BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] (102 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254781058|ref|YP_003065471.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 102 Score = 208 bits (529), Expect = 2e-56, Method: Compositional matrix adjust. Identities = 102/102 (100%), Positives = 102/102 (100%) Query: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 Query: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 102 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG Sbjct: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLLNG 102 >gi|254781056|ref|YP_003065469.1| phage-related lysozyme [Candidatus Liberibacter asiaticus str. psy62] Length = 171 Score = 154 bits (388), Expect = 4e-40, Method: Compositional matrix adjust. Identities = 76/100 (76%), Positives = 82/100 (82%) Query: 1 MTITAKEAEDLLLSDLRSHLDLLLDASPTLKSASENRLVAVADFVFNLGIGNYNKSTFKQ 60 MTIT KEAED LL D L+LLL++SP LKS SENRLVAVADFVFNLGIGNYNKSTFKQ Sbjct: 70 MTITEKEAEDFLLKDASKSLNLLLESSPALKSTSENRLVAVADFVFNLGIGNYNKSTFKQ 129 Query: 61 RVDAQDWEKAAEECKKWTKAGGQSLRGIENRRAEGATMLL 100 RVDAQDWEKAAEECKKWTKAGG+ L G+ RR +LL Sbjct: 130 RVDAQDWEKAAEECKKWTKAGGKVLPGLVKRRDAEVKLLL 169 >gi|254780601|ref|YP_003065014.1| ATP-dependent RNA helicase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 573 Score = 21.6 bits (44), Expect = 3.7, Method: Compositional matrix adjust. Identities = 8/26 (30%), Positives = 16/26 (61%) Query: 3 ITAKEAEDLLLSDLRSHLDLLLDASP 28 + EA+++L R ++ +LD+SP Sbjct: 152 VVLDEADEMLDLGFRDDIEFILDSSP 177 >gi|254780486|ref|YP_003064899.1| 8-amino-7-oxononanoate synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 381 Score = 20.8 bits (42), Expect = 5.1, Method: Composition-based stats. Identities = 7/15 (46%), Positives = 9/15 (60%) Query: 71 AEECKKWTKAGGQSL 85 AE KW K+GG+ Sbjct: 150 AENINKWRKSGGKGF 164 >gi|254781053|ref|YP_003065466.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 466 Score = 20.4 bits (41), Expect = 6.9, Method: Composition-based stats. Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 5 AKEAEDLLLSDLRSHLDL 22 AKEA DL ++ HLDL Sbjct: 63 AKEAGDLGINIASCHLDL 80 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.314 0.129 0.363 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,938 Number of Sequences: 1233 Number of extensions: 1689 Number of successful extensions: 7 Number of sequences better than 100.0: 7 Number of HSP's better than 100.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of query: 102 length of database: 328,796 effective HSP length: 62 effective length of query: 40 effective length of database: 252,350 effective search space: 10094000 effective search space used: 10094000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.1 bits) S2: 32 (16.9 bits)