RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] (102 letters) >gnl|CDD|149397 pfam08324, PUL, PUL domain. The PUL (PLAP, Ufd3p and Lub1p) domain is a novel alpha-helical Ub-associated domain. It directly binds to Cdc48, a chaperone-like AAA ATPase that collects ubiquitylated substrates. Length = 264 Score = 27.0 bits (60), Expect = 1.2 Identities = 14/43 (32%), Positives = 22/43 (51%), Gaps = 2/43 (4%) Query: 16 LRSHLDLLLDASPTLKSASENR--LVAVADFVFNLGIGNYNKS 56 L SH D +LD LKS+ N+ +A+A + NL + + Sbjct: 146 LLSHDDSILDLISVLKSSLLNKNLQIALATLLLNLAVLLLENN 188 >gnl|CDD|181621 PRK09041, motB, flagellar motor protein MotB; Validated. Length = 317 Score = 26.4 bits (59), Expect = 1.7 Identities = 7/27 (25%), Positives = 14/27 (51%) Query: 5 AKEAEDLLLSDLRSHLDLLLDASPTLK 31 + E L L+ LD ++++P L+ Sbjct: 111 KERREQERLEKLKQELDQAIESNPKLR 137 >gnl|CDD|184929 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional. Length = 576 Score = 25.9 bits (57), Expect = 2.2 Identities = 14/33 (42%), Positives = 18/33 (54%) Query: 7 EAEDLLLSDLRSHLDLLLDASPTLKSASENRLV 39 +A +DL+ HL LLL A + AS RLV Sbjct: 318 QAAAADAADLQRHLTLLLRAEGEMAHASFPRLV 350 >gnl|CDD|183314 PRK11788, PRK11788, tetratricopeptide repeat protein; Provisional. Length = 389 Score = 25.2 bits (56), Expect = 3.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Query: 66 DWEKAAEECKKWTKAGGQSLR 86 DW+KA + ++ K GG SLR Sbjct: 156 DWQKAIDVAERLEKLGGDSLR 176 >gnl|CDD|172342 PRK13811, PRK13811, orotate phosphoribosyltransferase; Provisional. Length = 170 Score = 24.8 bits (54), Expect = 5.8 Identities = 11/20 (55%), Positives = 13/20 (65%) Query: 78 TKAGGQSLRGIENRRAEGAT 97 T +GG +L GIE RA GA Sbjct: 114 TTSGGSALYGIEQLRAAGAV 133 >gnl|CDD|151125 pfam10596, U6-snRNA_bdg, U6-snRNA interacting domain of PrP8. This domain incorporates the interacting site for the U6-snRNA as part of the U4/U6.U5 tri-snRNPs complex of the spliceosome, and is the prime candidate for the role of cofactor for the spliceosome's RNA core. The essential spliceosomal protein Prp8 interacts with U5 and U6 snRNAs and with specific pre-mRNA sequences that participate in catalysis. This close association with crucial RNA sequences, together with extensive genetic evidence, suggests that Prp8 could directly affect the function of the catalytic core, perhaps acting as a splicing cofactor. Length = 160 Score = 24.4 bits (53), Expect = 6.9 Identities = 13/31 (41%), Positives = 15/31 (48%), Gaps = 5/31 (16%) Query: 67 WEKAAE-----ECKKWTKAGGQSLRGIENRR 92 WEKA+ + KK T A L I NRR Sbjct: 62 WEKASGFEESMKFKKLTNAQRSGLSQIPNRR 92 >gnl|CDD|184028 PRK13398, PRK13398, 3-deoxy-7-phosphoheptulonate synthase; Provisional. Length = 266 Score = 24.3 bits (53), Expect = 7.1 Identities = 15/50 (30%), Positives = 22/50 (44%) Query: 34 SENRLVAVADFVFNLGIGNYNKSTFKQRVDAQDWEKAAEECKKWTKAGGQ 83 SE ++V VA+ + LG+ FK R ++ EE K K G Sbjct: 39 SEEQMVKVAEKLKELGVHMLRGGAFKPRTSPYSFQGLGEEGLKILKEVGD 88 >gnl|CDD|178427 PLN02833, PLN02833, glycerol acyltransferase family protein. Length = 376 Score = 24.3 bits (53), Expect = 7.3 Identities = 14/48 (29%), Positives = 16/48 (33%), Gaps = 11/48 (22%) Query: 7 EAEDLLLSDLR-------SHLDLLLDASPTLKSASENRLVAVADFVFN 47 ED L S L LLD S L A+ A+ D F Sbjct: 22 NIEDYLPSGSSIQEPSGKLLLRDLLDISGVLTEAAS----AIVDDSFT 65 >gnl|CDD|181858 PRK09438, nudB, dihydroneopterin triphosphate pyrophosphatase; Provisional. Length = 148 Score = 24.1 bits (53), Expect = 7.7 Identities = 6/15 (40%), Positives = 8/15 (53%) Query: 66 DWEKAAEECKKWTKA 80 D +AA K W+ A Sbjct: 122 DAREAAALTKSWSNA 136 >gnl|CDD|181577 PRK08898, PRK08898, coproporphyrinogen III oxidase; Provisional. Length = 394 Score = 24.2 bits (53), Expect = 8.0 Identities = 12/24 (50%), Positives = 14/24 (58%) Query: 7 EAEDLLLSDLRSHLDLLLDASPTL 30 D LLSD+R+ L L DA TL Sbjct: 90 AGLDRLLSDVRALLPLDPDAEITL 113 >gnl|CDD|177761 PLN00162, PLN00162, transport protein sec23; Provisional. Length = 761 Score = 24.1 bits (53), Expect = 8.8 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 7/35 (20%) Query: 13 LSD-LRSHLDLLLDASPTLKSASE------NRLVA 40 LS+ +RSH DL DA+P K A + +LVA Sbjct: 306 LSEPIRSHKDLDKDAAPYYKKAVKFYEGLAKQLVA 340 >gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase. Length = 1159 Score = 23.9 bits (52), Expect = 8.8 Identities = 11/38 (28%), Positives = 17/38 (44%), Gaps = 5/38 (13%) Query: 43 DFVFNLGIGNYN---KSTFKQRVDAQDWEKAAEECKKW 77 D V +GI YN +S + ++WEK +W Sbjct: 105 DDVLKMGIDKYNEECRSIVTRYS--KEWEKTVTRTGRW 140 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.314 0.129 0.363 Gapped Lambda K H 0.267 0.0636 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 1,574,311 Number of extensions: 83568 Number of successful extensions: 126 Number of sequences better than 10.0: 1 Number of HSP's gapped: 126 Number of HSP's successfully gapped: 21 Length of query: 102 Length of database: 5,994,473 Length adjustment: 69 Effective length of query: 33 Effective length of database: 4,503,521 Effective search space: 148616193 Effective search space used: 148616193 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (22.0 bits) S2: 50 (23.2 bits)