HHsearch alignment for GI: 254781059 and conserved domain: COG0719

>COG0719 SufB Cysteine desulfurase activator SufB [Posttranslational modification, protein turnover, chaperones].
Probab=98.19  E-value=0.0011  Score=46.76  Aligned_cols=172  Identities=9%  Similarity=0.018  Sum_probs=112.4

Q ss_pred             EEEEECCCCCCCCCEEEEEEEC---CCCCEECCEEEEEEECCCEEEEEECCCCCCCCCCCCCCEEEEEEECCCCEEEEEE
Q ss_conf             3887347741342127999965---8884002214899727724999961567654444443305899866995899999
Q gi|254781059|r  200 SFVYIPKGVRCPMELSTYFRIN---EKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYST  276 (489)
Q Consensus       200 ~fi~Vp~gv~v~~PI~~~~~~~---~~~~~~f~r~lIi~ee~S~v~~iE~~~s~~~~~~~~~~~v~Ei~vg~nA~v~~~~  276 (489)
T Consensus       166 ~lIivee~a~v~~----ie~~~~p~~~~~~h~~vvei~v~~nA~v~~~~vqn~---~~~~~~~~~~~~~~~~~a~~~~~~  238 (412)
T COG0719         166 TLIIVEEGAEITV----IEGCSAPVGSGSLHNGVVEIFVGENASLTYTTVQNW---SPVYNHLTKRAAVEEEDATVRWTQ  238 (412)
T ss_pred             EEEEECCCCEEEE----EEEEECCCCCCCEEEEEEEEEECCCCEEEEEEEECC---CCCEEEEEEEEEEECCCCEEEEEE
T ss_conf             8999889988999----950114678875045689999848979999997736---750576788999833784899999


Q ss_pred             EEECCCCCCCCCCCEEEEEEEEEEEECCCEEEEEEEEEECCCE--EEEEEEEEEECCCCEEEEEEEEEECCCEEEEE--E
Q ss_conf             6304755311448746401467863046303899887514634--78853899827872799998776259868997--2
Q gi|254781059|r  277 VQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAI--TWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS--G  352 (489)
Q Consensus       277 iQn~~~~~~~~~~~~~~~~t~r~~~~~~~a~~~~~~~~lG~~~--~r~~~~~~L~G~~a~~~~~gi~l~~~~Q~~D~--~  352 (489)
T Consensus       239 ~~~-------G~~~t~~~~~--~~l~Ge~a~~e~~sv~~~~~~q~~D~~~~v~h~g~~t~s~i~~kgI~~d~a~~vfrG~  309 (412)
T COG0719         239 VTL-------GSKVTRKYPS--VRLKGEGADGELLSVAFAGGGQHMDVGTKMIHNGPNTRSNILSKGIVKDGARTVFRGL  309 (412)
T ss_pred             ECC-------CCEEEEEEEE--EEEECCCCEEEEEEEEECCCCCEECCCCEEEEECCCCEEEEEEEEEEECCCEEEEEEE
T ss_conf             636-------8705999742--7997599579999999747980881142899956995668999889927868999808


Q ss_pred             EEEEEECCCCCCEEEEEEEECCC-CEEEEEEEEEEC
Q ss_conf             18998367661101000010589-468994014733
Q gi|254781059|r  353 TKMLHLAKNTTSRIVSKGISAGF-SNNTYRGKVSVH  387 (489)
Q Consensus       353 ~~v~H~~p~t~S~~~~K~i~~d~-s~~~f~G~i~v~  387 (489)
T Consensus       310 i~i~~~A~~s~a~~~c~~LlLs~~a~~dt~P~LeI~  345 (412)
T COG0719         310 IDIRKGATGSDAYQECRTLLLSDDARADTVPILEIE  345 (412)
T ss_pred             EEEECCCCCCCCEEEECEEEECCCCCEECCEEEEEE
T ss_conf             998368877601347157998699756516079997