v_1 domain of major pollen allergen of white birch (Betula verrucosa), Bet v 1, and related proteins. This family includes the ligand binding domain of Bet v 1 (the major pollen allergen of white birch, Betula verrucosa) and related proteins. In addition to birch Bet v 1, this family includes other plant intracellular pathogenesis-related class 10 (PR-10) proteins, norcoclaurine synthases (NCSs), cytokinin binding proteins (CSBPs), major latex proteins (MLPs), and ripening-related proteins. It belongs to the SRPBCC (START/RHO_alpha_C/PITP/Bet_v1/CoxG/CalC) domain superfamily of proteins that bind hydrophobic ligands. SRPBCC domains have a deep hydrophobic ligand-binding pocket. Members of this family binds a diverse range of ligands. Bet v 1 can bind brassinosteroids, cytokinins, flavonoids and fatty acids. Hyp-1, a PR-10 from Hypericum perforatum/St. John's wort, catalyzes the condensation of two molecules of emodin to the bioactive naphthodianthrone hypericin. NCSs catalyze the condensation of dopamine and 4-hydroxyphenylacetaldehyde to (S)-norcoclaurine, the first committed step in the biosynthesis of benzylisoquinoline alkaloids such as morphine. The role of MLPs is unclear; however, they are associated with fruit and flower development and in pathogen defense responses. A number of PR-10 proteins in this subgroup, including Bet v 1, have in vitro RNase activity, the biological significance of which is unclear. Bet v 1 family proteins have a conserved glycine-rich P (phosphate-binding)-loop proximal to the entrance of the ligand-binding pocket. However, its conformation differs from that of the canonical P-loop structure found in nucleotide-binding proteins. Several PR-10 members including Bet v1 are allergenic. Cross-reactivity of Bet v 1 with homologs from plant foods results in birch-fruit syndrome. Length = 148 Score = 25.2 bits (56), Expect = 3.8 Identities = 9/25 (36%), Positives = 12/25 (48%), Gaps = 1/25 (4%) Query: 45 VFNLGIGNYNKSTFKQRVDAQDWEK 69 + G G K K+R+DA D E Sbjct: 52 LITFGPGGKVK-YVKERIDAVDEEN 75 >gnl|CDD|38955 KOG3751, KOG3751, KOG3751, Growth factor receptor-bound proteins (GRB7, GRB10, GRB14) [Signal transduction mechanisms]. Length = 622 Score = 24.6 bits (53), Expect = 5.5 Identities = 10/26 (38%), Positives = 14/26 (53%) Query: 16 LRSHLDLLLDASPTLKSASENRLVAV 41 + + L AS +SAS N LVA+ Sbjct: 437 QQIRRETLSPASSPSRSASSNSLVAM 462 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.314 0.129 0.363 Gapped Lambda K H 0.267 0.0701 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,113,051 Number of extensions: 46980 Number of successful extensions: 100 Number of sequences better than 10.0: 1 Number of HSP's gapped: 97 Number of HSP's successfully gapped: 12 Length of query: 102 Length of database: 6,263,737 Length adjustment: 69 Effective length of query: 33 Effective length of database: 4,772,716 Effective search space: 157499628 Effective search space used: 157499628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 51 (23.5 bits)