HHsearch alignment for GI: 254781059 and conserved domain: PRK11814

>PRK11814 cysteine desulfurase activator complex subunit SufB; Provisional.
Probab=97.30  E-value=0.013  Score=38.63  Aligned_cols=148  Identities=15%  Similarity=0.141  Sum_probs=86.9

Q ss_pred             EEEEEEECCCEEEEE--ECCCCCC-CCCCCCCCEEEE--EEECCCCEEEEEEEEECCCCCCCCCCCEEEEEEEEEEEECC
Q ss_conf             148997277249999--6156765-444444330589--98669958999996304755311448746401467863046
Q gi|254781059|r  230 RTLIIADEGSYVSYL--EGCTAPQ-RDENQLHAAVVE--LVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM  304 (489)
Q Consensus       230 r~lIi~ee~S~v~~i--E~~~s~~-~~~~~~~~~v~E--i~vg~nA~v~~~~iQn~~~~~~~~~~~~~~~~t~r~~~~~~  304 (489)
T Consensus       256 vvEi~v~~~A~v~y~tiQNW~~gd~~~~~~v~n~vtkR~~~~~~~a~i~W~~~~-------~Gs~it~~yp--s~~L~G~  326 (484)
T PRK11814        256 VVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFVTKRGLCRGENSKISWTQVE-------TGSAITWKYP--SCILRGD  326 (484)
T ss_pred             EEEEEECCCCEEEEEEEECCCCCCCCCCCCEEEEEEEHHHHCCCCCEEEEEEEE-------CCCCEEECCC--CEEEECC
T ss_conf             899997689778899986045545246674489888401221678558888863-------3870021256--1589748


Q ss_pred             CEEEEEEEEEECCCEEEEE--EEEEEECCCCEEEEEEEEEECCCEEEEEEE--EEEEECCCCCCEEEEEEEECC-CCEEE
Q ss_conf             3038998875146347885--389982787279999877625986899721--899836766110100001058-94689
Q gi|254781059|r  305 RSKISWTQLETGSAITWKY--PSCLLRGEQSCGEFYSIAISNGFQQIDSGT--KMLHLAKNTTSRIVSKGISAG-FSNNT  379 (489)
Q Consensus       305 ~a~~~~~~~~lG~~~~r~~--~~~~L~G~~a~~~~~gi~l~~~~Q~~D~~~--~v~H~~p~t~S~~~~K~i~~d-~s~~~  379 (489)
T Consensus       327 gs~~~~~sv~~a~~~Q~~D~gtk~~H~ap~t~S~ii~K~I~~d~s~~~frG~v~i~~~A~~s~~~~~c~~LlL~~~a~~d  406 (484)
T PRK11814        327 NSVGEFYSVALTNGHQQADTGTKMIHIGKNTKSTIISKGISAGHSQNTYRGLVKIMPKATNARNFTQCDSLLIGDQCGAH  406 (484)
T ss_pred             CCEEEEEEEEECCCCEEEECCEEEEEECCCCEEEEEHHHHCCCCCEEEEEEEEEECCCCCCCHHHHHHHHEECCCCCCCC
T ss_conf             97899988997269899813307999757760135400122068879980257755774467034303115017886620


Q ss_pred             EEEEEEE
Q ss_conf             9401473
Q gi|254781059|r  380 YRGKVSV  386 (489)
Q Consensus       380 f~G~i~v  386 (489)
T Consensus       407 t~P~leI  413 (484)
T PRK11814        407 TFPYIEV  413 (484)
T ss_pred             CCCEEEE
T ss_conf             0653899