BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator
complex subunit SufB [Candidatus Liberibacter asiaticus str. psy62]
         (489 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|296445836|ref|ZP_06887788.1| FeS assembly protein SufB [Methylosinus trichosporium OB3b]
 gi|296256664|gb|EFH03739.1| FeS assembly protein SufB [Methylosinus trichosporium OB3b]
          Length = 489

 Score =  605 bits (1559), Expect = e-171,   Method: Composition-based stats.
 Identities = 388/489 (79%), Positives = 439/489 (89%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A +ETV +V +IDVD YKYGF T+I+ +KAPKGL+EDI+RFISAKKNEP+W+ EWRL 
Sbjct: 1   MAARQETVARVEEIDVDAYKYGFTTDIESEKAPKGLSEDIVRFISAKKNEPEWLTEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P WAR+ YPAID+ DLYYY+APKS  GP+SLD+VDPELLRTYEKLGIP+R
Sbjct: 61  AYRRWLTMEEPKWARVDYPAIDYQDLYYYSAPKSTPGPKSLDEVDPELLRTYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE LAGV+  K+AVDAVFDSVSV TTF+EEL K+GVIF PISEA+ EHP+LV+KYL +V
Sbjct: 121 EQEALAGVEQRKIAVDAVFDSVSVATTFREELSKAGVIFCPISEAVREHPELVRKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DNFYA LNSAVF+DGSFVYIP GVRCPMELSTYFRINEK TGQFERTLIIAD GSY
Sbjct: 181 VPVTDNFYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINEKNTGQFERTLIIADAGSY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+RDENQLHAAVVELVALD+AEIKYSTVQNWYPGDS+GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPKRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDSEGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  S ISWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIA+SNG+QQ+DSGTKM+HL K
Sbjct: 301 CRGKNSHISWTQVETGSAVTWKYPSCILRGDNSQGEFYSIAVSNGYQQVDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRI+SKGISAG S NTYRG+VS HR A  +RNFT CDSLLIG+ CGAHT+PY+ESKN
Sbjct: 361 NTKSRIISKGISAGNSQNTYRGQVSAHRKAEGARNFTNCDSLLIGDKCGAHTVPYLESKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           +S   EHEATTSKIS++ LFYC+QRG+ EE A ALIVNGFVR+VLQKLPMEFAVEAQKLI
Sbjct: 421 ASAVFEHEATTSKISEDQLFYCMQRGLSEEEATALIVNGFVRDVLQKLPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            +SLEGSVG
Sbjct: 481 AVSLEGSVG 489


>gi|15965488|ref|NP_385841.1| cysteine desulfurase activator complex subunit SufB [Sinorhizobium
           meliloti 1021]
 gi|307302609|ref|ZP_07582365.1| FeS assembly protein SufB [Sinorhizobium meliloti BL225C]
 gi|307318456|ref|ZP_07597890.1| FeS assembly protein SufB [Sinorhizobium meliloti AK83]
 gi|15074669|emb|CAC46314.1| Probable ABC transporter [Sinorhizobium meliloti 1021]
 gi|306895796|gb|EFN26548.1| FeS assembly protein SufB [Sinorhizobium meliloti AK83]
 gi|306902973|gb|EFN33564.1| FeS assembly protein SufB [Sinorhizobium meliloti BL225C]
          Length = 489

 Score =  599 bits (1545), Expect = e-169,   Method: Composition-based stats.
 Identities = 402/489 (82%), Positives = 452/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDVDQYKYGFET I++D APKGL+EDIIR IS+KKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRQIDVDQYKYGFETTIEMDLAPKGLSEDIIRLISSKKNEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRW TM++P+WAR+RYP IDF+D++YYAAPK   GP+SLD+VDPELL+ YEKLGIP++
Sbjct: 61  AYRRWQTMEEPTWARVRYPKIDFNDIHYYAAPKGTTGPKSLDEVDPELLKVYEKLGIPLK 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+ SK+AVDAVFDSVSVVTTFKEELKK+GVIFM ISEA+ EHPDLV+KYL TV
Sbjct: 121 EQEILAGVEKSKIAVDAVFDSVSVVTTFKEELKKAGVIFMSISEAMREHPDLVRKYLGTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINEK TGQFERTLIIADEG+Y
Sbjct: 181 VPQSDNFYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINEKNTGQFERTLIIADEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGD QGKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELIALDDAEIKYSTVQNWYPGDKQGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGKNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRI+SKGI+AG S NTYRG+VS HR A ++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIISKGIAAGVSENTYRGQVSAHRKAENARNFTQCDSLLIGDRCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIPEEAAIALIVNGFV+EV+Q+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPEEAAIALIVNGFVKEVIQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|227822091|ref|YP_002826062.1| cysteine desulfurase activator complex subunit SufB [Sinorhizobium
           fredii NGR234]
 gi|227341091|gb|ACP25309.1| transport protein associated with Fe-S cluster assembly SufB
           [Sinorhizobium fredii NGR234]
          Length = 489

 Score =  598 bits (1543), Expect = e-169,   Method: Composition-based stats.
 Identities = 401/489 (82%), Positives = 453/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDVDQYKYGFET I++DKAPKGL+EDIIR ISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRQIDVDQYKYGFETTIEMDKAPKGLSEDIIRLISAKKNEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWLTM +PSWAR+RYP IDF++++YYAAPK   GP+SLD+VDPELL+ YEKLGIP++
Sbjct: 61  AYQRWLTMDEPSWARVRYPKIDFNEIHYYAAPKGTTGPKSLDEVDPELLKVYEKLGIPLK 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+ +K+AVDAVFDSVSVVTTFKEELKK+GVIFM ISEA+ EHPDLV+KYL TV
Sbjct: 121 EQEILAGVEKTKIAVDAVFDSVSVVTTFKEELKKAGVIFMSISEAMREHPDLVRKYLGTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINEK TGQFERTLIIADEG+Y
Sbjct: 181 VPQSDNFYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINEKNTGQFERTLIIADEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELIALDDAEIKYSTVQNWYPGDKHGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL K
Sbjct: 301 CRGKNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAVSNGHQQVDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRI+SKGI+AG S+NTYRG+VS HR A ++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIISKGIAAGVSDNTYRGQVSAHRKAENARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIPEEAAIALIVNGFV+EV+Q+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPEEAAIALIVNGFVKEVIQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|163759515|ref|ZP_02166600.1| hypothetical protein HPDFL43_09187 [Hoeflea phototrophica DFL-43]
 gi|162283112|gb|EDQ33398.1| hypothetical protein HPDFL43_09187 [Hoeflea phototrophica DFL-43]
          Length = 489

 Score =  598 bits (1543), Expect = e-169,   Method: Composition-based stats.
 Identities = 395/489 (80%), Positives = 447/489 (91%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDVDQYKYGFET I+ D APKGLNED IR ISAKK+EP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRQIDVDQYKYGFETVIESDTAPKGLNEDTIRMISAKKDEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A++RW TM++PSWAR+ YP IDF D++YY+APK   GP+S+DDVDPELLR YEKLGIP+R
Sbjct: 61  AFKRWQTMEEPSWARVDYPKIDFQDIHYYSAPKGTAGPKSIDDVDPELLRVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGVQ SK+AVDAVFDSVSVVTTFK+EL ++GVIFM ISEA+ EHP+LV+KY+ TV
Sbjct: 121 EQEILAGVQQSKIAVDAVFDSVSVVTTFKKELAQAGVIFMSISEAMREHPELVQKYIGTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINEK TGQFERTLIIA+EG+Y
Sbjct: 181 VPVTDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINEKNTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVEL+A+D+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELIAMDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG+QQIDSGTKM+HL K
Sbjct: 301 CRGKNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAVSNGYQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSLLIGN CGAHT+PYIE+KN
Sbjct: 361 NTSSRIISKGISAGHSNNTYRGQVSAHRKAENARNFTQCDSLLIGNQCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCL RGIPEE AIALIVNGFV+EV+Q+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLARGIPEEEAIALIVNGFVKEVIQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|159184936|ref|NP_354808.2| cysteine desulfurase activator complex subunit SufB [Agrobacterium
           tumefaciens str. C58]
 gi|325293226|ref|YP_004279090.1| FeS assembly protein SufB [Agrobacterium sp. H13-3]
 gi|159140214|gb|AAK87593.2| ABC transporter subunit [Agrobacterium tumefaciens str. C58]
 gi|325061079|gb|ADY64770.1| FeS assembly protein SufB [Agrobacterium sp. H13-3]
          Length = 489

 Score =  598 bits (1542), Expect = e-169,   Method: Composition-based stats.
 Identities = 398/489 (81%), Positives = 452/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDVDQYKYGFET I+VDKAPKGL+E++IRFISAKK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRQIDVDQYKYGFETEIEVDKAPKGLSEEVIRFISAKKQEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWLTM++P+WAR+ YP IDF+DLYYYAAPKS  GP+SLD+VDPELL+ YEKLGIP++
Sbjct: 61  AYKRWLTMEEPTWARVSYPKIDFNDLYYYAAPKSTPGPKSLDEVDPELLKVYEKLGIPLK 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+  +VAVDAVFDSVSVVTTFK EL K+GVIFM ISEA+ E+PDLVKKYL +V
Sbjct: 121 EQEILAGVENRRVAVDAVFDSVSVVTTFKAELAKAGVIFMSISEAVREYPDLVKKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEK TGQFERTLIIA+EG+Y
Sbjct: 181 VPQTDNFYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKNTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGNRSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRI++KGI+AGFS N YRG+VS HR A ++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIIAKGIAAGFSENVYRGQVSAHRKATNTRNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           SS + EHEATTSKIS++ LFYCLQRGIPEE+AIALIVNGFV++V+Q+LPMEFAVEAQKLI
Sbjct: 421 SSAHFEHEATTSKISEDQLFYCLQRGIPEESAIALIVNGFVKDVIQQLPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|150396681|ref|YP_001327148.1| cysteine desulfurase activator complex subunit SufB [Sinorhizobium
           medicae WSM419]
 gi|150028196|gb|ABR60313.1| FeS assembly protein SufB [Sinorhizobium medicae WSM419]
          Length = 489

 Score =  597 bits (1540), Expect = e-168,   Method: Composition-based stats.
 Identities = 405/489 (82%), Positives = 453/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDVDQYKYGFET I++DKAPKGL+EDIIR IS+KKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRQIDVDQYKYGFETTIEMDKAPKGLSEDIIRLISSKKNEPEWMLEWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RW TM++PSWAR+RYP IDF+DL+YYAAPKS  GP+SLD+VDPELLR YEKLGIP++
Sbjct: 61  AYSRWQTMEEPSWARVRYPKIDFNDLHYYAAPKSTSGPKSLDEVDPELLRVYEKLGIPLK 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+ S++AVDAVFDSVSVVTTFKEELKK+GVIFM ISEA+ EHPDLV+KYL TV
Sbjct: 121 EQEILAGVEKSRIAVDAVFDSVSVVTTFKEELKKAGVIFMSISEAMREHPDLVRKYLGTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINEK TGQFERTLIIADEG+Y
Sbjct: 181 VPQSDNFYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINEKNTGQFERTLIIADEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGD QGKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELIALDDAEIKYSTVQNWYPGDKQGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGKNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRI+SKGI+AG S NTYRG+VS HR A ++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIISKGIAAGVSENTYRGQVSAHRKAENARNFTQCDSLLIGDRCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIPEEAAIALIVNGFV+EV+Q+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPEEAAIALIVNGFVKEVIQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|323136294|ref|ZP_08071376.1| FeS assembly protein SufB [Methylocystis sp. ATCC 49242]
 gi|322398368|gb|EFY00888.1| FeS assembly protein SufB [Methylocystis sp. ATCC 49242]
          Length = 489

 Score =  597 bits (1539), Expect = e-168,   Method: Composition-based stats.
 Identities = 392/489 (80%), Positives = 440/489 (89%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A +ETV +V  IDVD YKYGF T+I+ +KAPKGL+EDI+RFISAKKNEP+W+ EWRL 
Sbjct: 1   MAARQETVARVESIDVDAYKYGFTTDIESEKAPKGLSEDIVRFISAKKNEPEWLTEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP+ID+ DLYYY+APKS  GP+SLD+VDPELLRTYEKLGIP+R
Sbjct: 61  AYRRWLTMSEPNWARVHYPSIDYQDLYYYSAPKSTPGPKSLDEVDPELLRTYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+T KVAVDAVFDSVSV TTFKEEL K+GVIF PISEA+  HP+LV+KYL +V
Sbjct: 121 EQEILAGVETRKVAVDAVFDSVSVATTFKEELAKAGVIFCPISEAVQTHPELVRKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DNFYA LNSAVF+DGSFVY+PKGVRCPMELSTYFRINE+ TGQFERTLIIADEGSY
Sbjct: 181 VPVTDNFYATLNSAVFSDGSFVYVPKGVRCPMELSTYFRINEQKTGQFERTLIIADEGSY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+RDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGDS+G+GGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPKRDENQLHAAVVELIALDDAEIKYSTVQNWYPGDSEGRGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  S ISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG+QQ+DSGTKM+HL K
Sbjct: 301 CRGRNSHISWTQVETGSAITWKYPSCILRGDNSQGEFYSIAVSNGYQQVDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRIVSKGISAG S NTYRG+VS HR A  +RNFTQCDSLLIG++CGAHT+PYIESKN
Sbjct: 361 NTKSRIVSKGISAGKSQNTYRGQVSAHRKAEGARNFTQCDSLLIGHDCGAHTVPYIESKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S   EHEATTSKISD+ LFY +QRG+  E A ALIVNGFVREVLQ+LPMEFAVEAQKLI
Sbjct: 421 PSAQFEHEATTSKISDDQLFYAMQRGLSAEEATALIVNGFVREVLQQLPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 SISLEGSVG 489


>gi|110634132|ref|YP_674340.1| cysteine desulfurase activator complex subunit SufB [Mesorhizobium
           sp. BNC1]
 gi|110285116|gb|ABG63175.1| Iron-regulated ABC transporter membrane component SufB
           [Chelativorans sp. BNC1]
          Length = 503

 Score =  595 bits (1535), Expect = e-168,   Method: Composition-based stats.
 Identities = 401/503 (79%), Positives = 446/503 (88%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I+ DKAPKGLNEDI+R ISAKK EP+WM EWRL 
Sbjct: 1   MPAVQETIDQVRLIDVDQYKYGFETLIESDKAPKGLNEDIVRLISAKKGEPEWMTEWRLN 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRWLTM++PSWAR+ YP IDF D++YYAAPK+  GP SLD+VDPELLRTYEKLGIP++
Sbjct: 61  AFRRWLTMEEPSWARVSYPKIDFQDIHYYAAPKTQAGPTSLDEVDPELLRTYEKLGIPLK 120

Query: 121 EQEILAGV--------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV               + +VAVDAVFDSVSVVTTFK+EL K+GVIF  ISEAI
Sbjct: 121 EQEILAGVRKPAEGEDAGDNVYASGRVAVDAVFDSVSVVTTFKKELAKAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP+LV+KYL +VVP  DNFYA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINEK TG
Sbjct: 181 REHPELVRKYLGSVVPPTDNFYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINEKNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD Q
Sbjct: 241 QFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKQ 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRGE S GEFYSIA+SNG 
Sbjct: 301 GKGGIYNFVTKRGDCRGKNSKISWTQVETGSAITWKYPSCLLRGEGSRGEFYSIAVSNGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL KNT+SRI+SKGISAG SNNTYRG+VSVHR A ++RNFT CDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGKNTSSRIISKGISAGNSNNTYRGQVSVHRKAENARNFTNCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHT+PYIE+KNS+  +EHEATTSKISD+  FY +QRGIPEE AIALIVNGFV++V+Q
Sbjct: 421 DCGAHTVPYIEAKNSTAQIEHEATTSKISDDQKFYVMQRGIPEEEAIALIVNGFVKDVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           +LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 ELPMEFAVEAQKLIGISLEGSVG 503


>gi|222086103|ref|YP_002544635.1| FeS assembly protein SufB [Agrobacterium radiobacter K84]
 gi|221723551|gb|ACM26707.1| FeS assembly protein SufB [Agrobacterium radiobacter K84]
          Length = 489

 Score =  595 bits (1534), Expect = e-168,   Method: Composition-based stats.
 Identities = 401/489 (82%), Positives = 450/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I++DKAPKGL+EDI+RFISAKK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRLIDVDQYKYGFETIIEMDKAPKGLSEDIVRFISAKKQEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+ +P+WAR+ YP IDF+D+YYYAAPK+  GP SLD+VDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLDEPTWARVDYPKIDFNDIYYYAAPKTTPGPTSLDEVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+  K+AVDAVFDSVSVVTTFKEELKK+GVIFM ISEA+ EHPDLV+KYL TV
Sbjct: 121 EQEILAGVERPKIAVDAVFDSVSVVTTFKEELKKAGVIFMSISEAVREHPDLVRKYLGTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEK TGQFERTLIIA+EG+Y
Sbjct: 181 VPTSDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKNTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL K
Sbjct: 301 CRGHRSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQVDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRIVSKGI+AG S NTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIVSKGIAAGVSQNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIP EAAIALIVNGFV+EVLQ+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPTEAAIALIVNGFVKEVLQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|254719029|ref|ZP_05180840.1| cysteine desulfurase activator complex subunit SufB [Brucella sp.
           83/13]
 gi|265984019|ref|ZP_06096754.1| cysteine desulfurase activator complex subunit SufB [Brucella sp.
           83/13]
 gi|306840083|ref|ZP_07472869.1| FeS assembly protein SufB [Brucella sp. NF 2653]
 gi|264662611|gb|EEZ32872.1| cysteine desulfurase activator complex subunit SufB [Brucella sp.
           83/13]
 gi|306404811|gb|EFM61104.1| FeS assembly protein SufB [Brucella sp. NF 2653]
          Length = 507

 Score =  595 bits (1533), Expect = e-168,   Method: Composition-based stats.
 Identities = 398/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVEL+A++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELIAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKM+HL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMIHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|209549494|ref|YP_002281411.1| cysteine desulfurase activator complex subunit SufB [Rhizobium
           leguminosarum bv. trifolii WSM2304]
 gi|209535250|gb|ACI55185.1| FeS assembly protein SufB [Rhizobium leguminosarum bv. trifolii
           WSM2304]
          Length = 489

 Score =  594 bits (1532), Expect = e-168,   Method: Composition-based stats.
 Identities = 404/489 (82%), Positives = 453/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I++DKAPKGL+EDIIRFISAKK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRLIDVDQYKYGFETVIEMDKAPKGLSEDIIRFISAKKQEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF+D+YYYAAPKS  GP+SLD+VDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVDYPKIDFNDIYYYAAPKSTPGPKSLDEVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV   K+AVDAVFDSVSVVTTFK ELKK+GVIFM ISEAI E+PDLV+KYL +V
Sbjct: 121 EQEILAGVDKPKIAVDAVFDSVSVVTTFKAELKKAGVIFMSISEAIREYPDLVRKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEKGTGQFERTLIIA+EG+Y
Sbjct: 181 VPTSDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKGTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD +GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGDRSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRIVSKGI+AG SNNTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIVSKGIAAGVSNNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIP EAAIALIVNGFV+EVLQ+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPTEAAIALIVNGFVKEVLQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 SISLEGSVG 489


>gi|116252328|ref|YP_768166.1| cysteine desulfurase activator complex subunit SufB [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115256976|emb|CAK08070.1| putative iron-sulfur cluster formation subunit protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 489

 Score =  594 bits (1532), Expect = e-167,   Method: Composition-based stats.
 Identities = 403/489 (82%), Positives = 453/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I++DKAPKGL+EDIIRFISAKK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRLIDVDQYKYGFETVIEMDKAPKGLSEDIIRFISAKKQEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF+D+YYYAAPKS  GP+SLD+VDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVDYPKIDFNDIYYYAAPKSTPGPKSLDEVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+  K+AVDAVFDSVSVVTTFK ELKK+GVIFM ISEAI E+P+LV+KYL +V
Sbjct: 121 EQEILAGVEKPKIAVDAVFDSVSVVTTFKAELKKAGVIFMSISEAIREYPELVQKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEKGTGQFERTLIIA+EG+Y
Sbjct: 181 VPTSDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKGTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGDRSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRIVSKGI+AG SNNTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIVSKGIAAGVSNNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIP EAAIALIVNGFV+EVLQ+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPTEAAIALIVNGFVKEVLQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 SISLEGSVG 489


>gi|86357868|ref|YP_469760.1| cysteine desulfurase activator complex subunit SufB [Rhizobium etli
           CFN 42]
 gi|86281970|gb|ABC91033.1| ABC transporter involved in Fe-S cluster assembly, permease protein
           [Rhizobium etli CFN 42]
          Length = 489

 Score =  593 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 404/489 (82%), Positives = 454/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I++DKAPKGL+EDIIRFISAKK EPDWMLEWRL 
Sbjct: 1   MAAVQETIDQVRLIDVDQYKYGFETVIEMDKAPKGLSEDIIRFISAKKQEPDWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF+D++YYAAPKS  GP+SLD+VDPELL+ Y+KLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVNYPKIDFNDIHYYAAPKSAPGPKSLDEVDPELLKVYDKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+  K+AVDAVFDSVSVVTTFK ELKK+GVIFM ISEAI EHPDLV+KYL +V
Sbjct: 121 EQEILAGVEKPKIAVDAVFDSVSVVTTFKAELKKAGVIFMSISEAIREHPDLVRKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEKGTGQFERTLIIA+EG+Y
Sbjct: 181 VPTSDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKGTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD +GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRIVSKGI+AG SNNTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIVSKGIAAGVSNNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIP EAAIALIVNGFV+EVLQ+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPTEAAIALIVNGFVKEVLQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 SISLEGSVG 489


>gi|239831805|ref|ZP_04680134.1| FeS assembly protein SufB [Ochrobactrum intermedium LMG 3301]
 gi|239824072|gb|EEQ95640.1| FeS assembly protein SufB [Ochrobactrum intermedium LMG 3301]
          Length = 507

 Score =  593 bits (1530), Expect = e-167,   Method: Composition-based stats.
 Identities = 400/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ +KAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEAEKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYYAAPK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYAAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPSDNVYASGRVAVDAVFDSVSVVTTFKEELAKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVEL+AL+NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELIALENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|62289872|ref|YP_221665.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 1 str. 9-941]
 gi|82699799|ref|YP_414373.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis biovar Abortus 2308]
 gi|189024114|ref|YP_001934882.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus S19]
 gi|225627417|ref|ZP_03785454.1| FeS assembly protein SufB [Brucella ceti str. Cudo]
 gi|237815366|ref|ZP_04594364.1| FeS assembly protein SufB [Brucella abortus str. 2308 A]
 gi|254693658|ref|ZP_05155486.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 3 str. Tulya]
 gi|254706863|ref|ZP_05168691.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis M163/99/10]
 gi|254710028|ref|ZP_05171839.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis B2/94]
 gi|254714030|ref|ZP_05175841.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M644/93/1]
 gi|254716912|ref|ZP_05178723.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M13/05/1]
 gi|254730209|ref|ZP_05188787.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 4 str. 292]
 gi|256031523|ref|ZP_05445137.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis M292/94/1]
 gi|256061032|ref|ZP_05451188.1| cysteine desulfurase activator complex subunit SufB [Brucella
           neotomae 5K33]
 gi|256254927|ref|ZP_05460463.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           B1/94]
 gi|256369357|ref|YP_003106865.1| cysteine desulfurase activator complex subunit SufB [Brucella
           microti CCM 4915]
 gi|260168655|ref|ZP_05755466.1| cysteine desulfurase activator complex subunit SufB [Brucella sp.
           F5/99]
 gi|260545384|ref|ZP_05821125.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus NCTC 8038]
 gi|260757898|ref|ZP_05870246.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 4 str. 292]
 gi|261213925|ref|ZP_05928206.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 3 str. Tulya]
 gi|261218719|ref|ZP_05933000.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M13/05/1]
 gi|261222109|ref|ZP_05936390.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           B1/94]
 gi|261314329|ref|ZP_05953526.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis M163/99/10]
 gi|261317575|ref|ZP_05956772.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis B2/94]
 gi|261321783|ref|ZP_05960980.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M644/93/1]
 gi|261325031|ref|ZP_05964228.1| cysteine desulfurase activator complex subunit SufB [Brucella
           neotomae 5K33]
 gi|261758129|ref|ZP_06001838.1| cysteine desulfurase activator complex subunit SufB [Brucella sp.
           F5/99]
 gi|265988609|ref|ZP_06101166.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis M292/94/1]
 gi|62196004|gb|AAX74304.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941]
 gi|82615900|emb|CAJ10904.1| Protein of unknown function UPF0051 [Brucella melitensis biovar
           Abortus 2308]
 gi|189019686|gb|ACD72408.1| hypothetical protein BAbS19_I08870 [Brucella abortus S19]
 gi|225617422|gb|EEH14467.1| FeS assembly protein SufB [Brucella ceti str. Cudo]
 gi|237790203|gb|EEP64413.1| FeS assembly protein SufB [Brucella abortus str. 2308 A]
 gi|255999517|gb|ACU47916.1| cysteine desulfurase activator complex subunit SufB [Brucella
           microti CCM 4915]
 gi|260096791|gb|EEW80666.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus NCTC 8038]
 gi|260668216|gb|EEX55156.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 4 str. 292]
 gi|260915532|gb|EEX82393.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 3 str. Tulya]
 gi|260920693|gb|EEX87346.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           B1/94]
 gi|260923808|gb|EEX90376.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M13/05/1]
 gi|261294473|gb|EEX97969.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M644/93/1]
 gi|261296798|gb|EEY00295.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis B2/94]
 gi|261301011|gb|EEY04508.1| cysteine desulfurase activator complex subunit SufB [Brucella
           neotomae 5K33]
 gi|261303355|gb|EEY06852.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis M163/99/10]
 gi|261738113|gb|EEY26109.1| cysteine desulfurase activator complex subunit SufB [Brucella sp.
           F5/99]
 gi|264660806|gb|EEZ31067.1| cysteine desulfurase activator complex subunit SufB [Brucella
           pinnipedialis M292/94/1]
          Length = 507

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 400/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|241204827|ref|YP_002975923.1| cysteine desulfurase activator complex subunit SufB [Rhizobium
           leguminosarum bv. trifolii WSM1325]
 gi|240858717|gb|ACS56384.1| FeS assembly protein SufB [Rhizobium leguminosarum bv. trifolii
           WSM1325]
          Length = 489

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 402/489 (82%), Positives = 453/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I++DKAPKGL+EDIIRFISAKK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRLIDVDQYKYGFETVIEMDKAPKGLSEDIIRFISAKKQEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF+D+YYYAAPKS  GP+SLD+VDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVDYPKIDFNDIYYYAAPKSTPGPKSLDEVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+  K+AVDAVFDSVSVVTTFK ELKK+GVIFM ISEAI E+P+LV+KYL +V
Sbjct: 121 EQEILAGVERPKIAVDAVFDSVSVVTTFKAELKKAGVIFMSISEAIREYPELVQKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEKGTGQFERTLIIA+EG+Y
Sbjct: 181 VPTTDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKGTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGDRSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRIVSKGI+AG SNNTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIVSKGIAAGVSNNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIP EAAIALIVNGFV+EVLQ+LPMEFA+EAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPTEAAIALIVNGFVKEVLQELPMEFAIEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 SISLEGSVG 489


>gi|217977771|ref|YP_002361918.1| FeS assembly protein SufB [Methylocella silvestris BL2]
 gi|217503147|gb|ACK50556.1| FeS assembly protein SufB [Methylocella silvestris BL2]
          Length = 490

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 381/490 (77%), Positives = 438/490 (89%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+V+ IDV +YKYGF ++I+ +KAPKGLNEDI+RFISAKKNEPDW+ +WRL 
Sbjct: 1   MAAVQETVDRVKSIDVSEYKYGFFSDIESEKAPKGLNEDIVRFISAKKNEPDWLTQWRLG 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRWLTM +P+WAR+ +P ID+ DLYYY+APK+  GP+SLD+VDPELL+ Y KLGIP+ 
Sbjct: 61  AFRRWLTMAEPTWARVDFPKIDYQDLYYYSAPKTAAGPKSLDEVDPELLKVYAKLGIPLG 120

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQEILAGV    +VAVDAVFDSVSVVTTFKEEL K+GVIF PISEA+  HP+LV+KYL +
Sbjct: 121 EQEILAGVAPERRVAVDAVFDSVSVVTTFKEELAKAGVIFCPISEAVHTHPELVQKYLGS 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 181 VVPTTDNYFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINEQNTGQFERTLIIADKGS 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RDENQLHAAVVELV  ++AEIKYSTVQNWYPGDS+GKGGI+NFVTKRG
Sbjct: 241 YVSYLEGCTAPKRDENQLHAAVVELVTHEDAEIKYSTVQNWYPGDSEGKGGIFNFVTKRG 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSKISWTQ+ETGSAITWKYPSC+LRG++S GEFYSIAISNG QQ+DSGTKM+HL 
Sbjct: 301 DCRGARSKISWTQVETGSAITWKYPSCILRGDESRGEFYSIAISNGRQQVDSGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG+VS HR A  +RNFT CDSLLIGN+CGAHT+PYIES+
Sbjct: 361 KNTTSRIISKGISAGKSQNTYRGQVSSHRKATGARNFTNCDSLLIGNSCGAHTVPYIESR 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKISD+ LFYC+QRG+  E A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 421 NTSTQFEHEATTSKISDDQLFYCMQRGLSAEEATALIVNGFVRDVLQQLPMEFAVEAQKL 480

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 481 IAISLEGSVG 490


>gi|306840444|ref|ZP_07473204.1| FeS assembly protein SufB [Brucella sp. BO2]
 gi|306289578|gb|EFM60793.1| FeS assembly protein SufB [Brucella sp. BO2]
          Length = 507

 Score =  593 bits (1529), Expect = e-167,   Method: Composition-based stats.
 Identities = 401/507 (79%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELLRTYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLRTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|306843826|ref|ZP_07476424.1| FeS assembly protein SufB [Brucella sp. BO1]
 gi|306275904|gb|EFM57620.1| FeS assembly protein SufB [Brucella sp. BO1]
          Length = 507

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 399/507 (78%), Positives = 448/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELLRTYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLRTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVEL+A++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELIAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KN +SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNASSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|153009585|ref|YP_001370800.1| cysteine desulfurase activator complex subunit SufB [Ochrobactrum
           anthropi ATCC 49188]
 gi|151561473|gb|ABS14971.1| FeS assembly protein SufB [Ochrobactrum anthropi ATCC 49188]
          Length = 507

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 399/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ +KAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEAEKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYYAAPK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYAAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPSDNVYASGRVAVDAVFDSVSVVTTFKEELAKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVEL+A++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELIAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|190891952|ref|YP_001978494.1| ABC transporter involved in Fe-S cluster assembly, permease
           [Rhizobium etli CIAT 652]
 gi|190697231|gb|ACE91316.1| ABC transporter involved in Fe-S cluster assembly, permease protein
           [Rhizobium etli CIAT 652]
 gi|327191058|gb|EGE58111.1| ABC transporter involved in Fe-S cluster assembly, permease protein
           [Rhizobium etli CNPAF512]
          Length = 489

 Score =  593 bits (1528), Expect = e-167,   Method: Composition-based stats.
 Identities = 403/489 (82%), Positives = 454/489 (92%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR IDVDQYKYGFET I++DKAPKGL+EDIIRFISAKK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRLIDVDQYKYGFETVIEMDKAPKGLSEDIIRFISAKKQEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF+D++YYAAPKS  GP+SLD+VDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVNYPKIDFNDIHYYAAPKSAPGPKSLDEVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV+  K+AVDAVFDSVSVVTTFK ELKK+GVIFM ISEAI E+PDLV+KYL +V
Sbjct: 121 EQEILAGVEKPKIAVDAVFDSVSVVTTFKAELKKAGVIFMSISEAIREYPDLVRKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFRINEKGTGQFERTLIIA+EG+Y
Sbjct: 181 VPTSDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRINEKGTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD +GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL K
Sbjct: 301 CRGDRSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGHQQIDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRIVSKGI+AG SNNTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIVSKGIAAGVSNNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+   EHEATTSKIS++ LFYCLQRGIP EAAIALIVNGFV+EVLQ+LPMEFAVEAQKLI
Sbjct: 421 STAQFEHEATTSKISEDQLFYCLQRGIPTEAAIALIVNGFVKEVLQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 SISLEGSVG 489


>gi|222148789|ref|YP_002549746.1| cysteine desulfurase activator complex subunit SufB [Agrobacterium
           vitis S4]
 gi|221735775|gb|ACM36738.1| ABC transporter subunit [Agrobacterium vitis S4]
          Length = 489

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 409/489 (83%), Positives = 456/489 (93%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDVDQYKYGFET I+VDKAPKGL+EDI+RFISAKKNEPDWML+WRL 
Sbjct: 1   MAAVQETIDQVRQIDVDQYKYGFETMIEVDKAPKGLSEDIVRFISAKKNEPDWMLQWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWLTM++P WAR+ YP IDF+D+YYYAAPKS  GP S+DDVDPELL+ YEKLGIP+R
Sbjct: 61  AYQRWLTMEEPDWARVHYPKIDFNDIYYYAAPKSTAGPTSIDDVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGVQTSK+AVDAVFDSVSVVTTFK EL K+GVIFM ISEA+ E+PDLVKKYL TV
Sbjct: 121 EQEILAGVQTSKIAVDAVFDSVSVVTTFKAELMKAGVIFMSISEAVREYPDLVKKYLGTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DN+YA LNSAVFTDGSFV+IPKGVRCPMELSTYFRINEK TGQFERTLIIA+EG+Y
Sbjct: 181 VPVTDNYYATLNSAVFTDGSFVFIPKGVRCPMELSTYFRINEKNTGQFERTLIIAEEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG+QQ+DSGTKM+HL K
Sbjct: 301 CRGARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGYQQVDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT+SRI+SKGISAGFS+NTYRG+VS HR A ++RNFTQCDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NTSSRIISKGISAGFSSNTYRGQVSAHRKAENARNFTQCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           SS   EHEATTSKIS++ LFYCLQRGIP+EAAIALIVNGFVREV+Q+LPMEFAVEAQKLI
Sbjct: 421 SSAQFEHEATTSKISEDQLFYCLQRGIPQEAAIALIVNGFVREVIQELPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|256113479|ref|ZP_05454313.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 3 str. Ether]
 gi|265994860|ref|ZP_06107417.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 3 str. Ether]
 gi|262765973|gb|EEZ11762.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 3 str. Ether]
          Length = 507

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 398/507 (78%), Positives = 448/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           G+  GKGGIYNFVTKRGDC G  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GNKDGKGGIYNFVTKRGDCHGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|17987325|ref|NP_539959.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 1 str. 16M]
 gi|225852442|ref|YP_002732675.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis ATCC 23457]
 gi|256044599|ref|ZP_05447503.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|256264064|ref|ZP_05466596.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 2 str. 63/9]
 gi|260563951|ref|ZP_05834437.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 1 str. 16M]
 gi|265991023|ref|ZP_06103580.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|17983006|gb|AAL52223.1| abc transporter-associated protein [Brucella melitensis bv. 1 str.
           16M]
 gi|225640807|gb|ACO00721.1| FeS assembly protein SufB [Brucella melitensis ATCC 23457]
 gi|260153967|gb|EEW89059.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 1 str. 16M]
 gi|263001807|gb|EEZ14382.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 1 str. Rev.1]
 gi|263094259|gb|EEZ18129.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis bv. 2 str. 63/9]
 gi|326408956|gb|ADZ66021.1| cysteine desulfurase activator complex subunit SufB [Brucella
           melitensis M28]
 gi|326538670|gb|ADZ86885.1| FeS assembly protein SufB [Brucella melitensis M5-90]
          Length = 507

 Score =  592 bits (1526), Expect = e-167,   Method: Composition-based stats.
 Identities = 399/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           G+  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GNKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040736|gb|ACT57532.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 489

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 489/489 (100%), Positives = 489/489 (100%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL
Sbjct: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR
Sbjct: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV
Sbjct: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY
Sbjct: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK
Sbjct: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN
Sbjct: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI
Sbjct: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
           DISLEGSVG
Sbjct: 481 DISLEGSVG 489


>gi|90417692|ref|ZP_01225604.1| conserved hypothetical protein with 2S-2Fe iron binding domain
           [Aurantimonas manganoxydans SI85-9A1]
 gi|90337364|gb|EAS51015.1| conserved hypothetical protein with 2S-2Fe iron binding domain
           [Aurantimonas manganoxydans SI85-9A1]
          Length = 507

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 398/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VRKIDVDQYKYGFET I++D APKGLNEDIIR ISAKK+EP WML+WRL 
Sbjct: 1   MPAVQETIDQVRKIDVDQYKYGFETLIEMDVAPKGLNEDIIRLISAKKDEPQWMLDWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RW TM+ PSWAR+ YP IDF D++YYAAPKS+ GP SLD+VDPE+LRTYEKLGIP+R
Sbjct: 61  AFERWKTMESPSWARLDYPEIDFQDIHYYAAPKSMSGPASLDEVDPEILRTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQE+LAGV                  + S+VAVDAVFDSVSV TTFK+EL+K+GVIFMPI
Sbjct: 121 EQEMLAGVVKPAAEPTYDEDGNEIAPRESRVAVDAVFDSVSVATTFKKELQKAGVIFMPI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LVKKYL +VVPV DNF+A +NSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVKKYLGSVVPVSDNFFATMNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNWYP
Sbjct: 241 KNTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELIALDDAEIKYSTVQNWYP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  S+ISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGKNSRISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS +R A ++RNFTQCDSL
Sbjct: 361 SNGRQQIDSGTKMLHLGKNTSSRIISKGISAGNSNNTYRGQVSANRKATNARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE KN++   EHEATTSKISD+ LFYC+QRGIPEE A+ALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEVKNATAQFEHEATTSKISDDQLFYCMQRGIPEEEAVALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +V+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 DVIQQLPMEFAVEAQKLIGISLEGSVG 507


>gi|254689175|ref|ZP_05152429.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 6 str. 870]
 gi|256257425|ref|ZP_05462961.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 9 str. C68]
 gi|260754674|ref|ZP_05867022.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 6 str. 870]
 gi|260883700|ref|ZP_05895314.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 9 str. C68]
 gi|297248274|ref|ZP_06931992.1| FeS assembly protein SufB [Brucella abortus bv. 5 str. B3196]
 gi|260674782|gb|EEX61603.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 6 str. 870]
 gi|260873228|gb|EEX80297.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 9 str. C68]
 gi|297175443|gb|EFH34790.1| FeS assembly protein SufB [Brucella abortus bv. 5 str. B3196]
          Length = 507

 Score =  592 bits (1525), Expect = e-167,   Method: Composition-based stats.
 Identities = 399/507 (78%), Positives = 449/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           G+  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GEKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|23501815|ref|NP_697942.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           1330]
 gi|161618887|ref|YP_001592774.1| cysteine desulfurase activator complex subunit SufB [Brucella canis
           ATCC 23365]
 gi|163843200|ref|YP_001627604.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           ATCC 23445]
 gi|260566518|ref|ZP_05836988.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 4 str. 40]
 gi|23347749|gb|AAN29857.1| conserved hypothetical protein [Brucella suis 1330]
 gi|161335698|gb|ABX62003.1| FeS assembly protein SufB [Brucella canis ATCC 23365]
 gi|163673923|gb|ABY38034.1| FeS assembly protein SufB [Brucella suis ATCC 23445]
 gi|260156036|gb|EEW91116.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 4 str. 40]
          Length = 507

 Score =  591 bits (1523), Expect = e-167,   Method: Composition-based stats.
 Identities = 399/507 (78%), Positives = 448/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVV TFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVATFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|163796149|ref|ZP_02190111.1| FeS assembly protein SufB [alpha proteobacterium BAL199]
 gi|159178608|gb|EDP63148.1| FeS assembly protein SufB [alpha proteobacterium BAL199]
          Length = 485

 Score =  591 bits (1523), Expect = e-166,   Method: Composition-based stats.
 Identities = 347/489 (70%), Positives = 412/489 (84%), Gaps = 4/489 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  +TV +V  +    YKYGF T+I+ D APKGL+E  IRFISAKK EP+W+LEWRL 
Sbjct: 1   MAATADTVRQVEDVTGGAYKYGFVTDIESDVAPKGLDESTIRFISAKKEEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ +W  M +P WA++ Y  ID+ D++YY+APK   GP+SLD+VDPELL TY KLGIP++
Sbjct: 61  AFEQWKRMVEPEWAKVDYQRIDYQDIHYYSAPKQKDGPKSLDEVDPELLATYAKLGIPLK 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE+LAGV    VAVDAVFDSVSV TT+K+EL+K G++F  ISEA+ E P+LVK+YL +V
Sbjct: 121 EQELLAGV----VAVDAVFDSVSVATTYKKELEKKGIVFCSISEAVRERPELVKRYLGSV 176

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DN++A LNSAVFTDGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLIIADEGSY
Sbjct: 177 VPVADNYFACLNSAVFTDGSFVYIPKGVRCPMELSTYFRINAQNTGQFERTLIIADEGSY 236

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELV LD+A+IKYSTVQNWYPGD  GKGGIYNFVTKRG 
Sbjct: 237 VSYLEGCTAPQRDENQLHAAVVELVTLDDAQIKYSTVQNWYPGDENGKGGIYNFVTKRGA 296

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+AI+N  QQ D+GTKM+HL K
Sbjct: 297 CRGKRSKISWTQVETGSAVTWKYPSCILQGDDSVGEFYSVAITNNAQQADTGTKMIHLGK 356

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG ++NTYRG V + + A  +RN+TQCDSLLIG+ CGAHT+PYIESKN
Sbjct: 357 NTRSTIISKGISAGRADNTYRGLVRISKKAEGARNYTQCDSLLIGDKCGAHTVPYIESKN 416

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKIS++ LFYCL RG+  E A++LIVNGF +EV+++LPMEFAVEAQKLI
Sbjct: 417 PTARVEHEATTSKISEDQLFYCLSRGLSAEQAVSLIVNGFCKEVMKELPMEFAVEAQKLI 476

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 477 GISLEGSVG 485


>gi|254701691|ref|ZP_05163519.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 5 str. 513]
 gi|261752242|ref|ZP_05995951.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 5 str. 513]
 gi|261741995|gb|EEY29921.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 5 str. 513]
          Length = 507

 Score =  590 bits (1522), Expect = e-166,   Method: Composition-based stats.
 Identities = 399/507 (78%), Positives = 448/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PY E+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYFEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|154244042|ref|YP_001415000.1| FeS assembly protein SufB [Xanthobacter autotrophicus Py2]
 gi|154158127|gb|ABS65343.1| FeS assembly protein SufB [Xanthobacter autotrophicus Py2]
          Length = 494

 Score =  590 bits (1521), Expect = e-166,   Method: Composition-based stats.
 Identities = 383/494 (77%), Positives = 436/494 (88%), Gaps = 5/494 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV++TV++VR IDVDQYKYGFET I+ +KAPKGL+E++IR+ISAKK EP+WML+WRL 
Sbjct: 1   MAAVQDTVEQVRSIDVDQYKYGFETLIESEKAPKGLSEEVIRYISAKKEEPEWMLQWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM +P WAR+ YP ID+ DLYYY+ PK    P+SLD+VDPE+L+TY KLGIP+R
Sbjct: 61  AYARWLTMPEPEWARVDYPTIDYQDLYYYSQPKQFKAPKSLDEVDPEILKTYAKLGIPLR 120

Query: 121 EQEILAGVQ-----TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           EQEILAGV+       K+AVDAVFDSVSV TTFKEELK +GVIFMPISEA+ EHPD+VK+
Sbjct: 121 EQEILAGVEIPEGERPKIAVDAVFDSVSVATTFKEELKAAGVIFMPISEALREHPDMVKQ 180

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVP  DN++A LN AVF+DGSFVYIP GVRCPMELSTYFRINEK TGQFERTLIIA
Sbjct: 181 YLGSVVPPTDNYFATLNQAVFSDGSFVYIPPGVRCPMELSTYFRINEKNTGQFERTLIIA 240

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD+ GKGGIYNFV
Sbjct: 241 DKGSYVSYLEGCTAPMRDENQLHAAVVELVVLDDAEIKYSTVQNWYPGDADGKGGIYNFV 300

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRGE S GEFYSIAISNG QQ+DSGTKM
Sbjct: 301 TKRGDCRGKNSKISWTQVETGSAITWKYPSCVLRGEGSSGEFYSIAISNGRQQVDSGTKM 360

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNTTSRI+SKGISAG SNNTYRG VS HR AA +RNFT CDSLLIG+NCGAHT+PY
Sbjct: 361 IHLGKNTTSRIISKGISAGRSNNTYRGLVSAHRKAAGARNFTNCDSLLIGDNCGAHTVPY 420

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE+KN +   EHEATTSKIS++ LFYC+QRG+ +E A+AL+VNGFVR+VLQ+LPMEFAVE
Sbjct: 421 IEAKNPTAQFEHEATTSKISEDMLFYCMQRGLTQEDAVALVVNGFVRDVLQQLPMEFAVE 480

Query: 476 AQKLIDISLEGSVG 489
           AQKLI ISLEGSVG
Sbjct: 481 AQKLISISLEGSVG 494


>gi|209963828|ref|YP_002296743.1| cysteine desulfurase activator complex subunit SufB [Rhodospirillum
           centenum SW]
 gi|209957294|gb|ACI97930.1| FeS assembly protein SufB [Rhodospirillum centenum SW]
          Length = 493

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 359/493 (72%), Positives = 418/493 (84%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  +T+++VR +   +YKYGF T+I+ + APKGLNEDI+RFISAKK EP+W+LEWRL 
Sbjct: 1   MAATDQTLEQVRNLTETKYKYGFFTDIESEMAPKGLNEDIVRFISAKKQEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WLTM +P WA ++YP IDF D YYYAAPK    P+SLD+VDPELLRTYEKLGIP+R
Sbjct: 61  AYRHWLTMTEPDWAMLKYPPIDFQDSYYYAAPKVTEKPKSLDEVDPELLRTYEKLGIPLR 120

Query: 121 EQEILAGVQTSK----VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           EQEILAGV+ +     VAVDAVFDSVSV TTFK++L++ G+IF  ISEAI  HP+LV++Y
Sbjct: 121 EQEILAGVEGAGDVPAVAVDAVFDSVSVATTFKKKLEEKGIIFCSISEAIQTHPELVRQY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DNFYA LNSAVFTDGSFVYIPKGVRCPMELSTYFRIN K TGQFERTLIIAD
Sbjct: 181 LGSVVPYSDNFYATLNSAVFTDGSFVYIPKGVRCPMELSTYFRINAKNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           EGSYVSYLEGCTAPQRDENQLHAAVVEL+ALD+A+IKYSTVQNWYPGD  GKGGIYNFVT
Sbjct: 241 EGSYVSYLEGCTAPQRDENQLHAAVVELIALDDAQIKYSTVQNWYPGDENGKGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRG CRG  SKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+AI+N  QQ D+GTKM+
Sbjct: 301 KRGACRGRNSKISWTQVETGSAITWKYPSCILQGDNSVGEFYSVAITNNMQQADTGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           H+ KNT S IVSKGISAG + NTYRG V +   A  +RN+TQCDSLLIG+ CGAHT+PYI
Sbjct: 361 HIGKNTRSTIVSKGISAGRAQNTYRGLVKILPKADGARNYTQCDSLLIGDRCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E++N S  +EHEATT+KIS++ LFYC  RG+ EE A+ LIVNGF +EVL++LPMEFAVEA
Sbjct: 421 ENRNRSARVEHEATTAKISEDQLFYCRSRGLAEEDAVGLIVNGFCKEVLKELPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKL+ ISLEGSVG
Sbjct: 481 QKLVAISLEGSVG 493


>gi|209545422|ref|YP_002277651.1| cysteine desulfurase activator complex subunit SufB
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533099|gb|ACI53036.1| FeS assembly protein SufB [Gluconacetobacter diazotrophicus PAl 5]
          Length = 496

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 345/496 (69%), Positives = 413/496 (83%), Gaps = 7/496 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET D V  +    YK+GFET I++D APKGL ED IR IS +K EP+W+LEWRL 
Sbjct: 1   MPAVAETRDTVEGLGQSTYKWGFETEIEMDLAPKGLTEDTIRLISHRKQEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A++ W  M +P+WA++ +P IDF D +YYAAPK   GP+SLD+VDPELLRTYEKLGIP+ 
Sbjct: 61  AFQAWQAMPEPTWAKVSHPPIDFQDAHYYAAPKKKTGPKSLDEVDPELLRTYEKLGIPLH 120

Query: 121 EQEILAGVQTSK-------VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ +LAGV+  +       VAVDAVFDSVSVVTTF+E L K+GVIF PISEA+ EHPDLV
Sbjct: 121 EQALLAGVEVPEGQEARAPVAVDAVFDSVSVVTTFRETLAKAGVIFCPISEAVREHPDLV 180

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           ++YL +VVPV DNFYAALNSAVFTDGSFVY+P+GVRCPMELSTYFRIN + TGQFERTLI
Sbjct: 181 RRYLGSVVPVADNFYAALNSAVFTDGSFVYVPRGVRCPMELSTYFRINARNTGQFERTLI 240

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           + ++G+ VSYLEGCTAP RDENQLHAAVVELVA+D+A IKYSTVQNWYPGD  G+GGIYN
Sbjct: 241 VVEDGASVSYLEGCTAPMRDENQLHAAVVELVAMDDASIKYSTVQNWYPGDENGRGGIYN 300

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG CRG RSKISWTQ+ETGSAITWKYPSC+L+G+ + GEFYS+A++N  QQ D+GT
Sbjct: 301 FVTKRGACRGARSKISWTQVETGSAITWKYPSCILQGDGAVGEFYSVAVTNNHQQADTGT 360

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+ +NT S I++K ISAG S++TYRG V +   A+ SRNFTQCDSLLIG+ CGAHT+
Sbjct: 361 KMIHIGRNTRSTIIAKTISAGHSDSTYRGLVRMMPKASGSRNFTQCDSLLIGDQCGAHTV 420

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIES+N S  +EHEATTSKIS++ LFYC QRG+ EE A+ LIVNGF ++VL++LPMEFA
Sbjct: 421 PYIESRNMSAKIEHEATTSKISEDQLFYCRQRGLSEEDAVGLIVNGFCKDVLKELPMEFA 480

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ ISLEGSVG
Sbjct: 481 VEAQKLLQISLEGSVG 496


>gi|254704235|ref|ZP_05166063.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 3 str. 686]
 gi|261754901|ref|ZP_05998610.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 3 str. 686]
 gi|261744654|gb|EEY32580.1| cysteine desulfurase activator complex subunit SufB [Brucella suis
           bv. 3 str. 686]
          Length = 507

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 398/507 (78%), Positives = 448/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+++VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETINQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVV TFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVATFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|330994035|ref|ZP_08317965.1| UPF0051 protein [Gluconacetobacter sp. SXCC-1]
 gi|329758981|gb|EGG75495.1| UPF0051 protein [Gluconacetobacter sp. SXCC-1]
          Length = 496

 Score =  590 bits (1520), Expect = e-166,   Method: Composition-based stats.
 Identities = 345/496 (69%), Positives = 419/496 (84%), Gaps = 7/496 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET   V  +  + YK+GFET+I++D APKGLNE+ IR ISA+KNEP+WMLEWRL 
Sbjct: 1   MPAVAETRKTVETLGQNTYKWGFETDIEMDIAPKGLNEETIRLISARKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WL M++P+WA++ YP ID+ D++YYAAP+   GP+SLD+VDPELLRTYEKLGIP+ 
Sbjct: 61  AYRSWLEMREPTWAKVSYPPIDYQDVHYYAAPRKKPGPKSLDEVDPELLRTYEKLGIPLH 120

Query: 121 EQEILAGVQTSK-------VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ +LAGV+  +       VAVDAVFDSVSV TTF++ L+++GVIF PISEA+ EHP+LV
Sbjct: 121 EQAMLAGVEVPEGQEARPPVAVDAVFDSVSVATTFRKTLQEAGVIFCPISEAVQEHPELV 180

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
            KYL +VVPV DNFYAALN+AVFTDGSFV++PKGVRCPMELSTYFRIN + TGQFERTLI
Sbjct: 181 CKYLGSVVPVTDNFYAALNAAVFTDGSFVFVPKGVRCPMELSTYFRINARNTGQFERTLI 240

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           + ++G+ VSYLEGCTAP RDENQLHAAVVELVA+++A IKYSTVQNWYPGD  G+GGIYN
Sbjct: 241 VVEDGASVSYLEGCTAPMRDENQLHAAVVELVAMEDASIKYSTVQNWYPGDENGRGGIYN 300

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG CRG RSKISWTQ+ETGSAITWKYPSC+L+GE S GEFYS+A++N  QQ D+GT
Sbjct: 301 FVTKRGACRGARSKISWTQVETGSAITWKYPSCILQGEGSVGEFYSVAVTNNHQQADTGT 360

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+ +NT S I++K ISAG S++TYRG V +   A+ +RNFTQCDSLLIG+ CGAHT+
Sbjct: 361 KMIHIGRNTRSTIIAKTISAGQSDSTYRGLVRMMPRASGARNFTQCDSLLIGDRCGAHTV 420

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIES+N S  +EHEATTSKIS++ LFYC QRG+ EE A+ LIVNGF ++VL++LPMEFA
Sbjct: 421 PYIESRNMSARVEHEATTSKISEDQLFYCRQRGLSEEDAVGLIVNGFCKDVLKELPMEFA 480

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ ISLEGSVG
Sbjct: 481 VEAQKLLQISLEGSVG 496


>gi|254469234|ref|ZP_05082639.1| FeS assembly protein SufB [Pseudovibrio sp. JE062]
 gi|211961069|gb|EEA96264.1| FeS assembly protein SufB [Pseudovibrio sp. JE062]
          Length = 490

 Score =  588 bits (1517), Expect = e-166,   Method: Composition-based stats.
 Identities = 389/490 (79%), Positives = 438/490 (89%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+ IDVDQYKYGF T+I+ + APKGLNEDII FISAKK EP+WML WRL 
Sbjct: 1   MAAVQETIDQVKAIDVDQYKYGFVTDIESELAPKGLNEDIIAFISAKKEEPEWMLNWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW TM++P+WAR+ YP IDF+DL+YYAAPK+  GP+SLD+VDPELL TY+KLGIP+ 
Sbjct: 61  AFRRWKTMEEPTWARVEYPKIDFEDLHYYAAPKNTEGPKSLDEVDPELLETYKKLGIPLS 120

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQEILAGV     VAVDAVFDSVSV TTFKEEL K+GVIF PISEA+ EHP+LV+KYL +
Sbjct: 121 EQEILAGVAPENRVAVDAVFDSVSVATTFKEELAKAGVIFCPISEAVREHPELVQKYLGS 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRINEK TGQFERTLIIAD+GS
Sbjct: 181 VVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINEKNTGQFERTLIIADKGS 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVELVAL++AEIKYSTVQNWYPGDS+GKGGIYNFVTKRG
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVELVALEDAEIKYSTVQNWYPGDSEGKGGIYNFVTKRG 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCR   SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG QQIDSGTKM+HL 
Sbjct: 301 DCREKNSKISWTQVETGSAITWKYPSCILRGDNSQGEFYSIAISNGHQQIDSGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRI+SKGISAG S NTYRG+VS HR A+++RNFTQCDSLLIG+ CGAHT+PYIESK
Sbjct: 361 KNTASRIISKGISAGVSQNTYRGQVSAHRKASNARNFTQCDSLLIGDKCGAHTVPYIESK 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NSS   EHEATTSKISD+ +FYC  RG+ EE A+ALIVNGFVR+V+Q+LPMEFAVEAQKL
Sbjct: 421 NSSAVFEHEATTSKISDDQMFYCQARGLDEEEAVALIVNGFVRDVIQQLPMEFAVEAQKL 480

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 481 ISISLEGSVG 490


>gi|258542738|ref|YP_003188171.1| cysteine desulfurase activator complex subunit SufB [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256633816|dbj|BAH99791.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-01]
 gi|256636875|dbj|BAI02844.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-03]
 gi|256639928|dbj|BAI05890.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-07]
 gi|256642984|dbj|BAI08939.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-22]
 gi|256646039|dbj|BAI11987.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-26]
 gi|256649092|dbj|BAI15033.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-32]
 gi|256652079|dbj|BAI18013.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-01-42C]
 gi|256655136|dbj|BAI21063.1| ABC transporter FeS assembly protein SufB [Acetobacter pasteurianus
           IFO 3283-12]
          Length = 496

 Score =  588 bits (1516), Expect = e-166,   Method: Composition-based stats.
 Identities = 349/496 (70%), Positives = 424/496 (85%), Gaps = 7/496 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET + V K+    YK+GFET+IQ+D APKGLNEDI+R ISA+KNEP+W+LEWRL 
Sbjct: 1   MPAVTETREAVEKLGQSTYKWGFETDIQMDLAPKGLNEDIVRLISARKNEPEWLLEWRLT 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R+W +MK+P+WA++ YP ID+ D +YYAAP+   GP+SLD+VDPELL+TYEKLGIP+ 
Sbjct: 61  AFRKWQSMKEPTWAKVSYPPIDYQDAHYYAAPRKKEGPKSLDEVDPELLKTYEKLGIPLH 120

Query: 121 EQEILAGVQ-------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ +LAGV+          VAVDAVFDSVSVVTTF++ L+++GVIF PISEA+ EHP+LV
Sbjct: 121 EQALLAGVELPEGETARPPVAVDAVFDSVSVVTTFRKTLEEAGVIFCPISEAVQEHPELV 180

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           +KYL +VVPV DNFYAALNSAVFTDGSFVY+PKGVRCPMELSTYFRIN + TGQFERTLI
Sbjct: 181 RKYLGSVVPVADNFYAALNSAVFTDGSFVYVPKGVRCPMELSTYFRINARNTGQFERTLI 240

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           + ++G+ VSYLEGCTAP RDENQLHAAVVELVA+++A IKYSTVQNWYPGDS+G+GGIYN
Sbjct: 241 VVEDGASVSYLEGCTAPMRDENQLHAAVVELVAMEDASIKYSTVQNWYPGDSEGRGGIYN 300

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG CRG RSKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N  QQ D+GT
Sbjct: 301 FVTKRGACRGARSKISWTQVETGSAITWKYPSCILQGDGSVGEFYSVAVTNNCQQADTGT 360

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+ +NT S I++K ISAG S++TYRG V V   A+ +RNFTQCDSLLIG+ CGAHT+
Sbjct: 361 KMIHIGRNTRSTIIAKTISAGRSDSTYRGLVRVQPKASGARNFTQCDSLLIGDECGAHTV 420

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIES+N +  +EHEATTSKIS++ LFYC QRG+ EE A+ LIVNGF R+VL++LPMEFA
Sbjct: 421 PYIESRNMAARIEHEATTSKISEDQLFYCRQRGLSEEDAVGLIVNGFCRDVLKELPMEFA 480

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ ISLEGSVG
Sbjct: 481 VEAQKLLQISLEGSVG 496


>gi|294852285|ref|ZP_06792958.1| FeS assembly protein SufB [Brucella sp. NVSL 07-0026]
 gi|294820874|gb|EFG37873.1| FeS assembly protein SufB [Brucella sp. NVSL 07-0026]
          Length = 507

 Score =  588 bits (1516), Expect = e-166,   Method: Composition-based stats.
 Identities = 398/507 (78%), Positives = 447/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++V PV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVAPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGI EE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGILEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|114704652|ref|ZP_01437560.1| hypothetical protein FP2506_06946 [Fulvimarina pelagi HTCC2506]
 gi|114539437|gb|EAU42557.1| hypothetical protein FP2506_06946 [Fulvimarina pelagi HTCC2506]
          Length = 510

 Score =  588 bits (1516), Expect = e-166,   Method: Composition-based stats.
 Identities = 388/510 (76%), Positives = 445/510 (87%), Gaps = 21/510 (4%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D VRKIDVDQYKYGFET I++D APKGL+E+II+ ISAKK EP WML+WRL 
Sbjct: 1   MPAVQETIDSVRKIDVDQYKYGFETLIEMDVAPKGLDEEIIKLISAKKGEPQWMLDWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RW TM+ P WAR+ YP IDF D++YYAAPKS+ GP SLD+VDPE+LRTYEKLGIP++
Sbjct: 61  AFERWKTMESPDWARLDYPPIDFQDIHYYAAPKSMSGPASLDEVDPEILRTYEKLGIPLK 120

Query: 121 EQEILAGVQT---------------------SKVAVDAVFDSVSVVTTFKEELKKSGVIF 159
           EQE+LAGV+                      ++VAVDAVFDSVSV TTFK+EL+K+GVIF
Sbjct: 121 EQEVLAGVRKMDEPSEFDEDSGTPPAGQNGQTRVAVDAVFDSVSVATTFKKELEKAGVIF 180

Query: 160 MPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFR 219
           MPISEAI EHP+LV+KYL +VVP+ DNF+A +NSAVFTDGSFVY+PKGVRCPMELSTYFR
Sbjct: 181 MPISEAIREHPELVQKYLGSVVPISDNFFATMNSAVFTDGSFVYVPKGVRCPMELSTYFR 240

Query: 220 INEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQN 279
           INE+ TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVAL+ AEIKYSTVQN
Sbjct: 241 INERNTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALEGAEIKYSTVQN 300

Query: 280 WYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYS 339
           WYPGD +GKGGIYNFVTKRGDCRG  S+ISWTQ+ETGSAITWKYPSC+LRG+ + GEFYS
Sbjct: 301 WYPGDKEGKGGIYNFVTKRGDCRGDNSRISWTQVETGSAITWKYPSCILRGDNARGEFYS 360

Query: 340 IAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQC 399
           IA+SNG QQIDSGTKM+HL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQC
Sbjct: 361 IAVSNGRQQIDSGTKMIHLGKNTSSRIISKGISAGHSNNTYRGQVSAHRKAKNARNFTQC 420

Query: 400 DSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNG 459
           DSLLIG  CGAHT+PYIESKN++   EHEATTSKISD+ LFYC+QRGIPEE A+ALIVNG
Sbjct: 421 DSLLIGEECGAHTVPYIESKNATAQFEHEATTSKISDDQLFYCMQRGIPEEEAVALIVNG 480

Query: 460 FVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           FV++V+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 FVKDVIQQLPMEFAVEAQKLIGISLEGSVG 510


>gi|148559230|ref|YP_001258904.1| cysteine desulfurase activator complex subunit SufB [Brucella ovis
           ATCC 25840]
 gi|148370487|gb|ABQ60466.1| FeS assembly protein SufB [Brucella ovis ATCC 25840]
          Length = 507

 Score =  588 bits (1516), Expect = e-166,   Method: Composition-based stats.
 Identities = 398/507 (78%), Positives = 447/507 (88%), Gaps = 18/507 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WML WRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLGWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPEL +TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNRSGPKSLDEVDPELFKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVLDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLPMEFAVEAQKLIDISLEGSVG 489
           EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 EVIQELPMEFAVEAQKLIGISLEGSVG 507


>gi|162148830|ref|YP_001603291.1| cysteine desulfurase activator complex subunit SufB
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787407|emb|CAP57002.1| FeS assembly protein SufB [Gluconacetobacter diazotrophicus PAl 5]
          Length = 496

 Score =  588 bits (1515), Expect = e-166,   Method: Composition-based stats.
 Identities = 344/496 (69%), Positives = 412/496 (83%), Gaps = 7/496 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET D V  +    YK+GFET I++D APKGL ED IR IS +K EP+W+LEWRL 
Sbjct: 1   MPAVAETRDTVEGLGQSTYKWGFETEIEMDLAPKGLTEDTIRLISHRKQEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A++ W  M +P+WA++ +P IDF D +YYAAPK   GP+SLD+VDPELLRTYEKLGIP+ 
Sbjct: 61  AFQAWQAMPEPTWAKVSHPPIDFQDAHYYAAPKKKTGPKSLDEVDPELLRTYEKLGIPLH 120

Query: 121 EQEILAGVQTSK-------VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ +LAGV+  +       VAVDAVFDSVSVVTTF+E L K+GVIF PISEA+ EHPDLV
Sbjct: 121 EQALLAGVEVPEGQEARAPVAVDAVFDSVSVVTTFRETLAKAGVIFCPISEAVREHPDLV 180

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           ++YL +VVPV DNFYAALNSAVFTDGSFVY+P+GVRCPMELSTYFRIN + TGQFERTLI
Sbjct: 181 RRYLGSVVPVADNFYAALNSAVFTDGSFVYVPRGVRCPMELSTYFRINARNTGQFERTLI 240

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           + ++G+ VSYLEGCTAP RDENQLHAAVVELVA+D+A IKYSTVQNWYPGD  G+GGIYN
Sbjct: 241 VVEDGASVSYLEGCTAPMRDENQLHAAVVELVAMDDASIKYSTVQNWYPGDENGRGGIYN 300

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG CRG RSKISWTQ+ETGSAITWKYPSC+L+G+ + GEFYS+A++N  QQ D+GT
Sbjct: 301 FVTKRGACRGARSKISWTQVETGSAITWKYPSCILQGDGAVGEFYSVAVTNNHQQADTGT 360

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+ +NT S I++K ISAG S++TYRG V +   A+  RNFTQCDSLLIG+ CGAHT+
Sbjct: 361 KMIHIGRNTRSTIIAKTISAGHSDSTYRGLVRMMPKASGGRNFTQCDSLLIGDQCGAHTV 420

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIES+N S  +EHEATTSKIS++ LFYC QRG+ EE A+ LIVNGF ++VL++LPMEFA
Sbjct: 421 PYIESRNMSAKIEHEATTSKISEDQLFYCRQRGLSEEDAVGLIVNGFCKDVLKELPMEFA 480

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ ISLEGSVG
Sbjct: 481 VEAQKLLQISLEGSVG 496


>gi|328543981|ref|YP_004304090.1| ABC transporter involved in Fe-S cluster assembly, permease
           [polymorphum gilvum SL003B-26A1]
 gi|326413725|gb|ADZ70788.1| ABC transporter involved in Fe-S cluster assembly, permease protein
           [Polymorphum gilvum SL003B-26A1]
          Length = 490

 Score =  587 bits (1513), Expect = e-165,   Method: Composition-based stats.
 Identities = 380/490 (77%), Positives = 439/490 (89%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+ IDVDQYKYGF T+I+ ++  KGL+++ +RF+SAKKNEP+WM EWRL 
Sbjct: 1   MPAVQETIDRVKAIDVDQYKYGFVTDIESERGAKGLSDETVRFLSAKKNEPEWMTEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A RR+  M +P+WAR+ YP IDFDDLYYYAAPKS+ GP+S+D+VDPELL TYEKLGIP+R
Sbjct: 61  ALRRFKAMDEPTWARVSYPKIDFDDLYYYAAPKSVEGPKSIDEVDPELLATYEKLGIPLR 120

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQEILAG+     VAVDAVFDSVSVVTTFKEELKK+GVIF  ISEA+ E+PDLVKKYL +
Sbjct: 121 EQEILAGIAPQNRVAVDAVFDSVSVVTTFKEELKKAGVIFCSISEAVREYPDLVKKYLGS 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+YA LNSAVF+DGSFVY+P+GVRCPMELSTYFRINE+ TGQFERTLIIAD+G+
Sbjct: 181 VVPVTDNYYATLNSAVFSDGSFVYVPEGVRCPMELSTYFRINEQKTGQFERTLIIADKGA 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVELIALDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRG 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL 
Sbjct: 301 DCRGRNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAVSNGHQQIDSGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT+SRI+SKGI+AG S NTYRG VS HR A ++RNFTQCDSLLIG +CGAHT+PYIESK
Sbjct: 361 KNTSSRIISKGIAAGKSENTYRGLVSAHRKATNARNFTQCDSLLIGQDCGAHTVPYIESK 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++   EHEATTSKISD+ +FYCLQRG+ EE A+ALIVNGFV++V+Q+LPMEFAVEAQKL
Sbjct: 421 NATAVFEHEATTSKISDDQMFYCLQRGLSEEEAVALIVNGFVKDVIQQLPMEFAVEAQKL 480

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 481 ISISLEGSVG 490


>gi|118589097|ref|ZP_01546504.1| component of SufBCD complex [Stappia aggregata IAM 12614]
 gi|118438426|gb|EAV45060.1| component of SufBCD complex [Stappia aggregata IAM 12614]
          Length = 490

 Score =  587 bits (1513), Expect = e-165,   Method: Composition-based stats.
 Identities = 382/490 (77%), Positives = 442/490 (90%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+DKV+ IDVDQYKYGF T+I+ D+  KGL+E+ +RF+SAKKNEP+WM EWRL 
Sbjct: 1   MPAVQETIDKVKAIDVDQYKYGFVTDIESDRGAKGLSEETVRFLSAKKNEPEWMTEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A RR+  M++P+WAR+ YP ID DDLYY+A+PKS+ GP+SLD+VDPELL TYEKLGIP+R
Sbjct: 61  ALRRFRQMEEPTWARVSYPKIDLDDLYYWASPKSVEGPKSLDEVDPELLATYEKLGIPLR 120

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQEILAGV+    VAVDAVFDSVSVVTTFKEELKK+GVIF  ISEA+ E+PDLVKKYL +
Sbjct: 121 EQEILAGVEPKNRVAVDAVFDSVSVVTTFKEELKKAGVIFCSISEALREYPDLVKKYLGS 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+YA LNSAVF+DGSFVY+P+GVRCPMELSTYFRINE+ TGQFERTLIIA++G+
Sbjct: 181 VVPVTDNYYATLNSAVFSDGSFVYVPEGVRCPMELSTYFRINEQNTGQFERTLIIAEKGA 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNW+PGD  GKGGIYNFVTKRG
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWFPGDKNGKGGIYNFVTKRG 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRGE S GEFYSIA+SNG+QQ+DSGTKM+HL 
Sbjct: 301 DCRGKNSKISWTQVETGSAITWKYPSCILRGENSRGEFYSIAVSNGYQQVDSGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KN++SRI+SKGISAG S NTYRG VS HR A+++RNFTQCDSLLIG +CGAHT+PYIESK
Sbjct: 361 KNSSSRIISKGISAGKSQNTYRGLVSAHRKASNARNFTQCDSLLIGQDCGAHTVPYIESK 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKISD+ +FYCLQRG+ EE A+ALIVNGFV++V+Q+LPMEFAVEAQKL
Sbjct: 421 NASAQFEHEATTSKISDDQMFYCLQRGLSEEEAVALIVNGFVKDVIQQLPMEFAVEAQKL 480

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 481 ISISLEGSVG 490


>gi|158422668|ref|YP_001523960.1| FeS assembly SufB protein [Azorhizobium caulinodans ORS 571]
 gi|158329557|dbj|BAF87042.1| FeS assembly SufB protein [Azorhizobium caulinodans ORS 571]
          Length = 493

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 382/493 (77%), Positives = 440/493 (89%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR+IDV+QYKYGF T+++ +KAPKGL+ED+IRFISAKKNEP+WMLEWRL 
Sbjct: 1   MAAVQETIDQVRQIDVEQYKYGFVTDVESEKAPKGLSEDVIRFISAKKNEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P WA++ +P IDF DLYYYAAPK      SLD+VDPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMREPEWAKVNFPKIDFQDLYYYAAPKKKKALSSLDEVDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           EQE+LAGV+      K+AVDAVFDSVSV TTF++ELK++GVIFMPISEA+ EHP+LV+KY
Sbjct: 121 EQELLAGVERPEGERKIAVDAVFDSVSVATTFQKELKEAGVIFMPISEALKEHPELVRKY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L TVVPV DN+YA LNSAVF+DGSFVY+P+GVRCPMELSTYFRINEK TGQFERTLIIAD
Sbjct: 181 LGTVVPVTDNYYATLNSAVFSDGSFVYVPEGVRCPMELSTYFRINEKNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAPQRDENQLHAAVVELV LD+AEIKYSTVQNWYPGD  GKGGIYNFVT
Sbjct: 241 KGAYVSYLEGCTAPQRDENQLHAAVVELVVLDDAEIKYSTVQNWYPGDKDGKGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG QQ+DSGTKM+
Sbjct: 301 KRGDCRGANSKISWTQVETGSAITWKYPSCVLRGDGSQGEFYSIAISNGHQQVDSGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNT+SRIVSKGISAG S NTYRG VS HR A  +RNFT CDSLLIG+ CGAHT+PYI
Sbjct: 361 HLGKNTSSRIVSKGISAGQSQNTYRGLVSAHRKAKGARNFTACDSLLIGDQCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN +   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV+EVLQ+LPMEFAVEA
Sbjct: 421 EAKNPTTVFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVKEVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|329114663|ref|ZP_08243422.1| FeS assembly protein SufB [Acetobacter pomorum DM001]
 gi|326696143|gb|EGE47825.1| FeS assembly protein SufB [Acetobacter pomorum DM001]
          Length = 496

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 349/496 (70%), Positives = 424/496 (85%), Gaps = 7/496 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET + V K+    YK+GFET+IQ+D APKGLNEDI+R ISA+KNEP+W+LEWRL 
Sbjct: 1   MPAVTETREAVEKLGQSTYKWGFETDIQMDLAPKGLNEDIVRLISARKNEPEWLLEWRLT 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R+W +MK+P+WA++ YP ID+ D +YYAAP+   GP+SLD+VDPELLRTYEKLGIP+ 
Sbjct: 61  AFRKWQSMKEPTWAKVSYPPIDYQDAHYYAAPRKKEGPKSLDEVDPELLRTYEKLGIPLH 120

Query: 121 EQEILAGVQ-------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ +LAGV+          VAVDAVFDSVSVVTTF++ L+++GVIF PISEA+ EHP+LV
Sbjct: 121 EQAMLAGVELPEGETARPPVAVDAVFDSVSVVTTFRKTLEEAGVIFCPISEAVQEHPELV 180

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           +KYL +VVPV DNFYAALNSAVFTDGSFVY+PKGVRCPMELSTYFRIN + TGQFERTLI
Sbjct: 181 RKYLGSVVPVADNFYAALNSAVFTDGSFVYVPKGVRCPMELSTYFRINARNTGQFERTLI 240

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           + ++G+ VSYLEGCTAP RDENQLHAAVVELVA++++ IKYSTVQNWYPGDS+G+GGIYN
Sbjct: 241 VVEDGASVSYLEGCTAPMRDENQLHAAVVELVAMEDSSIKYSTVQNWYPGDSEGRGGIYN 300

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG CRG RSKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N  QQ D+GT
Sbjct: 301 FVTKRGACRGARSKISWTQVETGSAITWKYPSCILQGDGSVGEFYSVAVTNNCQQADTGT 360

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+ +NT S I++K ISAG S++TYRG V V   A+ +RNFTQCDSLLIG+ CGAHT+
Sbjct: 361 KMIHIGRNTRSTIIAKTISAGRSDSTYRGLVRVQPKASGARNFTQCDSLLIGDECGAHTV 420

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIES+N +  +EHEATTSKIS++ LFYC QRG+ EE A+ LIVNGF R+VL++LPMEFA
Sbjct: 421 PYIESRNMAARIEHEATTSKISEDQLFYCRQRGLSEEDAVGLIVNGFCRDVLKELPMEFA 480

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ ISLEGSVG
Sbjct: 481 VEAQKLLQISLEGSVG 496


>gi|58038585|ref|YP_190549.1| cysteine desulfurase activator complex subunit SufB [Gluconobacter
           oxydans 621H]
 gi|58000999|gb|AAW59893.1| ABC transporter subunit [Gluconobacter oxydans 621H]
          Length = 493

 Score =  587 bits (1512), Expect = e-165,   Method: Composition-based stats.
 Identities = 343/493 (69%), Positives = 414/493 (83%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET + V K+    Y++GFET+I++D APKGLNE+ +R IS +K EP WML+WRL 
Sbjct: 1   MPAVTETRETVEKLAKSSYEWGFETDIEMDIAPKGLNEETVRLISERKGEPQWMLDWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R WL M++P+WA I +P ID+ D +Y+A PK   GP+SLD+VDPELL+TY KLGIP+ 
Sbjct: 61  AFRAWLEMEEPTWAHIHHPPIDYQDAHYFAQPKKKPGPKSLDEVDPELLKTYAKLGIPLH 120

Query: 121 EQEILAGVQTSK----VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           EQ +LAGV+ ++    VAVDAVFDSVSV TTF++ L ++GVIF PIS+AI EHP+LV+KY
Sbjct: 121 EQALLAGVEGAEERLPVAVDAVFDSVSVATTFRKTLAEAGVIFCPISDAIREHPELVQKY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L TVVPV DNF+AALNSAVFTDGSFVYIP+GVRCPMELSTYFRIN + TGQFERTLIIA+
Sbjct: 181 LGTVVPVADNFFAALNSAVFTDGSFVYIPEGVRCPMELSTYFRINARNTGQFERTLIIAE 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           + + VSYLEGCTAPQRDENQLHAAVVELVA+++A IKYSTVQNWYPGD +G+GGIYNFVT
Sbjct: 241 DRATVSYLEGCTAPQRDENQLHAAVVELVAMEDASIKYSTVQNWYPGDDEGRGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRG CRG RSKISWTQ+ETGSAITWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM+
Sbjct: 301 KRGICRGARSKISWTQVETGSAITWKYPSCVLAGEGSVGEFYSVAVTNNHQQADTGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HLA NT S I++K ISAG S++TYRG V +   A ++RNFTQCDSLLIG+ CGAHT+PYI
Sbjct: 361 HLAPNTRSTIIAKTISAGHSDSTYRGLVRMQPKARNARNFTQCDSLLIGDQCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           ES+N +  +EHEATTSKIS++ LFYC  RG+ EE A+ LIVNGF REVL++LPMEFAVEA
Sbjct: 421 ESRNMTARVEHEATTSKISEDQLFYCRSRGLSEEDAVGLIVNGFCREVLKELPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKL+ ISLEGSVG
Sbjct: 481 QKLLQISLEGSVG 493


>gi|298291334|ref|YP_003693273.1| FeS assembly protein SufB [Starkeya novella DSM 506]
 gi|296927845|gb|ADH88654.1| FeS assembly protein SufB [Starkeya novella DSM 506]
          Length = 491

 Score =  586 bits (1510), Expect = e-165,   Method: Composition-based stats.
 Identities = 379/491 (77%), Positives = 438/491 (89%), Gaps = 2/491 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR IDVDQYKYGF T I+ +KAPKGL ED IRFISAKK+EP+WMLEWRL 
Sbjct: 1   MPAVQETVDQVRSIDVDQYKYGFFTEIESEKAPKGLTEDTIRFISAKKDEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW TM++P WAR+ YP I + +LYYY+APK   GP+S+DD+DPE+L TYEKLGIP+R
Sbjct: 61  AFRRWQTMREPEWARVSYPPIAYQELYYYSAPKRKEGPKSIDDIDPEILATYEKLGIPLR 120

Query: 121 EQEILAGVQ--TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLS 178
           E++ L G++   ++VAVDAVFDSVSV TTFKEEL K+GVIFMPISEAI E+P++V+KYL 
Sbjct: 121 ERDALLGIESGGARVAVDAVFDSVSVATTFKEELAKAGVIFMPISEAIREYPEVVRKYLG 180

Query: 179 TVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEG 238
           +VVPV DNF+A LNSAVF+DGSFVY+PKGVRCPMELSTYFRINE+ TGQFERTLIIADEG
Sbjct: 181 SVVPVTDNFFATLNSAVFSDGSFVYVPKGVRCPMELSTYFRINERNTGQFERTLIIADEG 240

Query: 239 SYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKR 298
           +YVSYLEGCTAP RDENQLHAAVVELVAL +AEIKYSTVQNWYPGDSQGKGGI+NFVTKR
Sbjct: 241 AYVSYLEGCTAPMRDENQLHAAVVELVALADAEIKYSTVQNWYPGDSQGKGGIFNFVTKR 300

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
           GDCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG QQ+DSGTKM+HL
Sbjct: 301 GDCRGDRSKISWTQVETGSAITWKYPSCILRGDNSQGEFYSIAISNGRQQVDSGTKMIHL 360

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
            KNT+SRI+SKGI+AG S+NTYRG VS HR A ++RNFT CDSLLIG+ CGAHT+PYIES
Sbjct: 361 GKNTSSRIISKGIAAGHSDNTYRGLVSAHRKATNARNFTNCDSLLIGDKCGAHTVPYIES 420

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           KNS+ + EHEATTSKIS++ LFYC QRG+  E A ALIVNGFV++VLQ+LPMEFAVEAQK
Sbjct: 421 KNSTAHFEHEATTSKISEDQLFYCRQRGLDPEEATALIVNGFVKDVLQQLPMEFAVEAQK 480

Query: 479 LIDISLEGSVG 489
           LI +SLEGSVG
Sbjct: 481 LIAVSLEGSVG 491


>gi|296116551|ref|ZP_06835161.1| cysteine desulfurase activator complex subunit SufB
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295976763|gb|EFG83531.1| cysteine desulfurase activator complex subunit SufB
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 496

 Score =  585 bits (1508), Expect = e-165,   Method: Composition-based stats.
 Identities = 343/496 (69%), Positives = 417/496 (84%), Gaps = 7/496 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET   V  +  + YK+GFET+I++D APKGLNEDIIR IS +KNEP+WML+WRL 
Sbjct: 1   MPAVAETRKTVETLGQNTYKWGFETDIEMDIAPKGLNEDIIRLISTRKNEPEWMLDWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY  WL M +P+WA++ +P ID+ D++YYAAPK   GP+SLD+VDPELLRTYEKLGIP+ 
Sbjct: 61  AYHAWLQMSEPTWAKVSHPPIDYQDVHYYAAPKKKPGPKSLDEVDPELLRTYEKLGIPLH 120

Query: 121 EQEILAGVQTSK-------VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ +LAGV+  +       +AVDAVFDSVSV TTF++ L ++GVIF PISEA+ EHPDLV
Sbjct: 121 EQALLAGVEVPEGEEARPPIAVDAVFDSVSVATTFRKTLSEAGVIFCPISEAVQEHPDLV 180

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           +KYL +VVPV DNFYAALN+AVFTDGSFV++PKGVRCPMELSTYFRIN + TGQFERTLI
Sbjct: 181 RKYLGSVVPVTDNFYAALNAAVFTDGSFVFVPKGVRCPMELSTYFRINARNTGQFERTLI 240

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           + ++G+ VSYLEGCTAP RDENQLHAAVVELVA+++A IKYSTVQNWYPGD  G+GGIYN
Sbjct: 241 VVEDGASVSYLEGCTAPMRDENQLHAAVVELVAMEDASIKYSTVQNWYPGDENGRGGIYN 300

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG CRG RSKISWTQ+ETGSAITWKYPSC+L+GE S GEFYS+A++N  QQ D+GT
Sbjct: 301 FVTKRGACRGARSKISWTQVETGSAITWKYPSCILQGEGSVGEFYSVAVTNNHQQADTGT 360

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+ +NT S I++K ISAG S++TYRG V +   A+  RNFTQCDSLLIG+ CGAHT+
Sbjct: 361 KMIHIGRNTRSTIIAKTISAGQSDSTYRGLVRMMPKASGGRNFTQCDSLLIGDRCGAHTV 420

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIE++N S ++EHEATTSKIS++ LFYC QRG+ EE A+ LIVNGF ++VL++LPMEFA
Sbjct: 421 PYIENRNMSASIEHEATTSKISEDQLFYCRQRGLSEEDAVGLIVNGFCKDVLKELPMEFA 480

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ ISLEGSVG
Sbjct: 481 VEAQKLLQISLEGSVG 496


>gi|154248389|ref|YP_001419347.1| FeS assembly protein SufB [Xanthobacter autotrophicus Py2]
 gi|154162474|gb|ABS69690.1| FeS assembly protein SufB [Xanthobacter autotrophicus Py2]
          Length = 490

 Score =  585 bits (1507), Expect = e-165,   Method: Composition-based stats.
 Identities = 382/492 (77%), Positives = 436/492 (88%), Gaps = 5/492 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETV++VR +DVDQYKYGF T+I+ +KAPKGL+ED IR+ISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETVERVRALDVDQYKYGFVTDIESEKAPKGLSEDTIRYISAKKNEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP IDF D YYY+APK+   P+S+D++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMVEPTWARVSYPQIDFQDYYYYSAPKA--APKSIDEIDPEILKTYEKLGIPLR 118

Query: 121 EQEILAGVQ---TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYL 177
           E++ L G++    SKVAVDAVFDSVSV TTFK EL  +GVIFMPISEAI EHP+LVK YL
Sbjct: 119 ERDALLGIESSGGSKVAVDAVFDSVSVATTFKAELASAGVIFMPISEAIREHPELVKTYL 178

Query: 178 STVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADE 237
            +VVPV DNFYA LNSAVF+DGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLIIADE
Sbjct: 179 GSVVPVSDNFYATLNSAVFSDGSFVYIPKGVRCPMELSTYFRINERNTGQFERTLIIADE 238

Query: 238 GSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTK 297
           G+YVSYLEGCTAPQRDENQLHAAVVELVAL  AEIKYSTVQNWYPGD  GKGGIYNFVTK
Sbjct: 239 GAYVSYLEGCTAPQRDENQLHAAVVELVALKGAEIKYSTVQNWYPGDKDGKGGIYNFVTK 298

Query: 298 RGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLH 357
           RGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG QQ+DSGTKM+H
Sbjct: 299 RGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSQGEFYSIAISNGHQQVDSGTKMIH 358

Query: 358 LAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIE 417
           L KNT+SRI+SKGI+AG S NTYRG+VS HR A  +RNFT CDSLLIG+ CGAHT+PY+E
Sbjct: 359 LGKNTSSRIISKGIAAGHSENTYRGQVSAHRKATGARNFTNCDSLLIGDQCGAHTVPYME 418

Query: 418 SKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQ 477
           +KN+S   EHEATTSKIS++ LFYCLQRG+  E A+ALIVNGFVR+VLQ+LPMEFAVEAQ
Sbjct: 419 AKNASAQFEHEATTSKISEDQLFYCLQRGLGPEEAVALIVNGFVRDVLQQLPMEFAVEAQ 478

Query: 478 KLIDISLEGSVG 489
           KLI +SLEGSVG
Sbjct: 479 KLIAVSLEGSVG 490


>gi|288961954|ref|YP_003452264.1| Fe-S cluster assembly protein [Azospirillum sp. B510]
 gi|288914234|dbj|BAI75720.1| Fe-S cluster assembly protein [Azospirillum sp. B510]
          Length = 494

 Score =  585 bits (1507), Expect = e-165,   Method: Composition-based stats.
 Identities = 355/494 (71%), Positives = 418/494 (84%), Gaps = 5/494 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  ETV++VR +   +YKYGF T+I+ D APKGLNEDI+RFISAKK EP+W+LEWRL 
Sbjct: 1   MAAQPETVEQVRAVTEQKYKYGFTTDIEADVAPKGLNEDIVRFISAKKEEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W TM++P WA + +P ID+ D +YYAAPK   GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AFRVWQTMEEPEWAAVSFPPIDYQDAHYYAAPKKKAGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGVQTSK-----VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           EQEILAGV+ S+     +AVDAVFDSVSV TTFK +L++ G+IF  ISEA+ +HPDLVKK
Sbjct: 121 EQEILAGVEGSEGKSPAIAVDAVFDSVSVATTFKAKLEEMGIIFCAISEAVQKHPDLVKK 180

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVP  DN+YA LN AVFTDGSFVYIPKGVRCPMELSTYFRIN+  TGQFERTLIIA
Sbjct: 181 YLGSVVPYTDNYYATLNCAVFTDGSFVYIPKGVRCPMELSTYFRINQANTGQFERTLIIA 240

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DEG+YVSYLEGCTAP+RDENQLHAAVVELVA+D+A IKYSTVQNWYPG+ +G GGIYNFV
Sbjct: 241 DEGAYVSYLEGCTAPKRDENQLHAAVVELVAMDDATIKYSTVQNWYPGNEEGVGGIYNFV 300

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKRG CRG  SKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+AI+N FQQ D+GTKM
Sbjct: 301 TKRGACRGRNSKISWTQVETGSAITWKYPSCILQGDNSVGEFYSVAITNNFQQADTGTKM 360

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +H+ KNT S IVSKGISAG +  TYRG V +   A  +RN TQCDSLLIG+ CGAHT+PY
Sbjct: 361 IHIGKNTRSTIVSKGISAGKAQQTYRGLVKILPKAEGARNHTQCDSLLIGDQCGAHTVPY 420

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IES+N S  +EHEATT+KIS++ LFYC QRGI EE A++LIVNGF +EVL++LPMEFAVE
Sbjct: 421 IESRNRSARIEHEATTAKISEDQLFYCRQRGISEEDAVSLIVNGFCKEVLKELPMEFAVE 480

Query: 476 AQKLIDISLEGSVG 489
           AQKL+ ISLEGSVG
Sbjct: 481 AQKLVGISLEGSVG 494


>gi|307946846|ref|ZP_07662181.1| FeS assembly protein SufB [Roseibium sp. TrichSKD4]
 gi|307770510|gb|EFO29736.1| FeS assembly protein SufB [Roseibium sp. TrichSKD4]
          Length = 490

 Score =  584 bits (1505), Expect = e-164,   Method: Composition-based stats.
 Identities = 379/490 (77%), Positives = 436/490 (88%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+ IDVDQYKYGF T+I+ +K  KGL+E+ +RF+SAKKNEP+WM EWRL 
Sbjct: 1   MPAVQETIDQVKAIDVDQYKYGFVTDIESEKGAKGLSEETVRFLSAKKNEPEWMTEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A RR+ TM +P WAR+ YP ID ++LYY+AAPKS+ GP+SLD+VDPELL TY KLGIP+ 
Sbjct: 61  ALRRFQTMTEPDWARVEYPPIDLNELYYWAAPKSVEGPKSLDEVDPELLETYAKLGIPLA 120

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQEILAGV+    VAVDAVFDSVSVVTTFKEEL K GVIF  ISEA+ EHP+LVKKYL +
Sbjct: 121 EQEILAGVEPKNRVAVDAVFDSVSVVTTFKEELAKVGVIFCSISEALREHPELVKKYLGS 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+YA LNSAVF+DGSFVYIP+GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 181 VVPVTDNYYATLNSAVFSDGSFVYIPEGVRCPMELSTYFRINEQNTGQFERTLIIADKGS 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNW+PGD  GKGGIYNFVTKRG
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWFPGDKDGKGGIYNFVTKRG 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 301 DCRGKNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAVSNGHQQVDSGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT+SRI+SKGISAG S NTYRG VS H+ A+++RNFTQCDSLLIG +CGAHT+PYIESK
Sbjct: 361 KNTSSRIISKGISAGKSQNTYRGLVSAHKKASNARNFTQCDSLLIGQDCGAHTVPYIESK 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKISD+ +FYCLQRG+ EE A+ALIVNGFV++V+Q+LPMEFAVE+QKL
Sbjct: 421 NASAQFEHEATTSKISDDQMFYCLQRGLSEEEAVALIVNGFVKDVIQQLPMEFAVESQKL 480

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 481 ISISLEGSVG 490


>gi|90424338|ref|YP_532708.1| cysteine desulfurase activator complex subunit SufB
           [Rhodopseudomonas palustris BisB18]
 gi|90106352|gb|ABD88389.1| Iron-regulated ABC transporter membrane component SufB
           [Rhodopseudomonas palustris BisB18]
          Length = 493

 Score =  584 bits (1505), Expect = e-164,   Method: Composition-based stats.
 Identities = 374/493 (75%), Positives = 435/493 (88%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A +ETV++VR++DVDQYKYGFET+I+ DKAPKGL+ED +RFISAKKNEPDWML+WRL 
Sbjct: 1   MPAEQETVERVRRVDVDQYKYGFETDIESDKAPKGLSEDTVRFISAKKNEPDWMLQWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP ID+ DLYYY+APK      S+D++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVDYPKIDYQDLYYYSAPKKKPQLSSIDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           E E+L GV       +VAVDAVFDSVSV TTF++ELK +GVIFMPISEAI EHPDLVKKY
Sbjct: 121 EVEVLEGVVRPEGERRVAVDAVFDSVSVATTFQKELKAAGVIFMPISEAIREHPDLVKKY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L TVVP  DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERTLIIAD
Sbjct: 181 LGTVVPTTDNYFATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAPQRDENQLHAAVVEL+  D+AEIKYSTVQNWYPG+S+G GGIYNFVT
Sbjct: 241 QGAYVSYLEGCTAPQRDENQLHAAVVELITHDDAEIKYSTVQNWYPGNSEGIGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DSGTKM+
Sbjct: 301 KRGDCRGKNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAISNGYQQVDSGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAHT+PY+
Sbjct: 361 HLGKNTTSRIISKGIAAGKSQNTYRGLVTAHRKATGARNFTACDSLLIGDQCGAHTVPYV 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPMEFAVEA
Sbjct: 421 EAKNSSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVKDVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|296536721|ref|ZP_06898781.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Roseomonas cervicalis ATCC 49957]
 gi|296262952|gb|EFH09517.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Roseomonas cervicalis ATCC 49957]
          Length = 499

 Score =  584 bits (1505), Expect = e-164,   Method: Composition-based stats.
 Identities = 353/499 (70%), Positives = 414/499 (82%), Gaps = 10/499 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET+D V+ +    YKYGFET I ++ APKGLNEDI+RFISAKKNEP W+LEWRL 
Sbjct: 1   MPAVTETIDAVQSVTQGTYKYGFETEIDMEFAPKGLNEDIVRFISAKKNEPAWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+  W TM++P W  + YP ID+ D YYYAAPK  V P+SLD+VDPELLRTYEKLGIP++
Sbjct: 61  AFALWKTMEEPRWPAVSYPPIDYQDAYYYAAPKQTVKPKSLDEVDPELLRTYEKLGIPLK 120

Query: 121 EQEILAGVQTS----------KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
           EQ ILAGV+ +           VAVDAVFDSVSV T++K+ L K G++F  ISEA+ EHP
Sbjct: 121 EQAILAGVEGAGDTPAEGGRMPVAVDAVFDSVSVATSYKDRLAKEGIVFCAISEAVQEHP 180

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LV++YL +VVP GDNF+AALNSAVFTDGSFVYIPKGV+CPMELSTYFRIN K TGQFER
Sbjct: 181 ELVRQYLGSVVPQGDNFFAALNSAVFTDGSFVYIPKGVKCPMELSTYFRINAKSTGQFER 240

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLIIA+EGS VSYLEGCTAP RDENQLHAAVVELVALD+A IKYSTVQNWYPGD  GKGG
Sbjct: 241 TLIIAEEGSSVSYLEGCTAPMRDENQLHAAVVELVALDDASIKYSTVQNWYPGDENGKGG 300

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKRG CRG RSKISWTQ+ETGS+ITWKYPSC+L+G++S GEFYS+AI+N  QQ D
Sbjct: 301 IYNFVTKRGACRGKRSKISWTQVETGSSITWKYPSCILQGDESVGEFYSVAITNNRQQAD 360

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           +GTKM H+ KNT S I+SKGISAGF  NTYRG V +   A+ +RNFTQCDSLLIG+ CGA
Sbjct: 361 TGTKMFHIGKNTRSTIISKGISAGFGQNTYRGLVKISPKASGARNFTQCDSLLIGDQCGA 420

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT+PYIE++  +  +EHEATTS+I+++ LFYC QRG+ EE A+ LIVNGF REVL++LPM
Sbjct: 421 HTVPYIENRCMTAKVEHEATTSRIAEDQLFYCRQRGLSEEDAVGLIVNGFCREVLKELPM 480

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFAVEAQKL+ ISLEGSVG
Sbjct: 481 EFAVEAQKLLQISLEGSVG 499


>gi|83593905|ref|YP_427657.1| cysteine desulfurase activator complex subunit SufB [Rhodospirillum
           rubrum ATCC 11170]
 gi|83576819|gb|ABC23370.1| Iron-regulated ABC transporter membrane component SufB
           [Rhodospirillum rubrum ATCC 11170]
          Length = 484

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 353/489 (72%), Positives = 416/489 (85%), Gaps = 5/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           MVA + TVD VR+   + YKYGF T+I VD APKGLNEDI+R ISAKK EP+WMLEWRL 
Sbjct: 1   MVATQNTVDTVRE-ATEAYKYGFVTDIAVDIAPKGLNEDIVRLISAKKGEPEWMLEWRLK 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R WLT+ +P WA++ YP ID+ D++YYAAPK   GP+SLD+VDPELL TY KLGIP++
Sbjct: 60  AFRHWLTLTEPDWAKVSYPPIDYQDVHYYAAPKLSEGPKSLDEVDPELLETYAKLGIPLK 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE+LAGV    VAVDAVFDSVSV TT+K++L + GVIF  ISEAI EHP+LV+KYL +V
Sbjct: 120 EQELLAGV----VAVDAVFDSVSVATTYKKKLGQMGVIFCSISEAIREHPELVRKYLGSV 175

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN++A LN AVFTDGSFVY+PKG+RCPMELSTYFRINE+ TGQFERTLI+ D+G+Y
Sbjct: 176 VPYSDNYFATLNCAVFTDGSFVYVPKGLRCPMELSTYFRINERNTGQFERTLIVCDDGAY 235

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVALD+A+IKYSTVQNWYPGD  GKGGI+NFVTKRG 
Sbjct: 236 VSYLEGCTAPQRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDKNGKGGIFNFVTKRGA 295

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+AI+N  QQ D+GTKM+H+ +
Sbjct: 296 CRGKNSKISWTQVETGSAVTWKYPSCILQGDNSMGEFYSVAITNNAQQADTGTKMIHIGR 355

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRI+SKGI+AG S+ TYRG V +   A  +RNFTQCDSLLIG+ CGAHT+PYIES+N
Sbjct: 356 NTRSRIISKGIAAGRSDQTYRGLVRMLPKAEGARNFTQCDSLLIGDRCGAHTVPYIESRN 415

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTS+I D+ LFYCLQRGI EE A+ALIVNGF +EVLQ LPMEFAVEAQKL+
Sbjct: 416 PTAKVEHEATTSRIGDDQLFYCLQRGIAEEDAVALIVNGFCKEVLQTLPMEFAVEAQKLV 475

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 476 SISLEGSVG 484


>gi|114327989|ref|YP_745146.1| cysteine desulfurase activator complex subunit SufB [Granulibacter
           bethesdensis CGDNIH1]
 gi|114316163|gb|ABI62223.1| ABC transporter-associated protein sufB [Granulibacter bethesdensis
           CGDNIH1]
          Length = 498

 Score =  583 bits (1503), Expect = e-164,   Method: Composition-based stats.
 Identities = 357/498 (71%), Positives = 417/498 (83%), Gaps = 9/498 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET+D V+ +    YK+G+ET I++D APKGL ED IR IS++K EP+W+LEWRL 
Sbjct: 1   MPAVAETLDAVKSVTESGYKWGWETEIEMDMAPKGLTEDTIRLISSRKEEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+  W TM+ P WARI +  IDF DL+YYAAPK   GP+SLD+VDPELLRTYEKLGIP++
Sbjct: 61  AFAAWKTMEMPEWARIAHAPIDFQDLHYYAAPKKKTGPKSLDEVDPELLRTYEKLGIPLK 120

Query: 121 EQEILAGVQTSK---------VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           EQ +LAGV+ ++         +AVDAVFDSVSV TTF+E L K GVIF  ISEA+ EHP+
Sbjct: 121 EQALLAGVEGAEALPASASPGIAVDAVFDSVSVATTFRESLAKVGVIFCSISEAVREHPE 180

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LVK+YL +VVP  DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRIN K TGQFERT
Sbjct: 181 LVKQYLGSVVPASDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINAKNTGQFERT 240

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIA++G+YVSYLEGCTAPQRDENQLHAAVVELVALD+A+IKYSTVQNWYPGD++G+GGI
Sbjct: 241 LIIAEDGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDAEGRGGI 300

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRG CRG RSKISWTQ+ETGSAITWKYPSCLL GE S GEFYS+A++   QQ D+
Sbjct: 301 YNFVTKRGACRGARSKISWTQVETGSAITWKYPSCLLLGEGSIGEFYSVAVTTNRQQADT 360

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+H+  NTTS IVSKGISAG SNNTYRG V +   A ++RNFTQCDSLLIG+ CGAH
Sbjct: 361 GTKMIHIGPNTTSTIVSKGISAGHSNNTYRGLVKMMPKAQNARNFTQCDSLLIGDLCGAH 420

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIES+N +  +EHEATTSKI+D+ LFYC  RG+ EE A+ LIVNGF +EVL++LPME
Sbjct: 421 TVPYIESRNPTAKIEHEATTSKIADDQLFYCRSRGLSEEDAVNLIVNGFCKEVLKELPME 480

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQKL+ ISLEGSVG
Sbjct: 481 FAVEAQKLLAISLEGSVG 498


>gi|240850613|ref|YP_002972013.1| FeS assembly protein SufB [Bartonella grahamii as4aup]
 gi|240267736|gb|ACS51324.1| FeS assembly protein SufB [Bartonella grahamii as4aup]
          Length = 503

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 395/503 (78%), Positives = 447/503 (88%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGFETNI+ DKAPKGLNEDII+FISAKK+EP+WML WRL 
Sbjct: 1   MPAVQETIRQVREIDVDQYKYGFETNIETDKAPKGLNEDIIKFISAKKHEPEWMLTWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P WAR+ YP IDF +LYYYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  AYRRWLTMQEPHWARLEYPKIDFQELYYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGVQ--------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV+              + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVRKQSDPSTFDDSMSVSGQVAVDAVFDSVSVVTTFKKELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EH +L+K+YL TVVP+ DN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 IEHSELIKEYLGTVVPISDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIA E SYVSYLEGCTAPQRDENQLHAAVVEL+AL NAEIKYSTVQNWYPGD  
Sbjct: 241 QFERTLIIAAEDSYVSYLEGCTAPQRDENQLHAAVVELIALKNAEIKYSTVQNWYPGDKD 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG+ + GEFYSIA++NG 
Sbjct: 301 GKGGIYNFVTKRGDCRGDSSKISWTQVETGSAITWKYPSCLLRGDNARGEFYSIAVANGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL KNT+SRI+SKGISAGFSNNTYRG+V+ HR A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGKNTSSRIISKGISAGFSNNTYRGQVTAHRKAQNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCGAHTVPYIEAKNATAQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|220925677|ref|YP_002500979.1| FeS assembly protein SufB [Methylobacterium nodulans ORS 2060]
 gi|219950284|gb|ACL60676.1| FeS assembly protein SufB [Methylobacterium nodulans ORS 2060]
          Length = 489

 Score =  583 bits (1502), Expect = e-164,   Method: Composition-based stats.
 Identities = 382/490 (77%), Positives = 438/490 (89%), Gaps = 2/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR IDVDQYKYGFET I+++K+ KGL+ED+IRFISAKK+EP+WMLEWRL 
Sbjct: 1   MPAVQETVDRVRAIDVDQYKYGFETTIEMEKSEKGLSEDVIRFISAKKDEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P+WAR+ Y  ID++D+YYYAAPK     QSLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMREPTWARVSYEKIDYNDIYYYAAPKRKSA-QSLDEIDPEILKTYEKLGIPLR 119

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           E E L G+ +   VAVDAVFDSVSV TTFK EL K+GVIFMPISEA+ EHP+LV+KYL +
Sbjct: 120 EVEALEGIASENRVAVDAVFDSVSVATTFKAELAKAGVIFMPISEALREHPELVRKYLGS 179

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 180 VVPVTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGS 239

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RD+NQLHAAVVEL+ALD+AEIKYSTVQNWYPGD+QG+GGIYNFVTKRG
Sbjct: 240 YVSYLEGCTAPRRDDNQLHAAVVELIALDDAEIKYSTVQNWYPGDAQGRGGIYNFVTKRG 299

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 300 DCRGANSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAVSNGRQQVDSGTKMIHLG 359

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG VS HR A ++RNFT CDSLLIG+ CGAHT+PYIESK
Sbjct: 360 KNTTSRIISKGISAGHSQNTYRGLVSAHRKATNARNFTNCDSLLIGDQCGAHTVPYIESK 419

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKIS++ LFYC QRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 420 NASAVFEHEATTSKISEDQLFYCRQRGLSEEEARALIVNGFVRDVLQQLPMEFAVEAQKL 479

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 480 ISISLEGSVG 489


>gi|163868342|ref|YP_001609551.1| cysteine desulfurase activator complex subunit SufB [Bartonella
           tribocorum CIP 105476]
 gi|161017998|emb|CAK01556.1| ABC transporter subunit [Bartonella tribocorum CIP 105476]
          Length = 503

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 396/503 (78%), Positives = 448/503 (89%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGFET I+ DKAPKGLNEDII+FISAKKNEP+WML WRL 
Sbjct: 1   MPAVQETIRQVREIDVDQYKYGFETKIKTDKAPKGLNEDIIKFISAKKNEPEWMLTWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P WAR+ YP IDF +LYYYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  AYRRWLTMQEPHWARLEYPKIDFQELYYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGVQ--------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV+              + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVRKQSDPSTFDDSVSVSGQVAVDAVFDSVSVVTTFKKELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EH +L+K+YL TVVPVGDN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 IEHSELIKEYLGTVVPVGDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIA E SYVSYLEGCTAPQRDENQLHAAVVEL+AL+NAEIKYSTVQNWYPGD  
Sbjct: 241 QFERTLIIAAEDSYVSYLEGCTAPQRDENQLHAAVVELIALENAEIKYSTVQNWYPGDKD 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG+ + GEFYSIA++NG 
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCLLRGDNARGEFYSIAVANGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL KNT+SRI+SKGISAGFSNNTYRG+V+ +R A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGKNTSSRIISKGISAGFSNNTYRGQVTAYRKAQNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCGAHTVPYIEAKNATAQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|300023865|ref|YP_003756476.1| FeS assembly protein SufB [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525686|gb|ADJ24155.1| FeS assembly protein SufB [Hyphomicrobium denitrificans ATCC 51888]
          Length = 489

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 380/489 (77%), Positives = 437/489 (89%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+KIDVDQYKYGFET I+  KAPKGL+E  +R+ISAKK EP+W+L WRL 
Sbjct: 1   MAAVQETIDQVKKIDVDQYKYGFETKIESIKAPKGLDETTVRYISAKKGEPEWLLNWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A++RW  M +P+WAR+ YP IDF DLYYY+APKS  GP+SL++VDPELL TY+KLGIP++
Sbjct: 61  AFQRWKAMTEPTWARVHYPKIDFQDLYYYSAPKSTEGPKSLEEVDPELLETYKKLGIPLK 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQEILAGV +S+VAVDAVFDSVS+VTTFKEEL K+GVIF PISEA+ EHP+LVKKYL +V
Sbjct: 121 EQEILAGVSSSRVAVDAVFDSVSIVTTFKEELAKAGVIFCPISEAVREHPELVKKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSFVY+P+GVRCPMELSTYFRINEK TGQFERTLIIAD+GSY
Sbjct: 181 VPQSDNFYAALNSAVFSDGSFVYVPEGVRCPMELSTYFRINEKQTGQFERTLIIADKGSY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD+QGKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPTRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDAQGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG+QQ+DSGTKM+HL K
Sbjct: 301 CRGHHSKISWTQVETGSAITWKYPSCILRGDHSRGEFYSIAVSNGYQQVDSGTKMIHLGK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           N++SRI+SKGI+AG+S NTYRG VS HR A   RNFT CDSLLIG+ CGAHT+PYIE+KN
Sbjct: 361 NSSSRIISKGIAAGYSQNTYRGLVSAHRKATGVRNFTNCDSLLIGDKCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           SS + EHEATTSKISD+ LFYC QRG+ +E A+AL+VNGFVR+VLQ LPMEF  E QKLI
Sbjct: 421 SSAHFEHEATTSKISDDMLFYCQQRGLSQEEAVALVVNGFVRDVLQHLPMEFMAETQKLI 480

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 481 GISLEGSVG 489


>gi|254502037|ref|ZP_05114188.1| FeS assembly protein SufB [Labrenzia alexandrii DFL-11]
 gi|222438108|gb|EEE44787.1| FeS assembly protein SufB [Labrenzia alexandrii DFL-11]
          Length = 490

 Score =  582 bits (1499), Expect = e-164,   Method: Composition-based stats.
 Identities = 380/490 (77%), Positives = 439/490 (89%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+ IDVDQYKYGF T+I+ +K  KGL+E+ +RF+SAKK+EP+WM EWRL 
Sbjct: 1   MPAVQETIDQVKAIDVDQYKYGFVTDIESEKGAKGLSEETVRFLSAKKDEPEWMTEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A RR+  M +P WAR+ YP IDFD+LYY+AAPKS+ GP+SLD+VDPELL TYEKLGIP+R
Sbjct: 61  ALRRFQQMDEPDWARVSYPKIDFDELYYWAAPKSVEGPKSLDEVDPELLETYEKLGIPLR 120

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQEILAGV     VAVDAVFDSVSVVTTFKEELKK+GVIF  ISEA+ E+PDLVKKY+ +
Sbjct: 121 EQEILAGVAPENRVAVDAVFDSVSVVTTFKEELKKAGVIFCSISEAMREYPDLVKKYIGS 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+YA LNSAVF+DGSFVYIP+GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 181 VVPVTDNYYATLNSAVFSDGSFVYIPEGVRCPMELSTYFRINEQNTGQFERTLIIADKGS 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNW+PGD  GKGGIYNFVTKRG
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVELIALDDAEIKYSTVQNWFPGDKDGKGGIYNFVTKRG 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQIDSGTKM+HL 
Sbjct: 301 DCRGKNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAVSNGHQQIDSGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT+SR++SKGISAG S NTYRG +S HR A+++RNFTQCDSLLIG +CGAHT+PYIESK
Sbjct: 361 KNTSSRVISKGISAGKSENTYRGLISAHRKASNARNFTQCDSLLIGQDCGAHTVPYIESK 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++   EHEATTSKISD+ +FYCLQRG+ EE A+ALIVNGFV++V+Q+LPMEFAVEAQKL
Sbjct: 421 NATAQFEHEATTSKISDDQMFYCLQRGMNEEEAVALIVNGFVKDVIQQLPMEFAVEAQKL 480

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 481 ISISLEGSVG 490


>gi|260460859|ref|ZP_05809109.1| FeS assembly protein SufB [Mesorhizobium opportunistum WSM2075]
 gi|259033436|gb|EEW34697.1| FeS assembly protein SufB [Mesorhizobium opportunistum WSM2075]
          Length = 505

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 393/505 (77%), Positives = 448/505 (88%), Gaps = 16/505 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV++T+D+VRKIDVDQYKYGF+T I VDKAPKGL+EDIIRFISAKK+EP WMLEWRL 
Sbjct: 1   MPAVQDTIDRVRKIDVDQYKYGFQTEIAVDKAPKGLSEDIIRFISAKKDEPSWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF D+YYYAAPKS  GP SL DVDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVNYPKIDFQDIYYYAAPKSTPGPSSLSDVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQ----------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISE 164
           EQEILAGVQ                + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISE
Sbjct: 121 EQEILAGVQKTDVSELEEASDNVYKSGRVAVDAVFDSVSVVTTFKKELAQAGVIFCSISE 180

Query: 165 AICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKG 224
           AI EHP+LVKKYL +VVP  DNFYA LNSAVFTDGSFV++PKGVRCPMELSTYFR+NEK 
Sbjct: 181 AIREHPELVKKYLGSVVPTSDNFYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRMNEKN 240

Query: 225 TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD 284
           TGQFERTLIIA+EG+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD
Sbjct: 241 TGQFERTLIIAEEGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGD 300

Query: 285 SQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISN 344
           ++GKGGIYNFVTKRGDCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SN
Sbjct: 301 AEGKGGIYNFVTKRGDCRGNRSKISWTQVETGSAITWKYPSCILRGDDSQGEFYSIAVSN 360

Query: 345 GFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLI 404
           G+QQ+DSGTKM+HL KNT+SRI+SKGI+AGFS NTYRG+VS HR A ++RNFT CDSLLI
Sbjct: 361 GYQQVDSGTKMIHLGKNTSSRIISKGIAAGFSQNTYRGQVSAHRKATNARNFTNCDSLLI 420

Query: 405 GNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREV 464
           G+ CGAHT+PY+E+KNS+   EHEATTSKIS++  FY +QRGIPEE AIALIVNGFV++V
Sbjct: 421 GDQCGAHTVPYMEAKNSTAQFEHEATTSKISEDQKFYVMQRGIPEEEAIALIVNGFVKDV 480

Query: 465 LQKLPMEFAVEAQKLIDISLEGSVG 489
           +Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 IQQLPMEFAVEAQKLIGISLEGSVG 505


>gi|49475627|ref|YP_033668.1| cysteine desulfurase activator complex subunit SufB [Bartonella
           henselae str. Houston-1]
 gi|49238434|emb|CAF27662.1| ABC transporter subunit [Bartonella henselae str. Houston-1]
          Length = 503

 Score =  581 bits (1497), Expect = e-163,   Method: Composition-based stats.
 Identities = 398/503 (79%), Positives = 446/503 (88%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGFET I+ DKAPKGLNEDIIRFISAKK EP+WML+WRL 
Sbjct: 1   MPAVQETIRQVREIDVDQYKYGFETKIKTDKAPKGLNEDIIRFISAKKCEPEWMLKWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRWLTM++P WARI YP IDF +L+YYAAPK+  GP+SL++VDPELL TYEKLGIP++
Sbjct: 61  AFRRWLTMQEPDWARIEYPKIDFQELHYYAAPKNHTGPKSLEEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGV--------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV               + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVRKQSDPSTFDESVYASGQVAVDAVFDSVSVVTTFKKELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP L+ +YL TVVPVGDN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 IEHPALINQYLGTVVPVGDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVELVAL NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADEDSYVSYLEGCTAPQRDENQLHAAVVELVALKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           G GGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG+ S GEFYSIA++NG 
Sbjct: 301 GNGGIYNFVTKRGDCRGDNSKISWTQIETGSAITWKYPSCLLRGDNSRGEFYSIAVANGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL KNT+SRIVSKGISAGFSNNTYRG+V+ HR A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGKNTSSRIVSKGISAGFSNNTYRGQVTAHRKAHNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCGAHTVPYIEAKNATAQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|148261259|ref|YP_001235386.1| cysteine desulfurase activator complex subunit SufB [Acidiphilium
           cryptum JF-5]
 gi|326404673|ref|YP_004284755.1| FeS assembly protein SufB [Acidiphilium multivorum AIU301]
 gi|146402940|gb|ABQ31467.1| Iron-regulated ABC transporter membrane component SufB
           [Acidiphilium cryptum JF-5]
 gi|325051535|dbj|BAJ81873.1| FeS assembly protein SufB [Acidiphilium multivorum AIU301]
          Length = 483

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 354/489 (72%), Positives = 417/489 (85%), Gaps = 6/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV ET++ V +I    YK+GFETNI+++ APKGLNEDI+R ISAKK EP+W+LEWRL 
Sbjct: 1   MPAVNETIETVDRISGGGYKFGFETNIEMEFAPKGLNEDIVRLISAKKGEPEWLLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WL+M+DP+WARIR+P ID+ DL+YYAAPK    P+SLD+VDPELL  YEKLGIP+ 
Sbjct: 61  AYRAWLSMEDPAWARIRHPKIDYQDLHYYAAPK-KPAPKSLDEVDPELLAMYEKLGIPLN 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG+     AVDAVFDSVSV TTF+E L K+GVIF  ISEA+ EHPDLV+KYL +V
Sbjct: 120 ERAALAGI-----AVDAVFDSVSVATTFRESLAKAGVIFCSISEAVREHPDLVRKYLGSV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP GDN+YAALNSAVF+DGSFV++PKGVRCPMELSTYFRIN + TGQFERTLI+A+ G+ 
Sbjct: 175 VPAGDNYYAALNSAVFSDGSFVFVPKGVRCPMELSTYFRINARNTGQFERTLIVAEAGAS 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD A IKYSTVQNWYPGD++G+GGIYNFVTKRG 
Sbjct: 235 VSYLEGCTAPMRDENQLHAAVVELVALDEATIKYSTVQNWYPGDAEGRGGIYNFVTKRGA 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+L+GE S GEFYS+A++N FQQ D+GTKM+HLA 
Sbjct: 295 CRGRNSKISWTQVETGSAITWKYPSCILQGEGSTGEFYSVAVTNNFQQADTGTKMIHLAP 354

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NTTS IVSKGISAG SNNTYRG V +   A ++RNFTQCDSLLIG+ CGAHT+PYIES+N
Sbjct: 355 NTTSTIVSKGISAGRSNNTYRGLVRIMPRATNARNFTQCDSLLIGDRCGAHTVPYIESRN 414

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI+D+ LFYC  RG+ EE A+ L+VNGF R+VL++LPMEFAVEAQKL+
Sbjct: 415 RTAKVEHEATTSKIADDQLFYCRSRGLSEEDAVGLLVNGFCRDVLKELPMEFAVEAQKLL 474

Query: 481 DISLEGSVG 489
            +SLEGSVG
Sbjct: 475 AVSLEGSVG 483


>gi|329889572|ref|ZP_08267915.1| feS assembly protein SufB [Brevundimonas diminuta ATCC 11568]
 gi|328844873|gb|EGF94437.1| feS assembly protein SufB [Brevundimonas diminuta ATCC 11568]
          Length = 488

 Score =  580 bits (1496), Expect = e-163,   Method: Composition-based stats.
 Identities = 360/490 (73%), Positives = 425/490 (86%), Gaps = 3/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M  V+ET+D V ++  ++YKYGF T+++ + APKGLN DIIRFIS KK EP+WMLEWRL 
Sbjct: 1   MAIVQETIDTVAEL--ERYKYGFTTDVEQEFAPKGLNPDIIRFISEKKGEPEWMLEWRLA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWL M++P+WA ++Y  +D+ DLYYYAAP    GP+SLD+VDPELL  Y KLGIP++
Sbjct: 59  AYERWLAMEEPTWAAVKYDPVDYQDLYYYAAPVKKEGPKSLDEVDPELLEVYAKLGIPLK 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQE+LAGVQ   KVAVDAVFDSVSVVTTFKEEL K+GVIFMPISEA+ E+PDLV++YL T
Sbjct: 119 EQEVLAGVQGAPKVAVDAVFDSVSVVTTFKEELAKAGVIFMPISEALREYPDLVRQYLGT 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALNSAVF+DGSFVYIP GVRCPMELSTYFRIN   TGQFERTLIIAD+GS
Sbjct: 179 VVPVSDNYFAALNSAVFSDGSFVYIPPGVRCPMELSTYFRINASQTGQFERTLIIADKGS 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAAVVE++ALD+AE+KYSTVQNWYPGD++GKGGIYNFVTKR 
Sbjct: 239 YVSYLEGCTAPMRDENQLHAAVVEIIALDDAEVKYSTVQNWYPGDAEGKGGIYNFVTKRA 298

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+SWTQ+ETGSA+TWKYPSC+L+GE+S GEFYSIAI+NG QQ D+GTKMLHL 
Sbjct: 299 DCRGDRSKVSWTQVETGSAVTWKYPSCILKGEESSGEFYSIAITNGHQQADTGTKMLHLG 358

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KN+ SRI++K +SAG S++TYRG VS+H  A   RNFTQCDSLLIG  CGAHTIPYIE +
Sbjct: 359 KNSRSRIIAKTVSAGKSDSTYRGLVSIHSKATGVRNFTQCDSLLIGKECGAHTIPYIEVR 418

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  LEHEATT+++S++ LFY  QRG+ EE A+AL+VNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 419 NGSAQLEHEATTTRLSEDQLFYAQQRGLSEEEAVALLVNGFVRDVLQELPMEFAVEAQKL 478

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 479 VAISLEGSVG 488


>gi|86750111|ref|YP_486607.1| cysteine desulfurase activator complex subunit SufB
           [Rhodopseudomonas palustris HaA2]
 gi|86573139|gb|ABD07696.1| Iron-regulated ABC transporter membrane component SufB
           [Rhodopseudomonas palustris HaA2]
          Length = 498

 Score =  580 bits (1495), Expect = e-163,   Method: Composition-based stats.
 Identities = 383/498 (76%), Positives = 437/498 (87%), Gaps = 9/498 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ DKAPKGL+EDI+RFISAKKNEPDWML+WRL 
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETLIESDKAPKGLSEDIVRFISAKKNEPDWMLQWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP IDF DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVDYPKIDFQDLYYYSAPKPKKTIGSLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQ---------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           E  +L GV+         + K+AVDAVFDSVSV TTF+ ELKK+GVIFMPISEAI EHPD
Sbjct: 121 EVALLEGVEPRPGEPNTPSRKIAVDAVFDSVSVATTFQAELKKAGVIFMPISEAIKEHPD 180

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LVKKYL TVVP  DN+YA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERT
Sbjct: 181 LVKKYLGTVVPTSDNYYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERT 240

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+GSYVSYLEGCTAPQRDENQLHAAVVELV  D+AEIKYSTVQNWYPG+S+GKGGI
Sbjct: 241 LIIADKGSYVSYLEGCTAPQRDENQLHAAVVELVTHDDAEIKYSTVQNWYPGNSEGKGGI 300

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DS
Sbjct: 301 YNFVTKRGDCRGNNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDS 360

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL  NTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAH
Sbjct: 361 GTKMIHLGNNTTSRIISKGIAAGRSQNTYRGLVTAHRKAKGARNFTACDSLLIGDQCGAH 420

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPME
Sbjct: 421 TVPYIEAKNSSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVKDVLQQLPME 480

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQKLI ISLEGSVG
Sbjct: 481 FAVEAQKLISISLEGSVG 498


>gi|299133785|ref|ZP_07026979.1| FeS assembly protein SufB [Afipia sp. 1NLS2]
 gi|298591621|gb|EFI51822.1| FeS assembly protein SufB [Afipia sp. 1NLS2]
          Length = 499

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 382/499 (76%), Positives = 437/499 (87%), Gaps = 10/499 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAP+GL ED IRFISAKKNEP WMLEWRL 
Sbjct: 1   MPAVQETVDRVRQIDVDQYRYGFETQIESEKAPRGLTEDTIRFISAKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRWLTM++P+WAR+ YP ID+ DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AFRRWLTMEEPTWARVDYPKIDYQDLYYYSAPKKKKEVASLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGV----------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
           E E+L GV             +VAVDAVFDSVSV TTF+ ELKK+GVIFMPIS+AI EHP
Sbjct: 121 EVEVLEGVVRKDEDGNEVSERRVAVDAVFDSVSVATTFQAELKKAGVIFMPISDAIREHP 180

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           DLVKKYL +VVP  DNF+A LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFER
Sbjct: 181 DLVKKYLGSVVPTSDNFFATLNSAVFSDGSFVYLPPGVRCPMELSTYFRINERNTGQFER 240

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLIIAD+G+YVSYLEGCTAPQRDENQLHAAVVELVA D+AEIKYSTVQNWYPG+S+GKGG
Sbjct: 241 TLIIADKGAYVSYLEGCTAPQRDENQLHAAVVELVAHDDAEIKYSTVQNWYPGNSEGKGG 300

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNGFQQ+D
Sbjct: 301 IYNFVTKRGDCRGKNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGFQQVD 360

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           SGTKM+HL KNTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGA
Sbjct: 361 SGTKMIHLGKNTTSRIISKGIAAGVSQNTYRGLVTAHRKATGARNFTACDSLLIGDKCGA 420

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+AL+VNGFVR+VLQ+LPM
Sbjct: 421 HTVPYIEAKNSSTQFEHEATTSKISEDMLFYCVQRGLSQEEAVALVVNGFVRDVLQQLPM 480

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFAVEAQKLI ISLEGSVG
Sbjct: 481 EFAVEAQKLISISLEGSVG 499


>gi|57165208|ref|NP_101908.2| cysteine desulfurase activator complex subunit SufB [Mesorhizobium
           loti MAFF303099]
 gi|14021081|dbj|BAB47694.1| ABC transporter subunit [Mesorhizobium loti MAFF303099]
          Length = 505

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 391/505 (77%), Positives = 447/505 (88%), Gaps = 16/505 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV++T+D+VRKIDVDQYKYGF+T I V KAPKGL+EDIIRFISAKK+EP WMLEWRL 
Sbjct: 1   MPAVQDTIDRVRKIDVDQYKYGFQTEIAVAKAPKGLSEDIIRFISAKKDEPSWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+++P+WAR+ YP IDF D+YYYAAPKS  GP SL DVDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLEEPTWARVHYPKIDFQDIYYYAAPKSTPGPSSLSDVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQ----------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISE 164
           EQEILAGVQ                + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISE
Sbjct: 121 EQEILAGVQKTDASELEEPSDNVYKSGRVAVDAVFDSVSVVTTFKKELAQAGVIFCSISE 180

Query: 165 AICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKG 224
           AI EHP+LV+KYL +VVP  DNFYA LNSAVFTDGSFV++PKGVRCPMELSTYFR+NEK 
Sbjct: 181 AIREHPELVQKYLGSVVPTSDNFYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRMNEKN 240

Query: 225 TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD 284
           TGQFERTLIIA+EG+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD
Sbjct: 241 TGQFERTLIIAEEGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGD 300

Query: 285 SQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISN 344
           ++GKGGIYNFVTKRGDCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SN
Sbjct: 301 AEGKGGIYNFVTKRGDCRGDRSKISWTQVETGSAITWKYPSCILRGDDSSGEFYSIAVSN 360

Query: 345 GFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLI 404
           G+QQ+DSGTKM+HL KNT+SRI+SKGI+AGFS NTYRG+VS HR A ++RNFT CDSLLI
Sbjct: 361 GYQQVDSGTKMIHLGKNTSSRIISKGIAAGFSQNTYRGQVSAHRKATNARNFTNCDSLLI 420

Query: 405 GNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREV 464
           G+ CGAHT+PY+E+KNS+   EHEATTSKIS++  FY +QRGIPEE AIALIVNGFV++V
Sbjct: 421 GDQCGAHTVPYMEAKNSTAQFEHEATTSKISEDQKFYVMQRGIPEEEAIALIVNGFVKDV 480

Query: 465 LQKLPMEFAVEAQKLIDISLEGSVG 489
           +Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 IQQLPMEFAVEAQKLIGISLEGSVG 505


>gi|315122394|ref|YP_004062883.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313495796|gb|ADR52395.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 489

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 437/489 (89%), Positives = 473/489 (96%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M+AV++T+D+VR I+VDQYKYGFETNI+V+++P+GLNED+IRFISAKKNEP+WMLEWRL 
Sbjct: 1   MIAVQKTIDQVRDIEVDQYKYGFETNIEVERSPRGLNEDVIRFISAKKNEPEWMLEWRLS 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWL MK+PSWAR+ YP IDF+ LYYY++PKS VGP+SLD+VDPELLR Y+KLGIP+ 
Sbjct: 61  AYRRWLKMKEPSWARVHYPPIDFNSLYYYSSPKSFVGPRSLDEVDPELLRMYDKLGIPLH 120

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE LAGVQTSKVAVDA+FDSVS+VTTFKEELKKSG+IFMPISEAI EH DLVKKYLS+V
Sbjct: 121 EQEALAGVQTSKVAVDAIFDSVSIVTTFKEELKKSGIIFMPISEAIHEHSDLVKKYLSSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DNFYAALNSAVFTDGSFVYIPKG+RCPMELSTYFRINE+ TGQFERTLIIADEGSY
Sbjct: 181 VPVADNFYAALNSAVFTDGSFVYIPKGIRCPMELSTYFRINERETGQFERTLIIADEGSY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+RDENQLHAAVVELVALD+AEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD
Sbjct: 241 VSYLEGCTAPKRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG+RSKISWTQLETGSAITWKYPSCLLRGE SCGEFYSIAISNGFQQIDSGTKMLHLAK
Sbjct: 301 CRGIRSKISWTQLETGSAITWKYPSCLLRGEYSCGEFYSIAISNGFQQIDSGTKMLHLAK 360

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NTTSRIVSKGISAGFSNNTYRGKVSVHRGA HSRNFTQCDSLLIGNNCGAHT+PYIE+KN
Sbjct: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGATHSRNFTQCDSLLIGNNCGAHTVPYIEAKN 420

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           SSCNLEHEATTSKISD+HLFYCLQRGIPEEAAIALI+NGFV+EVLQKLPMEFAVEAQKLI
Sbjct: 421 SSCNLEHEATTSKISDDHLFYCLQRGIPEEAAIALIINGFVKEVLQKLPMEFAVEAQKLI 480

Query: 481 DISLEGSVG 489
           DISLEGSVG
Sbjct: 481 DISLEGSVG 489


>gi|121602810|ref|YP_989100.1| cysteine desulfurase activator complex subunit SufB [Bartonella
           bacilliformis KC583]
 gi|120614987|gb|ABM45588.1| FeS assembly protein SufB [Bartonella bacilliformis KC583]
          Length = 503

 Score =  580 bits (1494), Expect = e-163,   Method: Composition-based stats.
 Identities = 399/503 (79%), Positives = 447/503 (88%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGFETNI++DKAPKGLNEDIIRFISAKK EP+WML WRL 
Sbjct: 1   MPAVQETIRQVREIDVDQYKYGFETNIEMDKAPKGLNEDIIRFISAKKGEPEWMLMWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A  RW TM++P+WARI+YP I+F DL YYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  ALHRWSTMEEPNWARIQYPKINFQDLCYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGVQ--------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV+              + +VAVDAVFDSVSVVTTFKEEL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVKKQTENSALDDNIYGSGRVAVDAVFDSVSVVTTFKEELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP L+K+YL TVVPV DN+YAALN+AVFTDGSFVYIPK VRCPMELSTYFRINE+ TG
Sbjct: 181 TEHPTLIKEYLGTVVPVSDNYYAALNAAVFTDGSFVYIPKDVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVELVAL NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADENSYVSYLEGCTAPQRDENQLHAAVVELVALKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGG+YNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG+ S GEFYSIAI+NG+
Sbjct: 301 GKGGVYNFVTKRGDCRGNHSKISWTQIETGSAITWKYPSCLLRGDNSSGEFYSIAIANGY 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL KNT+SRI+SKGISAGFSNNTYRG+V+ HR A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGKNTSSRIISKGISAGFSNNTYRGQVTAHRKAQNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           NCGAHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 NCGAHTVPYIEAKNATVQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|146340498|ref|YP_001205546.1| cysteine desulfurase activator complex subunit SufB [Bradyrhizobium
           sp. ORS278]
 gi|146193304|emb|CAL77320.1| transport protein associated with Fe-S cluster assembly, sufB
           [Bradyrhizobium sp. ORS278]
          Length = 498

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 383/498 (76%), Positives = 440/498 (88%), Gaps = 9/498 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+ED IRFIS KKNEP WMLEWRL 
Sbjct: 1   MPAVQETVDRVRRIDVDQYRYGFETVIESEKAPKGLSEDTIRFISGKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P+WAR+ YP IDF DLYYYAAPK      S+D++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMQEPTWARVDYPKIDFQDLYYYAAPKPKKQLSSIDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQ---------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           E  IL GV+         T K+AVDAVFDSVSV TTFKEELKK+GVIFMPISEAI E+P+
Sbjct: 121 EVAILEGVEPAPGAGSPETRKIAVDAVFDSVSVATTFKEELKKAGVIFMPISEAIREYPE 180

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LV+KYL +VVP  DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERT
Sbjct: 181 LVQKYLGSVVPTSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERT 240

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+G+YVSYLEGCTAPQRDENQLHAAVVELVA+D+AEIKYSTVQNWYPG+S+GKGGI
Sbjct: 241 LIIADKGAYVSYLEGCTAPQRDENQLHAAVVELVAMDDAEIKYSTVQNWYPGNSEGKGGI 300

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNGFQQ+DS
Sbjct: 301 YNFVTKRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGFQQVDS 360

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL KNT+SRI+SKGI+AG S NTYRG V+ HR A+ +RNFT CDSLLIG+ CGAH
Sbjct: 361 GTKMIHLGKNTSSRIISKGIAAGRSQNTYRGLVTAHRKASGARNFTACDSLLIGDKCGAH 420

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPME
Sbjct: 421 TVPYIEAKNSSATFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKDVLQQLPME 480

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQKLI ISLEGSVG
Sbjct: 481 FAVEAQKLISISLEGSVG 498


>gi|294083584|ref|YP_003550341.1| FeS assembly protein SufB [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663156|gb|ADE38257.1| FeS assembly protein SufB [Candidatus Puniceispirillum marinum
           IMCC1322]
          Length = 483

 Score =  579 bits (1493), Expect = e-163,   Method: Composition-based stats.
 Identities = 349/489 (71%), Positives = 416/489 (85%), Gaps = 6/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  +T++++      +YKYGF T+I+ DKAPKGLNEDIIRFISAKK+EP+WML WRL 
Sbjct: 1   MAATTQTIEQMEA-ATGKYKYGFVTDIESDKAPKGLNEDIIRFISAKKDEPEWMLAWRLK 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY++WLTM+ P WA++    ID+ D+YYY+APK     +SLD+VDPELL TYEKLGIP+ 
Sbjct: 60  AYKKWLTMESPDWAKLDIDPIDYQDVYYYSAPKDSEKLKSLDEVDPELLATYEKLGIPLN 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ++LAG     VAVDAVFDSVSV TTF+ EL K GVIF PISEAI ++PDLVKKY+ +V
Sbjct: 120 EQKMLAG-----VAVDAVFDSVSVATTFRGELAKVGVIFCPISEAIRDYPDLVKKYMGSV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DN+++ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLIIA++ SY
Sbjct: 175 VPVADNYFSALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTLIIAEDESY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVA+ +AEIKYSTVQNWYPGD  GKGGIYNFVTKRG 
Sbjct: 235 VSYLEGCTAPQRDENQLHAAVVELVAMQDAEIKYSTVQNWYPGDENGKGGIYNFVTKRGA 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+L+G++S GEFYS+A++N  QQ D+GTKM+H+ +
Sbjct: 295 CRGDRSKISWTQVETGSAITWKYPSCILQGKESVGEFYSVALTNNMQQADTGTKMIHIGE 354

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
            + S I+SKGISAG S N YRG V +  GA ++RNFTQCDSLL+G+ CGAHT+PYI S+N
Sbjct: 355 GSRSTIISKGISAGKSQNCYRGLVRMQPGAENARNFTQCDSLLVGDKCGAHTVPYIVSRN 414

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEATTS+IS++ LFYCLQRGI EE A++LIVNGF +EV+++LPMEFAVEAQKLI
Sbjct: 415 PSAKIEHEATTSRISEDQLFYCLQRGINEEDAVSLIVNGFCKEVMKELPMEFAVEAQKLI 474

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 475 GISLEGSVG 483


>gi|83858480|ref|ZP_00952002.1| hypothetical protein OA2633_03236 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853303|gb|EAP91155.1| hypothetical protein OA2633_03236 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 503

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 357/503 (70%), Positives = 423/503 (84%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET++ VR+++ D+YKYGF T I+ ++APKGL+ED +RFISAKK EP+W+LEWRL 
Sbjct: 1   MPAVKETIEDVRQLESDKYKYGFTTEIEQERAPKGLSEDTVRFISAKKGEPEWLLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A++RW  MK+P WA++ YP ID+ + YYYAAPK     +SLD+V  ELL TY+KLGIP++
Sbjct: 61  AFKRWTQMKEPDWAKVGYPPIDYQEAYYYAAPKDAAKYKSLDEVPQELLDTYKKLGIPLK 120

Query: 121 EQEILAGVQT--------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           E E+L GV+                KVAVDAVFDSVSV TTFKEELKK+GVIFMPISEA+
Sbjct: 121 EAEVLLGVEGAEASAAEARNEGSQRKVAVDAVFDSVSVATTFKEELKKAGVIFMPISEAV 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP+L+KKYL +VVPV DNF+A LNSAVF+DGSFVY+PKGVRCPMELSTYFRIN +GTG
Sbjct: 181 HEHPELIKKYLGSVVPVTDNFFATLNSAVFSDGSFVYVPKGVRCPMELSTYFRINAEGTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLI+ADEG+YVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNW+PGDS 
Sbjct: 241 QFERTLIVADEGAYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWWPGDSD 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGG+YNFVTKR DCRG  SK+SWTQ+ETGSAITWKYPSC+L+G+ S GEFYSIA++NG 
Sbjct: 301 GKGGVYNFVTKRADCRGRNSKVSWTQVETGSAITWKYPSCVLKGDNSQGEFYSIAVTNGR 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQ D+GTKM+HL +NT SRI+SKGISAG S+ TYRG VSVH  A  +RNFTQCDSLLIG+
Sbjct: 361 QQADTGTKMIHLGRNTKSRIISKGISAGKSDQTYRGLVSVHGKAEGARNFTQCDSLLIGD 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
            CGAHT+PYIE K     LEHEATTSK+S+E LFY  QRG+ EE+A+AL+VNGF REVLQ
Sbjct: 421 TCGAHTVPYIECKTPKATLEHEATTSKLSEEQLFYARQRGLDEESAVALLVNGFCREVLQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           +LPMEFAVEAQ L+ +SLEGSVG
Sbjct: 481 ELPMEFAVEAQALLKVSLEGSVG 503


>gi|170743214|ref|YP_001771869.1| FeS assembly protein SufB [Methylobacterium sp. 4-46]
 gi|168197488|gb|ACA19435.1| FeS assembly protein SufB [Methylobacterium sp. 4-46]
          Length = 489

 Score =  579 bits (1492), Expect = e-163,   Method: Composition-based stats.
 Identities = 384/490 (78%), Positives = 436/490 (88%), Gaps = 2/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR IDVDQYKYGFET I+++K+ KGL+ED+IRFISAKK EP+WMLEWRL 
Sbjct: 1   MPAVQETVDRVRAIDVDQYKYGFETTIEMEKSEKGLSEDVIRFISAKKQEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P WAR+ Y  ID+D+LYYYAAPK     QSLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMREPDWARVSYDRIDYDNLYYYAAPK-RKAAQSLDEIDPEILKTYEKLGIPLR 119

Query: 121 EQEILAGVQTSK-VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           E E L G+     VAVDAVFDSVSV TTFK EL K+GVIFMPISEA+ EHPDLV+KYL +
Sbjct: 120 EVEALEGIAPENRVAVDAVFDSVSVATTFKAELAKAGVIFMPISEALREHPDLVRKYLGS 179

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 180 VVPVTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGS 239

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RD+NQLHAAVVELVALD+AEIKYSTVQNWYPG++QG+GGIYNFVTKRG
Sbjct: 240 YVSYLEGCTAPRRDDNQLHAAVVELVALDDAEIKYSTVQNWYPGNAQGRGGIYNFVTKRG 299

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 300 DCRGANSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAVSNGMQQVDSGTKMIHLG 359

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG VS H+ A+++RNFT CDSLLIG+ CGAHT+PYIESK
Sbjct: 360 KNTTSRIISKGISAGRSQNTYRGLVSAHKKASNARNFTNCDSLLIGDQCGAHTVPYIESK 419

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKIS+E LFYC QRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 420 NASAVFEHEATTSKISEEQLFYCQQRGLGEEEARALIVNGFVRDVLQQLPMEFAVEAQKL 479

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 480 ISISLEGSVG 489


>gi|319408610|emb|CBI82265.1| ABC transporter subunit [Bartonella schoenbuchensis R1]
          Length = 503

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 394/503 (78%), Positives = 447/503 (88%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGF+TNI+ DKAPKGLNEDIIRFISAKKNEP+WML WRL 
Sbjct: 1   MPAVQETIRQVREIDVDQYKYGFKTNIKTDKAPKGLNEDIIRFISAKKNEPEWMLAWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RW TM++P WAR+ YP I+F + YYYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  AFHRWTTMEEPQWARVEYPKINFQEFYYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGVQ--------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV+              + +VAVDAVFDSVS+VTTFK+EL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVRKQADRSPLNDNIYGSGQVAVDAVFDSVSIVTTFKKELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP  +K+YL TVVP GDN+YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 IEHPAFIKEYLGTVVPAGDNYYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVELVAL NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADEDSYVSYLEGCTAPQRDENQLHAAVVELVALKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG+ S GEFYSIA++NG+
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCLLRGDNSRGEFYSIAVANGY 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL +NT+SRI+SKGISAGFSNNTYRG+V+ H+ A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGQNTSSRIISKGISAGFSNNTYRGQVTAHKKAQNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           NCGAHT+PYIE+KN++ + EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 NCGAHTVPYIEAKNATAHFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIAISLEGSVG 503


>gi|148255357|ref|YP_001239942.1| cysteine desulfurase activator complex subunit SufB [Bradyrhizobium
           sp. BTAi1]
 gi|146407530|gb|ABQ36036.1| Iron-regulated ABC transporter membrane component SufB
           [Bradyrhizobium sp. BTAi1]
          Length = 498

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 380/498 (76%), Positives = 436/498 (87%), Gaps = 9/498 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+ED IR+IS KKNEP WMLEWRL 
Sbjct: 1   MPAVQETVDRVRRIDVDQYRYGFETVIESEKAPKGLSEDTIRYISGKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP IDF DLYYY+APK      S+D++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVDYPKIDFQDLYYYSAPKPKKQLSSIDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQ---------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           E  IL GV+         T K+AVDAVFDSVSV TTFKEELKK+GVIFMPISEAI EHP+
Sbjct: 121 EVAILEGVEPKPGAGSPETRKIAVDAVFDSVSVATTFKEELKKAGVIFMPISEAIREHPE 180

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LV+KYL +VVP  DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERT
Sbjct: 181 LVQKYLGSVVPTSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERT 240

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+G+YVSYLEGCTAPQRDENQLHAAVVELVA D+AEIKYSTVQNWYPG+S+G GGI
Sbjct: 241 LIIADKGAYVSYLEGCTAPQRDENQLHAAVVELVAHDDAEIKYSTVQNWYPGNSEGVGGI 300

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DS
Sbjct: 301 YNFVTKRGDCRGNNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDS 360

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL KNT+SRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAH
Sbjct: 361 GTKMIHLGKNTSSRIISKGIAAGRSQNTYRGLVTAHRKATGARNFTACDSLLIGDRCGAH 420

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPME
Sbjct: 421 TVPYIEAKNSSATFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKDVLQQLPME 480

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQKLI ISLEGSVG
Sbjct: 481 FAVEAQKLISISLEGSVG 498


>gi|114569863|ref|YP_756543.1| cysteine desulfurase activator complex subunit SufB [Maricaulis
           maris MCS10]
 gi|114340325|gb|ABI65605.1| Iron-regulated ABC transporter membrane component SufB [Maricaulis
           maris MCS10]
          Length = 491

 Score =  578 bits (1491), Expect = e-163,   Method: Composition-based stats.
 Identities = 347/491 (70%), Positives = 413/491 (84%), Gaps = 2/491 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET++ VR ++ D+YKYGF T+I+ D APKGLNE+I+R ISAKK EP+WML+WRL 
Sbjct: 1   MAAVKETIEDVRNLEADKYKYGFTTDIEQDLAPKGLNEEIVRLISAKKGEPEWMLQWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A  R+  MK+P WA++ YP ID+ D++YYA PK      S+DDV  E+L  + KLGI ++
Sbjct: 61  ALERFKAMKEPEWAKVNYPKIDYQDIHYYAEPKDGAKYDSIDDVPEEILADFAKLGISLK 120

Query: 121 EQEILAGVQTSK--VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLS 178
           EQE+L GV+ S+  VAVDAVFDSVSVVTTFK EL K+GVIF  ISEA+ EHP+LV+KYL 
Sbjct: 121 EQEVLLGVKGSENRVAVDAVFDSVSVVTTFKAELAKAGVIFCSISEALREHPELVRKYLG 180

Query: 179 TVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEG 238
           +VVP  DNF+A LN+AVF+DGSFVY+P GVRCPMELSTYFR+N +GTGQFERTLIIAD+G
Sbjct: 181 SVVPASDNFFATLNTAVFSDGSFVYVPPGVRCPMELSTYFRMNAQGTGQFERTLIIADKG 240

Query: 239 SYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKR 298
           +YVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNW+PGD  GKGG+YNFVTKR
Sbjct: 241 AYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWWPGDENGKGGVYNFVTKR 300

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
           GDCRG  SKISWTQ+ETGSAITWKYPSC+LRGE S GEFYSIA++NG QQ D+GTKM+HL
Sbjct: 301 GDCRGRNSKISWTQVETGSAITWKYPSCILRGENSRGEFYSIAVTNGRQQADTGTKMIHL 360

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
            K +TSRI+SKGISAG S+ TYRG VSVH  A  +RNFTQCDSLLIG+ CGAHT+PY+E 
Sbjct: 361 GKGSTSRIISKGISAGRSDQTYRGLVSVHAKAEGARNFTQCDSLLIGDQCGAHTVPYVEC 420

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           K     LEHEATT+K+S++ LFY  QRG+ EEAA AL+VNGFVR+VLQ+LPMEFAVEAQ 
Sbjct: 421 KTPKAVLEHEATTTKLSEDQLFYARQRGLGEEAATALLVNGFVRDVLQQLPMEFAVEAQA 480

Query: 479 LIDISLEGSVG 489
           L+ +SLEGSVG
Sbjct: 481 LLKVSLEGSVG 491


>gi|182677100|ref|YP_001831246.1| FeS assembly protein SufB [Beijerinckia indica subsp. indica ATCC
           9039]
 gi|182632983|gb|ACB93757.1| FeS assembly protein SufB [Beijerinckia indica subsp. indica ATCC
           9039]
          Length = 506

 Score =  577 bits (1488), Expect = e-162,   Method: Composition-based stats.
 Identities = 376/506 (74%), Positives = 433/506 (85%), Gaps = 17/506 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A +ETVD+V+ IDV +YKYGF + I+ DKAPKGLNEDI+RFISAKKNEP W+ EWRL 
Sbjct: 1   MAAAKETVDQVKSIDVSEYKYGFFSEIEADKAPKGLNEDIVRFISAKKNEPAWLTEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P WAR+ +  +D+ DLYYY+APKS  GP+SLD+VDPELL+ YEKLGIP++
Sbjct: 61  AYRRWLTMREPEWARVNFAKVDYQDLYYYSAPKSAAGPKSLDEVDPELLKVYEKLGIPLK 120

Query: 121 EQEILAGVQT-----------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPIS 163
           EQ  LAGV                    K+AVDAVFDSVSVVTTF+EEL K+GVIF PIS
Sbjct: 121 EQAALAGVVAGENEMIDDEGNVVPMPERKIAVDAVFDSVSVVTTFREELAKAGVIFCPIS 180

Query: 164 EAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEK 223
           EA+  HP+LV+KYL +VVP  DNFYA LNSAVF+DGSFVYIP+GVRCPMELSTYFRINE+
Sbjct: 181 EAVHTHPELVQKYLGSVVPTTDNFYATLNSAVFSDGSFVYIPEGVRCPMELSTYFRINEQ 240

Query: 224 GTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPG 283
            TGQFERTLIIAD+GSYVSYLEGCTAP+RDENQLHAAVVEL+ALD+AEIKYSTVQNWYPG
Sbjct: 241 NTGQFERTLIIADKGSYVSYLEGCTAPKRDENQLHAAVVELIALDDAEIKYSTVQNWYPG 300

Query: 284 DSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAIS 343
           D+ GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAIS
Sbjct: 301 DADGKGGIYNFVTKRGDCRGANSKISWTQVETGSAVTWKYPSCVLRGDNSRGEFYSIAIS 360

Query: 344 NGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLL 403
           NG QQ+DSGTKM+HL KNTTSR++SKGISAG S NTYRG++S HR A  +RNFT CDSLL
Sbjct: 361 NGHQQVDSGTKMIHLGKNTTSRVISKGISAGHSQNTYRGQISSHRKATGARNFTNCDSLL 420

Query: 404 IGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVRE 463
           IGN+CGAHT+PY+ES+N S   EHEATTSKIS++ LFYC+QRG+  E A ALIVNGFVR+
Sbjct: 421 IGNSCGAHTVPYLESRNPSTQFEHEATTSKISEDQLFYCMQRGLSAEEATALIVNGFVRD 480

Query: 464 VLQKLPMEFAVEAQKLIDISLEGSVG 489
           VLQ+LPMEFAVEAQKLI +SLEGSVG
Sbjct: 481 VLQQLPMEFAVEAQKLIAVSLEGSVG 506


>gi|319784073|ref|YP_004143549.1| FeS assembly protein SufB [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317169961|gb|ADV13499.1| FeS assembly protein SufB [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 505

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 390/505 (77%), Positives = 447/505 (88%), Gaps = 16/505 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV++T+D+VRKIDVDQYKYGF+T I +DKAPKGL+EDIIRFISAKK+EP WMLEWRL 
Sbjct: 1   MPAVQDTIDRVRKIDVDQYKYGFQTEIAMDKAPKGLSEDIIRFISAKKDEPSWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLT+ +P+WAR+ YP IDF D+Y+YAAPKS  GP SL DVDPELL+ YEKLGIP+R
Sbjct: 61  AYRRWLTLDEPTWARVHYPKIDFQDIYFYAAPKSTPGPTSLSDVDPELLKVYEKLGIPLR 120

Query: 121 EQEILAGVQ----------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISE 164
           EQEILAGVQ                + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISE
Sbjct: 121 EQEILAGVQKTDASELEEVSDNVYKSGRVAVDAVFDSVSVVTTFKKELAQAGVIFCSISE 180

Query: 165 AICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKG 224
           AI EHP+LVKKYL +VVP  DN+YA LNSAVFTDGSFV++PKGVRCPMELSTYFR+NEK 
Sbjct: 181 AIREHPELVKKYLGSVVPTSDNYYATLNSAVFTDGSFVFVPKGVRCPMELSTYFRMNEKN 240

Query: 225 TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD 284
           TGQFERTLIIA+EG+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD
Sbjct: 241 TGQFERTLIIAEEGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGD 300

Query: 285 SQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISN 344
           ++GKGGIYNFVTKRGDCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SN
Sbjct: 301 AEGKGGIYNFVTKRGDCRGDRSKISWTQVETGSAITWKYPSCILRGDDSSGEFYSIAVSN 360

Query: 345 GFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLI 404
           G+QQ+DSGTKM+HL KNT+SRI+SKGI+AGFS NTYRG+VS HR A ++RNFT CDSLLI
Sbjct: 361 GYQQVDSGTKMIHLGKNTSSRIISKGIAAGFSQNTYRGQVSAHRKATNARNFTNCDSLLI 420

Query: 405 GNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREV 464
           G+ CGAHT+PY+E+KNS+   EHEATTSKIS++  FY +QRGIPEE AIALIVNGFV++V
Sbjct: 421 GDQCGAHTVPYMEAKNSTAQFEHEATTSKISEDQKFYVMQRGIPEEEAIALIVNGFVKDV 480

Query: 465 LQKLPMEFAVEAQKLIDISLEGSVG 489
           +Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 IQQLPMEFAVEAQKLIGISLEGSVG 505


>gi|115524974|ref|YP_781885.1| cysteine desulfurase activator complex subunit SufB
           [Rhodopseudomonas palustris BisA53]
 gi|115518921|gb|ABJ06905.1| Iron-regulated ABC transporter membrane component SufB
           [Rhodopseudomonas palustris BisA53]
          Length = 508

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 372/508 (73%), Positives = 433/508 (85%), Gaps = 19/508 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A +ETV++VR+IDVDQY+YGFET+I+ DKAPKGL+ED IRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAEQETVERVRRIDVDQYRYGFETDIESDKAPKGLSEDTIRFISAKKNEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WA++ YP ID+ DLYYY+APK      S D++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWAKVDYPKIDYQDLYYYSAPKKKPQLSSFDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGV-------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMP 161
           E  +L GV                      +VAVDAVFDSVSV TTF+ ELK++GVIFMP
Sbjct: 121 EVAVLEGVVAPEPKPTVDADGNEIEVLPQRRVAVDAVFDSVSVATTFQAELKRAGVIFMP 180

Query: 162 ISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRIN 221
           ISEA+ EHPDLV+KYL TVVP  DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRIN
Sbjct: 181 ISEALREHPDLVRKYLGTVVPTSDNYFATLNSAVFSDGSFVYVPPGVRCPMELSTYFRIN 240

Query: 222 EKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWY 281
           E+ TGQFERTLIIAD+G+YVSYLEGCTAPQRDENQLHAAVVELV  D+AEIKYSTVQNWY
Sbjct: 241 ERNTGQFERTLIIADKGAYVSYLEGCTAPQRDENQLHAAVVELVTHDDAEIKYSTVQNWY 300

Query: 282 PGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIA 341
           PG+S+G GGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA
Sbjct: 301 PGNSEGVGGIYNFVTKRGDCRGKNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIA 360

Query: 342 ISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDS 401
           ISNG+QQ+DSGTKM+HL KNTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDS
Sbjct: 361 ISNGYQQVDSGTKMIHLGKNTTSRIISKGIAAGKSQNTYRGLVTAHRKATGARNFTACDS 420

Query: 402 LLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFV 461
           LLIG+ CGAHT+PY+E+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV
Sbjct: 421 LLIGDQCGAHTVPYVEAKNSSALFEHEATTSKISEDVLFYCVQRGLNQEEAVGLVVNGFV 480

Query: 462 REVLQKLPMEFAVEAQKLIDISLEGSVG 489
           ++VLQ+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KDVLQQLPMEFAVEAQKLISISLEGSVG 508


>gi|188583646|ref|YP_001927091.1| FeS assembly protein SufB [Methylobacterium populi BJ001]
 gi|179347144|gb|ACB82556.1| FeS assembly protein SufB [Methylobacterium populi BJ001]
          Length = 489

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 381/490 (77%), Positives = 439/490 (89%), Gaps = 2/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR ID+DQYKYGFET I+++K+ KGL+ED+IRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDRVRSIDIDQYKYGFETVIEMEKSEKGLSEDVIRFISAKKNEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWLTMK+P WAR+ Y  +D++D+YYYAAPK   GP+SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYKRWLTMKEPEWARVDYDKVDYNDIYYYAAPK-RKGPESLDEIDPEILKTYEKLGIPLR 119

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           E E L G+    +VAVDAVFDSVSV TTFK+EL+K+GVIFMPISEAI E+PDLVK YL +
Sbjct: 120 EVEALEGIAPERRVAVDAVFDSVSVATTFKKELEKAGVIFMPISEAIREYPDLVKTYLGS 179

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 180 VVPVTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGS 239

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RD+NQLHAAVVELVAL++AEIKYSTVQNWYPGD++GKGGIYNFVTKRG
Sbjct: 240 YVSYLEGCTAPKRDDNQLHAAVVELVALEDAEIKYSTVQNWYPGDNEGKGGIYNFVTKRG 299

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 300 DCRGARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGMQQVDSGTKMIHLG 359

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG VS H+ A  +RNFT CDSLLIG+ CGAHT+PYIESK
Sbjct: 360 KNTTSRIISKGISAGRSQNTYRGLVSAHKKAKGARNFTNCDSLLIGDQCGAHTVPYIESK 419

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKIS++  FYC QRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 420 NASAVFEHEATTSKISEDQKFYCQQRGLSEEEATALIVNGFVRDVLQQLPMEFAVEAQKL 479

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 480 ISISLEGSVG 489


>gi|319404266|emb|CBI77859.1| ABC transporter subunit [Bartonella rochalimae ATCC BAA-1498]
          Length = 503

 Score =  577 bits (1487), Expect = e-162,   Method: Composition-based stats.
 Identities = 393/503 (78%), Positives = 442/503 (87%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +V +IDVDQYKYGFETNI+VDKAPKGLNEDIIRFISAKK EP+WML WRL 
Sbjct: 1   MPAVQETIRQVSEIDVDQYKYGFETNIEVDKAPKGLNEDIIRFISAKKCEPEWMLTWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW  M+ P WARI+YP I+F +LYYYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  AFRRWSKMEVPRWARIKYPKINFQELYYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGV--------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV               + +VAVDAVFDSVSVVTTFKEEL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVKKQADLSTSDDNIYASGQVAVDAVFDSVSVVTTFKEELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP  +++YL  VVP GDN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 TEHPAFIQEYLGAVVPAGDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVEL+AL NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADEDSYVSYLEGCTAPQRDENQLHAAVVELIALKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG  S GEFYSIA++NG 
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQIETGSAITWKYPSCLLRGNNSRGEFYSIAVANGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL +NT+SRI+SKGISAGFSNNTYRG+V+ H+ A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGENTSSRIISKGISAGFSNNTYRGQVTAHKKAKNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCGAHTVPYIEAKNATAQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|116626727|ref|YP_828883.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Solibacter usitatus Ellin6076]
 gi|116229889|gb|ABJ88598.1| Iron-regulated ABC transporter membrane component SufB [Candidatus
           Solibacter usitatus Ellin6076]
          Length = 482

 Score =  577 bits (1486), Expect = e-162,   Method: Composition-based stats.
 Identities = 331/487 (67%), Positives = 407/487 (83%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ + +      +YK+GF T+I+ D  P+GLNED++R ISAKKNEP+W+LEWRL AYR
Sbjct: 1   MSDSTNTIETFANQEYKWGFVTDIEADAIPRGLNEDVVRLISAKKNEPEWLLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLT+K+P WA + YP ID+ D+ YY++PK+   GP+SLD+VDPELL+TYEKLGIP++E+
Sbjct: 61  HWLTLKEPDWANVHYPKIDYQDIIYYSSPKAKADGPKSLDEVDPELLKTYEKLGIPLQER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
            ILAG     VAVDAVFDSVSV TTFKE+LK+ G+IF   SEA+ EHP+LV++YL +VVP
Sbjct: 121 AILAG-----VAVDAVFDSVSVATTFKEKLKEQGIIFGSFSEAVQEHPELVRQYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+AALNSAVF+DGSF YIPKGV+CPMELSTYFRIN K TGQFERTLI+ADEG+ VS
Sbjct: 176 TSDNFFAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINAKDTGQFERTLIVADEGATVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RD NQLHAAVVELVALDNA+IKYSTVQNWYPGD  GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDTNQLHAAVVELVALDNAQIKYSTVQNWYPGDKDGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G+ SKISWTQ+ETGSAITWKYPSCLL G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT
Sbjct: 296 GVNSKISWTQVETGSAITWKYPSCLLIGDNSVGEFYSVALTNNWQQADTGTKMIHIGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           TS IVSKGISAG   NTYRG V + + A  +RN++QCDSLL+G+ CGAHT PY+E +N+S
Sbjct: 356 TSTIVSKGISAGHGQNTYRGGVKILKSATGARNYSQCDSLLLGDKCGAHTFPYLEVRNTS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKI ++ +FYC QRGI  E A+++IV+GF +EV ++LPMEFAVEAQKL+ +
Sbjct: 416 AQVEHEASTSKIGEDQIFYCRQRGISTEDAVSMIVHGFCKEVFRELPMEFAVEAQKLLGV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|91976928|ref|YP_569587.1| cysteine desulfurase activator complex subunit SufB
           [Rhodopseudomonas palustris BisB5]
 gi|91683384|gb|ABE39686.1| Iron-regulated ABC transporter membrane component SufB
           [Rhodopseudomonas palustris BisB5]
          Length = 493

 Score =  577 bits (1486), Expect = e-162,   Method: Composition-based stats.
 Identities = 378/493 (76%), Positives = 435/493 (88%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ DKAPKGL+EDI+RFISAKKNEPDWML+WRL 
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETLIESDKAPKGLSEDIVRFISAKKNEPDWMLQWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP IDF DLYYY+APK      SLD++DPE+L TY+KLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVNYPKIDFQDLYYYSAPKPKKTIGSLDEIDPEILETYKKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           E E+L GV       ++AVDAVFDSVSV TTF+ ELKK+GVIFMPISEAI +HP+LV+KY
Sbjct: 121 EVEVLEGVVRPEGERRIAVDAVFDSVSVATTFQAELKKAGVIFMPISEAIKQHPELVQKY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L TVVP  DN+YA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERTLIIAD
Sbjct: 181 LGTVVPTTDNYYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAPQRDENQLHAAVVELV  D+AEIKYSTVQNWYPG+S+GKGGIYNFVT
Sbjct: 241 KGSYVSYLEGCTAPQRDENQLHAAVVELVTHDDAEIKYSTVQNWYPGNSEGKGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DSGTKM+
Sbjct: 301 KRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDSGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL  NTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAHT+PYI
Sbjct: 361 HLGNNTTSRIISKGIAAGRSQNTYRGLVTAHRKAKGARNFTACDSLLIGDQCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN+S   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPMEFAVEA
Sbjct: 421 EAKNTSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVKDVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|146342292|ref|YP_001207340.1| cysteine desulfurase activator complex subunit SufB [Bradyrhizobium
           sp. ORS278]
 gi|146195098|emb|CAL79123.1| transport protein associated with Fe-S cluster assembly
           [Bradyrhizobium sp. ORS278]
          Length = 505

 Score =  577 bits (1486), Expect = e-162,   Method: Composition-based stats.
 Identities = 382/505 (75%), Positives = 438/505 (86%), Gaps = 16/505 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+ IDVDQY+YGFET I+ +KAPKGL+ED IRFISAKKNEP WMLEWRL 
Sbjct: 1   MAAVQETIDRVKGIDVDQYRYGFETQIESEKAPKGLSEDTIRFISAKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP ID+ DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVGYPKIDYQDLYYYSAPKPKKKVASLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQTSKVA----------------VDAVFDSVSVVTTFKEELKKSGVIFMPISE 164
           E E+L GV+   VA                VDAVFDSVSV TTFKEELKK+GVIFMPISE
Sbjct: 121 EVELLEGVERPTVAAESEDGEAAAPRTKIAVDAVFDSVSVATTFKEELKKAGVIFMPISE 180

Query: 165 AICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKG 224
           A+ EHPDLV+KYL TVVP  DN++A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ 
Sbjct: 181 ALREHPDLVQKYLGTVVPTTDNYFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERN 240

Query: 225 TGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD 284
           TGQFERTLIIAD+G+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPG+
Sbjct: 241 TGQFERTLIIADKGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGN 300

Query: 285 SQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISN 344
           S+G GGIYNFVTKRGDCRG+ SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISN
Sbjct: 301 SEGVGGIYNFVTKRGDCRGVNSKISWTQVETGSAITWKYPSCILRGDNSSGEFYSIAISN 360

Query: 345 GFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLI 404
           GFQQ+DSGTKM+HL KNT+SRI+SKGI+AG S NTYRG VS HR A+ +RNFT CDSLLI
Sbjct: 361 GFQQVDSGTKMIHLGKNTSSRIISKGIAAGKSQNTYRGLVSAHRKASGARNFTACDSLLI 420

Query: 405 GNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREV 464
           G+ CGAHT+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++V
Sbjct: 421 GDKCGAHTVPYIEAKNSSAVFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKDV 480

Query: 465 LQKLPMEFAVEAQKLIDISLEGSVG 489
           LQ+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 LQQLPMEFAVEAQKLISISLEGSVG 505


>gi|316934380|ref|YP_004109362.1| FeS assembly protein SufB [Rhodopseudomonas palustris DX-1]
 gi|315602094|gb|ADU44629.1| FeS assembly protein SufB [Rhodopseudomonas palustris DX-1]
          Length = 498

 Score =  576 bits (1485), Expect = e-162,   Method: Composition-based stats.
 Identities = 381/498 (76%), Positives = 439/498 (88%), Gaps = 9/498 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+EDI+RFISAKKNEPDWML+WR  
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETLIESEKAPKGLSEDIVRFISAKKNEPDWMLQWRQE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP IDF DLYYYAAPK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVSYPKIDFQDLYYYAAPKPKKTIGSLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQ---------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           E  +L GV+         + K+AVDAVFDSVSV TTF+ ELKK+GVIFMPISEAI +HP+
Sbjct: 121 EVALLEGVEPAPGGPDTPSRKIAVDAVFDSVSVATTFQAELKKAGVIFMPISEAIRQHPE 180

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LV+KYL +VVP  DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERT
Sbjct: 181 LVQKYLGSVVPTSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERT 240

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+GSYVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPG+S+GKGGI
Sbjct: 241 LIIADKGSYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGNSEGKGGI 300

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DS
Sbjct: 301 YNFVTKRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDS 360

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL KNTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAH
Sbjct: 361 GTKMIHLGKNTTSRIISKGIAAGKSQNTYRGLVTAHRKATGARNFTACDSLLIGDQCGAH 420

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE+KN+S   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPME
Sbjct: 421 TVPYIEAKNASALFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKDVLQQLPME 480

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQKLI ISLEGSVG
Sbjct: 481 FAVEAQKLISISLEGSVG 498


>gi|85716315|ref|ZP_01047288.1| FeS assembly protein SufB [Nitrobacter sp. Nb-311A]
 gi|85696831|gb|EAQ34716.1| FeS assembly protein SufB [Nitrobacter sp. Nb-311A]
          Length = 493

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 385/493 (78%), Positives = 440/493 (89%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+ED IRFISAKKNEP+WMLEWRL 
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETIIESEKAPKGLSEDTIRFISAKKNEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P+WAR+ YP ID+ DLYYYAAPK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMQEPTWARVDYPKIDYQDLYYYAAPKPKKEISSLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           E E L GV       KVAVDAVFDSVSV TTF+EELKK+GVIFMPIS AI +HP+LVK+Y
Sbjct: 121 EVEALEGVVRPEGERKVAVDAVFDSVSVATTFQEELKKAGVIFMPISHAIQQHPELVKQY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DNF+A LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERTLIIAD
Sbjct: 181 LGSVVPTSDNFFATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPG+S+GKGGIYNFVT
Sbjct: 241 KGSYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGNSEGKGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DSGTKML
Sbjct: 301 KRGDCRGAHSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDSGTKML 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNTTSRI+SKGI+AG S NTYRG V+ HR AA++RNFT CDSLLIG+ CGAHT+PYI
Sbjct: 361 HLGKNTTSRIISKGIAAGKSQNTYRGLVTAHRKAANARNFTACDSLLIGDKCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN+S   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFVR+VLQ+LPMEFAVEA
Sbjct: 421 EAKNTSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVRDVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|319407272|emb|CBI80911.1| ABC transporter subunit [Bartonella sp. 1-1C]
          Length = 503

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 393/503 (78%), Positives = 441/503 (87%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +V +IDVDQYKYGFETNI+VDKAPKGLNEDIIRFISAKK EP+WML WRL 
Sbjct: 1   MPAVQETIRQVSEIDVDQYKYGFETNIEVDKAPKGLNEDIIRFISAKKCEPEWMLTWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW  M+ P WARI+YP I+F +LYYYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  AFRRWSKMEIPRWARIKYPKINFQELYYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGV--------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV               + +VAVDAVFDSVSVVTTFKEEL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVKKQTDLSTSDDNIYASGQVAVDAVFDSVSVVTTFKEELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP  +++YL  VVP GDN+YAALN+AVFTDGSFVYIPKGV CPMELSTYFRINE+ TG
Sbjct: 181 IEHPAFIQEYLGAVVPAGDNYYAALNAAVFTDGSFVYIPKGVHCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVEL+AL NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADEDSYVSYLEGCTAPQRDENQLHAAVVELIALKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG  S GEFYSIA++NG 
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQIETGSAITWKYPSCLLRGNNSRGEFYSIAVANGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL +NT+SRI+SKGISAGFSNNTYRG+V+ H+ A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGENTSSRIISKGISAGFSNNTYRGQVTAHKKAKNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHTIPYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCGAHTIPYIEAKNATAQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|27379450|ref|NP_770979.1| cysteine desulfurase activator complex subunit SufB [Bradyrhizobium
           japonicum USDA 110]
 gi|27352601|dbj|BAC49604.1| blr4339 [Bradyrhizobium japonicum USDA 110]
          Length = 498

 Score =  576 bits (1484), Expect = e-162,   Method: Composition-based stats.
 Identities = 378/498 (75%), Positives = 436/498 (87%), Gaps = 9/498 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETV++V++IDVDQY+YGFET I+ DKAPKGL+E+ ++FIS KKNEP WML+WRL 
Sbjct: 1   MPAVQETVERVKRIDVDQYRYGFETLIESDKAPKGLSEETVKFISEKKNEPAWMLQWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP IDF DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVDYPKIDFQDLYYYSAPKPKKSITSLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT---------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           E  +L GV+           K+AVDAVFDSVSV TTFK ELKK+GVIFMPISEAI EHP+
Sbjct: 121 EVAMLEGVEPKVGEEDPARRKIAVDAVFDSVSVATTFKAELKKAGVIFMPISEAIREHPE 180

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LV+KYL +VVP  DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERT
Sbjct: 181 LVQKYLGSVVPTSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERT 240

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+GSYVSYLEGCTAPQRDENQLHAAVVELVA D+AEIKYSTVQNWYPG+S+GKGGI
Sbjct: 241 LIIADKGSYVSYLEGCTAPQRDENQLHAAVVELVAHDDAEIKYSTVQNWYPGNSEGKGGI 300

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRGDCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNGFQQ+DS
Sbjct: 301 YNFVTKRGDCRGDRSKISWTQVETGSAITWKYPSCILRGDNSSGEFYSIAISNGFQQVDS 360

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL KNT+SRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAH
Sbjct: 361 GTKMIHLGKNTSSRIISKGIAAGKSQNTYRGLVTAHRKATGARNFTACDSLLIGDKCGAH 420

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPME
Sbjct: 421 TVPYIEAKNSSATFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKDVLQQLPME 480

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQKLI ISLEGSVG
Sbjct: 481 FAVEAQKLISISLEGSVG 498


>gi|312115584|ref|YP_004013180.1| FeS assembly protein SufB [Rhodomicrobium vannielii ATCC 17100]
 gi|311220713|gb|ADP72081.1| FeS assembly protein SufB [Rhodomicrobium vannielii ATCC 17100]
          Length = 493

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 373/493 (75%), Positives = 438/493 (88%), Gaps = 5/493 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
           +A ++T+++V +IDVD+YKYGF T+I+  +APKGL+ED +RFISAKK EP+W+LEWRL A
Sbjct: 1   MAEQDTIERVSEIDVDKYKYGFTTDIESVRAPKGLSEDTVRFISAKKGEPEWLLEWRLEA 60

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           YRRW ++++P+WAR+ Y  ID+DDLYYY+APKS  GP+SL DVDPELLRTYEKLGIP+RE
Sbjct: 61  YRRWRSIEEPTWARVHYQKIDYDDLYYYSAPKSAEGPKSLADVDPELLRTYEKLGIPLRE 120

Query: 122 QEILAGVQT-----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           Q +LAGV+       +VAVDAVFDSVSVVTTFKEEL ++GVIF PISEA+ +HP+LV+KY
Sbjct: 121 QAVLAGVEGAEVTAPRVAVDAVFDSVSVVTTFKEELGRAGVIFCPISEAVRDHPELVRKY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DN++A LNSAV++DGSFVY+P+GVRCPMELSTYFRINEK TGQFERTLIIAD
Sbjct: 181 LGSVVPTSDNYFATLNSAVYSDGSFVYVPEGVRCPMELSTYFRINEKNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAP RDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGD +GKGGIYNFVT
Sbjct: 241 KGSYVSYLEGCTAPMRDENQLHAAVVELIALDDAEIKYSTVQNWYPGDKEGKGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG QQ+DSGTKM+
Sbjct: 301 KRGDCRGRNSKISWTQVETGSAITWKYPSCILRGDGSRGEFYSIAISNGRQQVDSGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNT+SRI+SKGISAG S+NTYRG VS HR A ++RNFTQCDSLLIG+ CGAHTIPYI
Sbjct: 361 HLGKNTSSRIISKGISAGRSDNTYRGLVSAHRRATNARNFTQCDSLLIGDQCGAHTIPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN++   EHEATTSKISD+ LFYCLQRG+ +E A+ALIVNGFVR+VLQ+LPMEF  E 
Sbjct: 421 EAKNATAQFEHEATTSKISDDQLFYCLQRGLSQEEAVALIVNGFVRDVLQQLPMEFLAET 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|75675856|ref|YP_318277.1| cysteine desulfurase activator complex subunit SufB [Nitrobacter
           winogradskyi Nb-255]
 gi|74420726|gb|ABA04925.1| Iron-regulated ABC transporter membrane component SufB [Nitrobacter
           winogradskyi Nb-255]
          Length = 493

 Score =  575 bits (1483), Expect = e-162,   Method: Composition-based stats.
 Identities = 381/493 (77%), Positives = 438/493 (88%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+ED IRFISAKKNEP WMLEWRL 
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETIIESEKAPKGLSEDTIRFISAKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++P+WAR+ YP ID+ DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMQEPTWARVDYPKIDYQDLYYYSAPKPKKEIASLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           E E+L GV       KVAVDAVFDSVSV TTF+EELKK+GVIFMPIS AI +HP+LVK+Y
Sbjct: 121 EVEVLEGVVRPEGERKVAVDAVFDSVSVATTFQEELKKAGVIFMPISHAIQQHPELVKQY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DNF+A LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERTLIIAD
Sbjct: 181 LGSVVPTSDNFFATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAPQRDENQLHAAVVELV LD+AEIKYSTVQNWYPG+S+GKGGI+NFVT
Sbjct: 241 KGSYVSYLEGCTAPQRDENQLHAAVVELVTLDDAEIKYSTVQNWYPGNSEGKGGIFNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DSGTKML
Sbjct: 301 KRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDSGTKML 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNTTSRI+SKGI+AG S NTYRG V+ HR A ++RNFT CDSLLIG+ CGAHT+PYI
Sbjct: 361 HLGKNTTSRIISKGIAAGKSQNTYRGLVTAHRKATNARNFTACDSLLIGDKCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN+S   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFVR+VLQ+LPMEFAVEA
Sbjct: 421 EAKNTSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVRDVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|154253700|ref|YP_001414524.1| FeS assembly protein SufB [Parvibaculum lavamentivorans DS-1]
 gi|154157650|gb|ABS64867.1| FeS assembly protein SufB [Parvibaculum lavamentivorans DS-1]
          Length = 482

 Score =  575 bits (1482), Expect = e-162,   Method: Composition-based stats.
 Identities = 368/489 (75%), Positives = 427/489 (87%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AVRETV+ V ++  ++YKYGF T+I+ +KAP GL ED +R+ISAKKNEP+W+LEWRL 
Sbjct: 1   MAAVRETVETVGEV--EKYKYGFFTDIESEKAPLGLTEDTVRYISAKKNEPEWLLEWRLA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRWLTM +P+WA++ YP IDF D YYY+APK +    SLD VDP+LL TY KLGIP+ 
Sbjct: 59  AFRRWLTMTEPTWAKVTYPPIDFQDAYYYSAPKQMAKLDSLDQVDPKLLETYAKLGIPLT 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ++LAG+     AVDAVFDSVSVVTTFKE+L + GVIF P+SEA+ +HP+LVKKYL +V
Sbjct: 119 EQKMLAGI-----AVDAVFDSVSVVTTFKEKLAEVGVIFCPMSEAVQKHPELVKKYLGSV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP+ DNFYA LNSAVF++GSFVYIP+GVRCPMELSTYFRINEK TGQFERTLIIAD+GSY
Sbjct: 174 VPISDNFYATLNSAVFSEGSFVYIPEGVRCPMELSTYFRINEKQTGQFERTLIIADKGSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVELVA D+AEIKYSTVQNW+PGD +GKGG+YNFVTKRGD
Sbjct: 234 VSYLEGCTAPQRDENQLHAAVVELVAHDDAEIKYSTVQNWFPGDEEGKGGVYNFVTKRGD 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG QQ+DSGTKM+HL +
Sbjct: 294 CRGTNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGRQQVDSGTKMIHLGR 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NTTSRI+SKGI+AG S+NTYRG VSVHR A   RNFTQCDSLLIG+ C AHT+PYIE+KN
Sbjct: 354 NTTSRIISKGIAAGHSSNTYRGLVSVHRKAEDVRNFTQCDSLLIGDRCSAHTVPYIETKN 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  LEHEATTSKISD+ LFYC+QRGI EE A+ALIVNGF R+VLQ+LPMEFAVEAQKL+
Sbjct: 414 PTALLEHEATTSKISDDQLFYCMQRGIGEEEAVALIVNGFCRDVLQQLPMEFAVEAQKLV 473

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 474 GISLEGSVG 482


>gi|148257193|ref|YP_001241778.1| cysteine desulfurase activator complex subunit SufB [Bradyrhizobium
           sp. BTAi1]
 gi|146409366|gb|ABQ37872.1| Iron-regulated ABC transporter membrane component SufB
           [Bradyrhizobium sp. BTAi1]
          Length = 506

 Score =  575 bits (1481), Expect = e-162,   Method: Composition-based stats.
 Identities = 383/506 (75%), Positives = 439/506 (86%), Gaps = 17/506 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+V+ IDVDQY+YGFET I+ +KAPKGL+ED IRFISAKKNEP WMLEWRL 
Sbjct: 1   MAAVQETIDRVKGIDVDQYRYGFETVIESEKAPKGLSEDTIRFISAKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +P+WAR+ YP ID+ DLYYYAAPK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPTWARVGYPKIDYQDLYYYAAPKPKKKVASLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT-----------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPIS 163
           E E+L GV+                  SK+AVDAVFDSVSV TTFKEELKK+GVIFMPIS
Sbjct: 121 EVELLEGVERPAAAAETDADGEAAAPRSKIAVDAVFDSVSVATTFKEELKKAGVIFMPIS 180

Query: 164 EAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEK 223
           EA+ EHPDLV+KYL TVVP  DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+
Sbjct: 181 EALREHPDLVQKYLGTVVPTTDNYFATLNSAVFSDGSFVYVPSGVRCPMELSTYFRINER 240

Query: 224 GTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPG 283
            TGQFERTLIIAD+G+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPG
Sbjct: 241 NTGQFERTLIIADKGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPG 300

Query: 284 DSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAIS 343
           +S+G GGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAIS
Sbjct: 301 NSEGVGGIYNFVTKRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSSGEFYSIAIS 360

Query: 344 NGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLL 403
           NGFQQ+DSGTKM+HL KNT+SRI+SKGI+AG S NTYRG VS HR A+ +RNFT CDSLL
Sbjct: 361 NGFQQVDSGTKMIHLGKNTSSRIISKGIAAGKSQNTYRGLVSAHRKASGARNFTACDSLL 420

Query: 404 IGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVRE 463
           IG+ CGAHT+PYIE+KNSS   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++
Sbjct: 421 IGDKCGAHTVPYIEAKNSSAVFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKD 480

Query: 464 VLQKLPMEFAVEAQKLIDISLEGSVG 489
           VLQ+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 VLQQLPMEFAVEAQKLISISLEGSVG 506


>gi|304391537|ref|ZP_07373479.1| FeS assembly protein SufB [Ahrensia sp. R2A130]
 gi|303295766|gb|EFL90124.1| FeS assembly protein SufB [Ahrensia sp. R2A130]
          Length = 512

 Score =  575 bits (1481), Expect = e-162,   Method: Composition-based stats.
 Identities = 382/512 (74%), Positives = 441/512 (86%), Gaps = 23/512 (4%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           MVAV+ET+D V+ +++DQYKYGF T+I+ DKAP GLNED IRFISAKK+EP WML+WRL 
Sbjct: 1   MVAVQETIDTVKTLEIDQYKYGFSTDIESDKAPIGLNEDTIRFISAKKDEPQWMLDWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPK-SIVGPQSLDDVDPELLRTYEKLGIPI 119
           A+ RW TM +P WAR+ Y  ID+ D+YYYAAPK    GP+SLD+VDPELLRTYEKLGIP+
Sbjct: 61  AFERWKTMTEPDWARVEYDKIDYQDIYYYAAPKNFAEGPKSLDEVDPELLRTYEKLGIPL 120

Query: 120 REQEILAGV----------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGV 157
           REQE+L+GV                      ++ +VAVDAVFDSVSVVTTFK EL K+GV
Sbjct: 121 REQEVLSGVAATKAALAAEDDREEDLGDNIYKSGRVAVDAVFDSVSVVTTFKAELAKAGV 180

Query: 158 IFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTY 217
           IF  +SEAI +HP+LVKKYL+TVVPV DN++A LN AVFTDGSFVY+PKGVRCPMELSTY
Sbjct: 181 IFCSMSEAIKDHPELVKKYLATVVPVSDNYFATLNCAVFTDGSFVYVPKGVRCPMELSTY 240

Query: 218 FRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTV 277
           FRINE+ TGQFERTLIIA+EGSYVSYLEGCTAPQRDENQLHAAVVEL+A+D+AEIKYSTV
Sbjct: 241 FRINEENTGQFERTLIIAEEGSYVSYLEGCTAPQRDENQLHAAVVELIAMDDAEIKYSTV 300

Query: 278 QNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEF 337
           QNWYPGD  GKGGIYNFVTKR DCRG  SK+SWTQ+ETGSA+TWKYPSC+LRG+ S GEF
Sbjct: 301 QNWYPGDENGKGGIYNFVTKRADCRGKNSKVSWTQVETGSAVTWKYPSCILRGDGSQGEF 360

Query: 338 YSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFT 397
           YSIA+SNG QQ+DSGTKMLH+ KNTTSRI+SKGISAG S+NTYRG+V+V R A+ +RNFT
Sbjct: 361 YSIAVSNGMQQVDSGTKMLHIGKNTTSRIISKGISAGRSSNTYRGQVNVGRRASDARNFT 420

Query: 398 QCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIV 457
           QCDSLLIG+ CGAHT+PYIE+K++S  LEHEATTSKISD+ LFYCLQRGIPEE AIALIV
Sbjct: 421 QCDSLLIGDRCGAHTVPYIETKSASAQLEHEATTSKISDDQLFYCLQRGIPEEEAIALIV 480

Query: 458 NGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           NGFV+EV+Q+LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 NGFVKEVIQELPMEFAVEAQKLIGISLEGSVG 512


>gi|170747128|ref|YP_001753388.1| FeS assembly protein SufB [Methylobacterium radiotolerans JCM 2831]
 gi|170653650|gb|ACB22705.1| FeS assembly protein SufB [Methylobacterium radiotolerans JCM 2831]
          Length = 489

 Score =  574 bits (1480), Expect = e-161,   Method: Composition-based stats.
 Identities = 382/490 (77%), Positives = 439/490 (89%), Gaps = 2/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR ID+DQYKYGFET I+++K+ KG++ED++RFISAKKNEP W+LEWRL 
Sbjct: 1   MPAVQETIDRVRSIDLDQYKYGFETTIEMEKSEKGISEDVVRFISAKKNEPAWLLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTMK+P WAR+ Y  +D++D+YYYAAPK   GP+SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMKEPEWARVSYDKVDYNDIYYYAAPK-RQGPESLDEIDPEILKTYEKLGIPLR 119

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           E E+L G+    +VAVDAVFDSVSV TTFK+EL+K+GVIFMPISEA+ EHP+LVKKYL +
Sbjct: 120 EVEVLEGIAPERRVAVDAVFDSVSVATTFKKELEKAGVIFMPISEAVREHPELVKKYLGS 179

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 180 VVPVTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGS 239

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RD+NQLHAAVVELVALD+AEIKYSTVQNWYPGD+ GKGGIYNFVTKRG
Sbjct: 240 YVSYLEGCTAPKRDDNQLHAAVVELVALDDAEIKYSTVQNWYPGDNDGKGGIYNFVTKRG 299

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 300 DCRGARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGMQQVDSGTKMIHLG 359

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG VS HR A  +RNFT CDSLLIG+ CGAHT+PYIESK
Sbjct: 360 KNTTSRIISKGISAGRSQNTYRGLVSAHRKAKGARNFTNCDSLLIGDQCGAHTVPYIESK 419

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKIS+E  FYC QRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 420 NASAVFEHEATTSKISEEQKFYCQQRGLSEEEATALIVNGFVRDVLQQLPMEFAVEAQKL 479

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 480 ISISLEGSVG 489


>gi|39935530|ref|NP_947806.1| cysteine desulfurase activator complex subunit SufB
           [Rhodopseudomonas palustris CGA009]
 gi|192291121|ref|YP_001991726.1| cysteine desulfurase activator complex subunit SufB
           [Rhodopseudomonas palustris TIE-1]
 gi|39649383|emb|CAE27905.1| sufB, needed for fhuF Fe-S center stability [Rhodopseudomonas
           palustris CGA009]
 gi|192284870|gb|ACF01251.1| FeS assembly protein SufB [Rhodopseudomonas palustris TIE-1]
          Length = 493

 Score =  573 bits (1478), Expect = e-161,   Method: Composition-based stats.
 Identities = 382/493 (77%), Positives = 437/493 (88%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+EDI+RFISAKKNEPDWML+WRL 
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETLIESEKAPKGLSEDIVRFISAKKNEPDWMLQWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM +PSWAR+ YP IDF DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMTEPSWARVSYPKIDFQDLYYYSAPKPKKQVGSLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           E E+L GV       K+AVDAVFDSVSV TTF+ ELKK+GVIFMPISEAI  HP+LV+KY
Sbjct: 121 EVEVLEGVVRPEGERKIAVDAVFDSVSVATTFQAELKKAGVIFMPISEAIKHHPELVQKY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERTLIIAD
Sbjct: 181 LGSVVPTSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINERNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPG+S+GKGGIYNFVT
Sbjct: 241 KGSYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGNSEGKGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DSGTKM+
Sbjct: 301 KRGDCRGANSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDSGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL  NTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGAHT+PYI
Sbjct: 361 HLGSNTTSRIISKGIAAGKSQNTYRGLVTAHRKAKGARNFTACDSLLIGDQCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN+S   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFV++VLQ+LPMEFAVEA
Sbjct: 421 EAKNASTLFEHEATTSKISEDVLFYCIQRGLSQEEAVGLVVNGFVKDVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|319898939|ref|YP_004159032.1| ABC transporter subunit [Bartonella clarridgeiae 73]
 gi|319402903|emb|CBI76454.1| ABC transporter subunit [Bartonella clarridgeiae 73]
          Length = 503

 Score =  573 bits (1477), Expect = e-161,   Method: Composition-based stats.
 Identities = 386/503 (76%), Positives = 441/503 (87%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGFETNI++DKAPKGLNEDIIRFISAKK EP+WML WRL 
Sbjct: 1   MPAVQETIRQVREIDVDQYKYGFETNIEMDKAPKGLNEDIIRFISAKKCEPEWMLTWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RW TM+ P WARI+YP I+F +LYYYAAPK+  GP+SLD+VDPELL TYEKLGIP++
Sbjct: 61  AFHRWSTMEIPHWARIKYPKINFQELYYYAAPKNHTGPKSLDEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGV--------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV               + +VAVDAVFDSVS+VTTFKEEL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVKKQTDLSTSDDNIYASGRVAVDAVFDSVSIVTTFKEELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP  +++YL  VVP GDN+YAALN+AVFTDGSFVYIPKGVRCPMELS YFRINE+ TG
Sbjct: 181 IEHPAFIQEYLGAVVPAGDNYYAALNAAVFTDGSFVYIPKGVRCPMELSAYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVEL++L NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADENSYVSYLEGCTAPQRDENQLHAAVVELISLKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG  S GEFYSIA++NG 
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQIETGSAITWKYPSCLLRGNNSRGEFYSIAVANGH 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL +NT+SRI+SKGISAGFS+NTYRG+V+ H+ A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGENTSSRIISKGISAGFSSNTYRGQVTAHKKAKNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +C AHT+PYIE+KN++   EHEATTSKISD+ +FY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCSAHTVPYIEAKNATAQFEHEATTSKISDDQIFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           +LPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 QLPMEFAVEAQKLIGISLEGSVG 503


>gi|163853376|ref|YP_001641419.1| FeS assembly protein SufB [Methylobacterium extorquens PA1]
 gi|240140791|ref|YP_002965271.1| FeS assembly protein SufB [Methylobacterium extorquens AM1]
 gi|254563302|ref|YP_003070397.1| FeS assembly protein SufB [Methylobacterium extorquens DM4]
 gi|163664981|gb|ABY32348.1| FeS assembly protein SufB [Methylobacterium extorquens PA1]
 gi|240010768|gb|ACS41994.1| FeS assembly protein SufB [Methylobacterium extorquens AM1]
 gi|254270580|emb|CAX26583.1| FeS assembly protein SufB [Methylobacterium extorquens DM4]
          Length = 489

 Score =  573 bits (1476), Expect = e-161,   Method: Composition-based stats.
 Identities = 380/490 (77%), Positives = 442/490 (90%), Gaps = 2/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR ID+DQYKYGFET I+++K+ KGL+ED++RFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDRVRSIDLDQYKYGFETVIEMEKSEKGLSEDVVRFISAKKNEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWLTMK+P WAR+ Y  +D++++YYYAAPK   GP+SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYKRWLTMKEPEWARVEYDRVDYNNIYYYAAPK-RKGPESLDEIDPEILKTYEKLGIPLR 119

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           E E+L G+    +VAVDAVFDSVSV TTF++EL+K+GVIFMPISEAI E+PDLVKKYL +
Sbjct: 120 EVEVLEGIAPERRVAVDAVFDSVSVATTFRKELEKAGVIFMPISEAIREYPDLVKKYLGS 179

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 180 VVPVTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGS 239

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RD+NQLHAAVVELVAL++AEIKYSTVQNWYPGD++GKGGIYNFVTKRG
Sbjct: 240 YVSYLEGCTAPKRDDNQLHAAVVELVALEDAEIKYSTVQNWYPGDNEGKGGIYNFVTKRG 299

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 300 DCRGARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGMQQVDSGTKMIHLG 359

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG VS H+ A  +RNFT CDSLLIG+ CGAHT+PYIESK
Sbjct: 360 KNTTSRIISKGISAGRSQNTYRGLVSAHKKAKGARNFTNCDSLLIGDQCGAHTVPYIESK 419

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKIS++  FYCLQRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 420 NASAVFEHEATTSKISEDQKFYCLQRGLSEEEATALIVNGFVRDVLQQLPMEFAVEAQKL 479

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 480 ISISLEGSVG 489


>gi|92117851|ref|YP_577580.1| cysteine desulfurase activator complex subunit SufB [Nitrobacter
           hamburgensis X14]
 gi|91800745|gb|ABE63120.1| Iron-regulated ABC transporter membrane component SufB [Nitrobacter
           hamburgensis X14]
          Length = 493

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 381/493 (77%), Positives = 441/493 (89%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KAPKGL+ED +RFISAKKNEP WMLEWRL 
Sbjct: 1   MAAVQETVDRVRQIDVDQYRYGFETLIESEKAPKGLSEDTVRFISAKKNEPAWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWLTM++PSWAR+ YP ID+ DLYYY+APK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYRRWLTMQEPSWARVNYPKIDYQDLYYYSAPKPKKEVASLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           E E+L GV       +VAVDAVFDSVSV TTF+EELKK+GVIFMPIS AI +HP+LVK+Y
Sbjct: 121 EVEVLEGVVRPEGERRVAVDAVFDSVSVATTFQEELKKAGVIFMPISHAIQQHPELVKQY 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DNF+A LNSAVF+DGSFVY+P GVRCPMELSTYFRINE+ TGQFERTLIIAD
Sbjct: 181 LGSVVPTSDNFFATLNSAVFSDGSFVYLPPGVRCPMELSTYFRINERNTGQFERTLIIAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPG+S+GKGGI+NFVT
Sbjct: 241 KGAYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGNSEGKGGIFNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KRGDCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+DSGTKML
Sbjct: 301 KRGDCRGARSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVDSGTKML 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNTTSRI+SKGI+AG S NTYRG V+ HR A+++RNFT CDSLLIG+ CGAHT+PYI
Sbjct: 361 HLGKNTTSRIISKGIAAGKSQNTYRGLVTAHRKASNARNFTACDSLLIGDQCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E+KN+S   EHEATTSKIS++ LFYC+QRG+ +E A+ L+VNGFVR+VLQ+LPMEFAVEA
Sbjct: 421 EAKNTSALFEHEATTSKISEDVLFYCVQRGLSQEEAVGLVVNGFVRDVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKLI ISLEGSVG
Sbjct: 481 QKLISISLEGSVG 493


>gi|329850524|ref|ZP_08265369.1| feS assembly protein SufB [Asticcacaulis biprosthecum C19]
 gi|328840839|gb|EGF90410.1| feS assembly protein SufB [Asticcacaulis biprosthecum C19]
          Length = 488

 Score =  572 bits (1475), Expect = e-161,   Method: Composition-based stats.
 Identities = 352/490 (71%), Positives = 427/490 (87%), Gaps = 3/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D V K++   Y++GF T+I+++ APKGLN DI+RFISAKKNEP+WMLE RL 
Sbjct: 1   MAAVKETIDTVAKLET--YEHGFVTDIEMEFAPKGLNADIVRFISAKKNEPEWMLELRLA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RWLTM++P WA++ Y  +++ DLYYYAAPK  VGP+SLD++DPE+L+TYEKLGIP+R
Sbjct: 59  AFERWLTMEEPDWAKVNYTRVNYQDLYYYAAPKKKVGPKSLDEIDPEILKTYEKLGIPLR 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ +LAGV+   K AVDAVFDSVSV+TTFK+ELKK GVIF  ISEA+ EHP+LV++YL T
Sbjct: 119 EQMVLAGVEGAPKYAVDAVFDSVSVITTFKDELKKYGVIFCSISEALREHPELVRQYLGT 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALN+AVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIAD+G+
Sbjct: 179 VVPVSDNYFAALNAAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIADKGA 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVEL+ALD+A IKYSTVQNWYPGD++GKGGIYNFVTKR 
Sbjct: 239 YVSYLEGCTAPQRDENQLHAAVVELIALDDANIKYSTVQNWYPGDAEGKGGIYNFVTKRA 298

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+SWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIA++NG QQ D+GTKM+HL 
Sbjct: 299 DCRGARSKVSWTQVETGSAVTWKYPSCILRGDDSVGEFYSIAVTNGAQQADTGTKMIHLG 358

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRI+SKG+SAG S+NTYRG VS H  A  +RNFTQCDSLLIG  C AHT+PY+ES 
Sbjct: 359 KNTRSRIISKGVSAGRSSNTYRGLVSAHAKATGARNFTQCDSLLIGKTCAAHTVPYVESD 418

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
            +    EHEATT+++S++ LFY +QRG+ +E A+AL+VNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 419 TAKAQFEHEATTTRLSEDQLFYAMQRGLSQEEAVALLVNGFVRDVLQELPMEFAVEAQKL 478

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 479 VAISLEGSVG 488


>gi|218532233|ref|YP_002423049.1| FeS assembly protein SufB [Methylobacterium chloromethanicum CM4]
 gi|218524536|gb|ACK85121.1| FeS assembly protein SufB [Methylobacterium chloromethanicum CM4]
          Length = 489

 Score =  572 bits (1474), Expect = e-161,   Method: Composition-based stats.
 Identities = 380/490 (77%), Positives = 443/490 (90%), Gaps = 2/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR ID+DQYKYGFET I+++K+ KGL+ED++RFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDRVRSIDLDQYKYGFETVIEMEKSEKGLSEDVVRFISAKKNEPEWMLEWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWLTMK+P WAR+ Y  +D++++YYYAAPK   GP+SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AYKRWLTMKEPEWARVEYDRVDYNNIYYYAAPK-RKGPESLDEIDPEILKTYEKLGIPLR 119

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           E E+L G+    +VAVDAVFDSVSV TTF++EL+K+GVIFMPISEAI E+PDLVKKYL +
Sbjct: 120 EVEVLEGIAPERRVAVDAVFDSVSVATTFRKELEKAGVIFMPISEAIREYPDLVKKYLGS 179

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GS
Sbjct: 180 VVPVTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGS 239

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RD+NQLHAAVVELVAL++AEIKYSTVQNWYPGD++GKGGIYNFVTKRG
Sbjct: 240 YVSYLEGCTAPKRDDNQLHAAVVELVALEDAEIKYSTVQNWYPGDNEGKGGIYNFVTKRG 299

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL 
Sbjct: 300 DCRGARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGMQQVDSGTKMIHLG 359

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTSRI+SKGISAG S NTYRG VS H+ A ++RNFT CDSLLIG+ CGAHT+PYIESK
Sbjct: 360 KNTTSRIISKGISAGRSQNTYRGLVSAHKKAKNARNFTNCDSLLIGDQCGAHTVPYIESK 419

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S   EHEATTSKIS++  FYCLQRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKL
Sbjct: 420 NASAVFEHEATTSKISEDQKFYCLQRGLSEEEATALIVNGFVRDVLQQLPMEFAVEAQKL 479

Query: 480 IDISLEGSVG 489
           I ISLEGSVG
Sbjct: 480 ISISLEGSVG 489


>gi|209885127|ref|YP_002288984.1| FeS assembly protein SufB [Oligotropha carboxidovorans OM5]
 gi|209873323|gb|ACI93119.1| FeS assembly protein SufB [Oligotropha carboxidovorans OM5]
          Length = 499

 Score =  572 bits (1473), Expect = e-161,   Method: Composition-based stats.
 Identities = 380/499 (76%), Positives = 434/499 (86%), Gaps = 10/499 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETVD+VR+IDVDQY+YGFET I+ +KA +GL ED IRFISAKK+EPDWML+WRL 
Sbjct: 1   MPAVQETVDRVRQIDVDQYRYGFETQIESEKAARGLTEDTIRFISAKKDEPDWMLQWRLD 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW TM++P+WAR+ YP ID+  LYYYAAPK      SLD++DPE+L+TYEKLGIP+R
Sbjct: 61  AFRRWQTMEEPTWARVDYPKIDYQSLYYYAAPKQKKAIASLDEIDPEILKTYEKLGIPLR 120

Query: 121 EQEILAGV----------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
           E EIL GV             +VAVDAVFDSVSV TTF+ ELKK+GVIFMPIS AI EHP
Sbjct: 121 EVEILEGVVRKDEEGNEVAERRVAVDAVFDSVSVATTFQAELKKAGVIFMPISHAIREHP 180

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LVKKYL +VVP  DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRINEK TGQFER
Sbjct: 181 ELVKKYLGSVVPTSDNYFATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINEKNTGQFER 240

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLIIAD+GSYVSYLEGCTAPQRDENQLHAAVVEL+A D+AEIKYSTVQNWYPGDS+GKGG
Sbjct: 241 TLIIADKGSYVSYLEGCTAPQRDENQLHAAVVELIAHDDAEIKYSTVQNWYPGDSEGKGG 300

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAISNG+QQ+D
Sbjct: 301 IYNFVTKRGDCRGKNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAISNGYQQVD 360

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           SGTKM+HL KNTTSRI+SKGI+AG S NTYRG V+ HR A  +RNFT CDSLLIG+ CGA
Sbjct: 361 SGTKMIHLGKNTTSRIISKGIAAGVSQNTYRGLVTAHRKATGARNFTACDSLLIGDRCGA 420

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT+PYIESKNSS   EHEATTSKIS++ LFYC+QRG+ +E A+AL+VNGFVR+VLQ+LPM
Sbjct: 421 HTVPYIESKNSSTQFEHEATTSKISEDMLFYCVQRGLSQEEAVALVVNGFVRDVLQQLPM 480

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFAVEAQKLI ISLEGSVG
Sbjct: 481 EFAVEAQKLISISLEGSVG 499


>gi|16126107|ref|NP_420671.1| cysteine desulfurase activator complex subunit SufB [Caulobacter
           crescentus CB15]
 gi|221234877|ref|YP_002517313.1| cysteine desulfurase activator complex subunit SufB [Caulobacter
           crescentus NA1000]
 gi|13423307|gb|AAK23839.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964049|gb|ACL95405.1| ABC transporter-associated protein sufB [Caulobacter crescentus
           NA1000]
          Length = 489

 Score =  571 bits (1472), Expect = e-161,   Method: Composition-based stats.
 Identities = 351/491 (71%), Positives = 419/491 (85%), Gaps = 4/491 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETV+ V  +  ++Y++GF T+I  + APKGL+EDI+RFISAKK+EP+WMLEWRL 
Sbjct: 1   MAAVKETVETVAAL--EKYEHGFTTDIDQEFAPKGLSEDIVRFISAKKDEPEWMLEWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWL M +P WA++ YP ID+ D YYYAAPK+  GP+SLD+VDPELL  YEKLGIP++
Sbjct: 59  AYRRWLAMDEPDWAKVSYPPIDYQDTYYYAAPKTKEGPKSLDEVDPELLAVYEKLGIPLK 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ +LAGV+   + AVDAVFDSVSVVTTFK+EL ++GVIF  +SEA+ EHP+LV++YL +
Sbjct: 119 EQAVLAGVEGAPRYAVDAVFDSVSVVTTFKKELAQAGVIFCSMSEAVREHPELVRQYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRIN K +GQFERTLIIAD+G+
Sbjct: 179 VVPTSDNYFACLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAKDSGQFERTLIIADKGA 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD-SQGKGGIYNFVTKR 298
           YVSYLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD   GKGGIYNFVTKR
Sbjct: 239 YVSYLEGCTAPMRDENQLHAAVVELVLLDDAEIKYSTVQNWYPGDPETGKGGIYNFVTKR 298

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
            DCRG RSK+SWTQ+ETGSAITWKYPSC+LRGE S GEFYSIA++NG QQ D+GTKM+HL
Sbjct: 299 ADCRGDRSKVSWTQVETGSAITWKYPSCVLRGEGSSGEFYSIAVTNGHQQADTGTKMIHL 358

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
             NT SRIV+KGISAG S +TYRG VS H  A  +RNFTQCDSLLIG +C AHT+PYIE+
Sbjct: 359 GANTRSRIVAKGISAGKSTSTYRGLVSAHPKAKGARNFTQCDSLLIGKDCAAHTVPYIEA 418

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           +N     EHEATT+++SD+ LFYC QRG+ EE ++AL+VNGFV++VLQ+LPMEFAVEAQK
Sbjct: 419 RNGQSVFEHEATTTRLSDDQLFYCQQRGLSEEESVALLVNGFVKDVLQQLPMEFAVEAQK 478

Query: 479 LIDISLEGSVG 489
           L+ ISLEGSVG
Sbjct: 479 LVAISLEGSVG 489


>gi|254420611|ref|ZP_05034335.1| FeS assembly protein SufB [Brevundimonas sp. BAL3]
 gi|196186788|gb|EDX81764.1| FeS assembly protein SufB [Brevundimonas sp. BAL3]
          Length = 488

 Score =  571 bits (1471), Expect = e-160,   Method: Composition-based stats.
 Identities = 351/490 (71%), Positives = 424/490 (86%), Gaps = 3/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D V  +  ++Y +GF ++I+ + AP+GLN DI+RFIS KK EP+WMLEWRL 
Sbjct: 1   MAAVKETIDAVAAL--EKYAHGFTSDIEQEFAPRGLNADIVRFISEKKGEPEWMLEWRLA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWL M++P+WA ++Y  +D+ DL+YYAAPK   GP+SLD+VDPE+L  Y+KLGIP++
Sbjct: 59  AYERWLAMEEPTWAAVKYEPVDYQDLFYYAAPKQKEGPKSLDEVDPEILEIYKKLGIPLK 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQE+LAGVQ   +VAVDAVFDSVSVVTTFKEEL K GVIFMPISEA+ E+P+LV++YL +
Sbjct: 119 EQEVLAGVQGAPRVAVDAVFDSVSVVTTFKEELAKVGVIFMPISEALREYPELVRQYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALNSAVF+DGSFVYIP GVRCPMELSTYFRIN   TGQFERTLIIAD+GS
Sbjct: 179 VVPVSDNYFAALNSAVFSDGSFVYIPPGVRCPMELSTYFRINASQTGQFERTLIIADKGS 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           Y SYLEGCTAP RDENQLHAAVVE+VALD+AE+KYSTVQNWYPGD++GKGGIYNFVTKR 
Sbjct: 239 YCSYLEGCTAPMRDENQLHAAVVEIVALDDAEVKYSTVQNWYPGDAEGKGGIYNFVTKRA 298

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+SWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIAI+NG QQ D+GTKM+HL 
Sbjct: 299 DCRGDRSKVSWTQVETGSAVTWKYPSCILKGDDSSGEFYSIAITNGCQQADTGTKMIHLG 358

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRI++K +SAG S++TYRG VSVH  A   RNFTQCDSLLIG  CG+HTIPYIE++
Sbjct: 359 KNTKSRIIAKAVSAGKSDSTYRGLVSVHPKATGVRNFTQCDSLLIGKECGSHTIPYIEAR 418

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  LEHEATT+++SD+ +FY  QRG+ +E A+AL+VNGFVR+V+QKLPMEFAVEAQKL
Sbjct: 419 NGSAQLEHEATTTRLSDDQMFYAQQRGLSQEEAVALLVNGFVRDVMQKLPMEFAVEAQKL 478

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 479 VAISLEGSVG 488


>gi|308806552|ref|XP_003080587.1| ABC transporter subunit (ISS) [Ostreococcus tauri]
 gi|116059048|emb|CAL54755.1| ABC transporter subunit (ISS) [Ostreococcus tauri]
          Length = 960

 Score =  570 bits (1470), Expect = e-160,   Method: Composition-based stats.
 Identities = 303/488 (62%), Positives = 383/488 (78%), Gaps = 5/488 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
            A  E VD+++++    YK+GF T I+ +  P GL+ED++R ISAKKNEPDWML++RL A
Sbjct: 478 SAKEEEVDRIQEMLNKPYKWGFSTTIETETIPAGLSEDVVRMISAKKNEPDWMLDFRLKA 537

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           +R+WLTM++P W+   YP ID+  + YY+APKS+   +SLD+VDPELL T++KLGIP+ E
Sbjct: 538 FRKWLTMEEPDWSDNSYPQIDYQGVSYYSAPKSMEKKKSLDEVDPELLATFDKLGIPLNE 597

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q+ L     + VAVDAVFDSVS+ TTFKE+L K+GVIF  ISEA+ ++P+LVKK+L +VV
Sbjct: 598 QKRL-----TNVAVDAVFDSVSIGTTFKEDLLKAGVIFCSISEAVHDYPELVKKHLGSVV 652

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
           PV DN++ ALNSAVF+DGSFVYIPKGV  PMELSTYFRIN +  GQFERTLI+A++ SYV
Sbjct: 653 PVADNYFTALNSAVFSDGSFVYIPKGVVSPMELSTYFRINAESAGQFERTLIVAEDDSYV 712

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP  D+NQLHAAVVE+ A  NAE+KYSTVQNWY GD  GKGGIYNFVTKRG C
Sbjct: 713 SYLEGCTAPAYDDNQLHAAVVEISAGKNAEVKYSTVQNWYAGDENGKGGIYNFVTKRGLC 772

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G  SKISWTQ+ETGS+ITWKYPS +L G+ S GEF+S+A++N  QQ D+GTKM+H+ KN
Sbjct: 773 KGDNSKISWTQVETGSSITWKYPSVVLAGDNSIGEFFSVALTNNAQQADTGTKMIHIGKN 832

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T SRIVSKGISAG S N YRG V V   A  +RN++QCDS+LIG+  GA+T PYI+ K  
Sbjct: 833 TRSRIVSKGISAGKSKNVYRGLVQVGPNAVGARNYSQCDSMLIGDKAGANTYPYIQVKEP 892

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           S  +EHEA+TSKI ++ LFY  QRGI  E A+ +I++GF  EV  +LP+EFA E  +L+ 
Sbjct: 893 SARVEHEASTSKIGEDQLFYFQQRGIDPEEAVGVIISGFCSEVFNELPLEFAAEVNQLMS 952

Query: 482 ISLEGSVG 489
           + LEGSVG
Sbjct: 953 LKLEGSVG 960


>gi|295689540|ref|YP_003593233.1| FeS assembly protein SufB [Caulobacter segnis ATCC 21756]
 gi|295431443|gb|ADG10615.1| FeS assembly protein SufB [Caulobacter segnis ATCC 21756]
          Length = 489

 Score =  570 bits (1470), Expect = e-160,   Method: Composition-based stats.
 Identities = 351/491 (71%), Positives = 416/491 (84%), Gaps = 4/491 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ETV+ V  +  ++Y++GF T I  + APKGL+EDI+RFISAKK+EP WMLEWRL 
Sbjct: 1   MAAVKETVETVAAL--EKYEHGFTTEIDQEFAPKGLSEDIVRFISAKKDEPAWMLEWRLD 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWL M +P WA++ YP ID+ D YYYAAPK+  GP+SLD+VDPELL  YEKLGIP++
Sbjct: 59  AYRRWLAMDEPDWAKVSYPPIDYQDTYYYAAPKTKEGPKSLDEVDPELLAVYEKLGIPLK 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ +LAGV+   + AVDAVFDSVSVVTTFK+EL ++GVIF  +SEAI EHP+LV++YL +
Sbjct: 119 EQAVLAGVEGAPRYAVDAVFDSVSVVTTFKKELAQAGVIFCSMSEAIREHPELVRQYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRIN K +GQFERTLIIAD+ +
Sbjct: 179 VVPTSDNYFACLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAKDSGQFERTLIIADKAA 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD-SQGKGGIYNFVTKR 298
           YVSYLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD   GKGGIYNFVTKR
Sbjct: 239 YVSYLEGCTAPMRDENQLHAAVVELVLLDDAEIKYSTVQNWYPGDPETGKGGIYNFVTKR 298

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
            DCRG RSK+SWTQ+ETGSAITWKYPSC+LRGE S GEFYSIA++NG QQ D+GTKM+HL
Sbjct: 299 ADCRGDRSKVSWTQVETGSAITWKYPSCVLRGEGSSGEFYSIAVTNGHQQADTGTKMIHL 358

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
             NT SRIV+KGISAG S +TYRG VS H  A  +RNFTQCDSLLIG +C AHT+PYIE+
Sbjct: 359 GANTRSRIVAKGISAGKSTSTYRGLVSAHPKAKGARNFTQCDSLLIGKDCAAHTVPYIEA 418

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           +N     EHEATT+++SD+ LFYC QRG+ +E A+AL+VNGFV++VLQ+LPMEFAVEAQK
Sbjct: 419 RNGQSVFEHEATTTRLSDDQLFYCQQRGLSQEEAVALLVNGFVKDVLQQLPMEFAVEAQK 478

Query: 479 LIDISLEGSVG 489
           L+ ISLEGSVG
Sbjct: 479 LVAISLEGSVG 489


>gi|126462855|ref|YP_001043969.1| cysteine desulfurase activator complex subunit SufB [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332558884|ref|ZP_08413206.1| cysteine desulfurase activator complex subunit SufB [Rhodobacter
           sphaeroides WS8N]
 gi|126104519|gb|ABN77197.1| Iron-regulated ABC transporter membrane component SufB [Rhodobacter
           sphaeroides ATCC 17029]
 gi|332276596|gb|EGJ21911.1| cysteine desulfurase activator complex subunit SufB [Rhodobacter
           sphaeroides WS8N]
          Length = 509

 Score =  570 bits (1469), Expect = e-160,   Method: Composition-based stats.
 Identities = 347/493 (70%), Positives = 415/493 (84%), Gaps = 9/493 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RET++ V+ +   +YKYG+ET I++D APKGLNEDI+R ISAK +EP+WM EWRL AYRR
Sbjct: 18  RETIETVQAM-AGKYKYGWETEIEMDFAPKGLNEDIVRLISAKNDEPEWMTEWRLQAYRR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL M++P WA + YP ID+ D+YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 77  WLQMEEPRWAMLDYPEIDYQDIYYYAKPKSMDVKPKSLDEVDPKLLETYKKLGIPLKEQA 136

Query: 124 ILAGVQT-------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           +LAGV+         +VAVDAVFDSVSV TTF++EL K+GVIF  ISEA+ EHP+LVKKY
Sbjct: 137 LLAGVEGAEVPDAPRQVAVDAVFDSVSVGTTFQKELAKAGVIFCSISEAVREHPELVKKY 196

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DN++A LNSAVF+DGSFVYIP G RCPMELSTYFRIN + TGQFERTLIIAD
Sbjct: 197 LGSVVPQSDNYFATLNSAVFSDGSFVYIPPGTRCPMELSTYFRINAENTGQFERTLIIAD 256

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAP+RD NQLHAAVVE+V L++AE+KYSTVQNWYPGD +G+GGIYNFVT
Sbjct: 257 KGAYVSYLEGCTAPKRDTNQLHAAVVEIVVLEDAEVKYSTVQNWYPGDEEGRGGIYNFVT 316

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KR DCRG RSK+ WTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM+
Sbjct: 317 KRADCRGARSKVMWTQVETGSAITWKYPSCILRGDDSQGEFYSIAIANNAQQADTGTKMI 376

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PYI
Sbjct: 377 HLGKNTRSRIVSKGISAGRAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHTVPYI 436

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEFA+EA
Sbjct: 437 EVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLQALPMEFAMEA 496

Query: 477 QKLIDISLEGSVG 489
           Q L+ ISLEGSVG
Sbjct: 497 QALVAISLEGSVG 509


>gi|148555826|ref|YP_001263408.1| cysteine desulfurase activator complex subunit SufB [Sphingomonas
           wittichii RW1]
 gi|148501016|gb|ABQ69270.1| Iron-regulated ABC transporter membrane component SufB
           [Sphingomonas wittichii RW1]
          Length = 490

 Score =  570 bits (1468), Expect = e-160,   Method: Composition-based stats.
 Identities = 338/490 (68%), Positives = 404/490 (82%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M  VR             Y++GF T+I+ D APKGL+E+ +RFISAKK EP+WML+WRL 
Sbjct: 1   MSDVRNKAAFDAAARASNYEWGFTTDIEQDFAPKGLSEETVRFISAKKGEPEWMLDWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WLTM  P WA++  P ID+ D YYYA PK+     SLD+VDPE+L+ YEKLGIPI 
Sbjct: 61  AYRHWLTMTPPDWAKLDVPPIDYQDAYYYAEPKAKKALGSLDEVDPEILKVYEKLGIPIE 120

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ++LAGV+   KVAVDAVFDSVSV TTF+ EL+K+GVIF  ISEAI ++P+LV+K+L  
Sbjct: 121 EQKVLAGVEGARKVAVDAVFDSVSVATTFRAELEKAGVIFRSISEAIRDYPELVRKWLGK 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP+ DN++AALN AVF+DG+FVYIP+GVRCPMELSTYFRIN + TGQFERTLI+AD+GS
Sbjct: 181 VVPMHDNYFAALNCAVFSDGTFVYIPEGVRCPMELSTYFRINAENTGQFERTLIVADKGS 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           +VSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD++G+GGIYNFVTKR 
Sbjct: 241 HVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDAEGRGGIYNFVTKRA 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G  SK+SWTQ+ETGSAITWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM+HL 
Sbjct: 301 LCQGRNSKVSWTQVETGSAITWKYPSCVLAGENSVGEFYSVAVTNNRQQADTGTKMIHLG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           K + S IVSKGISAG S+NTYRG V V   A  +RNFTQCDSLL+G+ CGAHT+PYIE K
Sbjct: 361 KGSRSTIVSKGISAGRSDNTYRGLVRVAPTAEGARNFTQCDSLLLGDRCGAHTVPYIEVK 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  +EHEATTSKISD+ LFY + RG+ +EA++ALIVNGF +EVLQ+LPMEFAVEAQKL
Sbjct: 421 NPSAQIEHEATTSKISDDQLFYAMSRGLDQEASVALIVNGFAKEVLQQLPMEFAVEAQKL 480

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 481 LGISLEGSVG 490


>gi|221639872|ref|YP_002526134.1| cysteine desulfurase activator complex subunit SufB [Rhodobacter
           sphaeroides KD131]
 gi|221160653|gb|ACM01633.1| Iron-regulated ABC transporter membrane component SufB [Rhodobacter
           sphaeroides KD131]
          Length = 509

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 347/493 (70%), Positives = 416/493 (84%), Gaps = 9/493 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RET++ V+ +   +YKYG+ET I++D APKGLNEDI+R ISAK +EP+WM EWRL AYRR
Sbjct: 18  RETIETVQAM-AGKYKYGWETEIEMDFAPKGLNEDIVRLISAKNDEPEWMTEWRLQAYRR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL M++P WA + YP ID+ D+YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 77  WLQMEEPRWAMLDYPEIDYQDIYYYAKPKSMDVKPKSLDEVDPKLLETYKKLGIPLKEQA 136

Query: 124 ILAGVQT-------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           +LAGV+         +VAVDAVFDSVSV TTF++EL K+GVIF  ISEA+ EHP+LVKKY
Sbjct: 137 LLAGVEGAEVPDAPRQVAVDAVFDSVSVGTTFQKELAKAGVIFCSISEAVREHPELVKKY 196

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DN++A LNSAVF+DGSFVYIP+G RCPMELSTYFRIN + TGQFERTLIIAD
Sbjct: 197 LGSVVPQSDNYFATLNSAVFSDGSFVYIPRGTRCPMELSTYFRINAENTGQFERTLIIAD 256

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAP+RD NQLHAAVVE+V L++AE+KYSTVQNWYPGD +G+GGIYNFVT
Sbjct: 257 KGAYVSYLEGCTAPKRDTNQLHAAVVEIVVLEDAEVKYSTVQNWYPGDEEGRGGIYNFVT 316

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KR DCRG RSK+ WTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM+
Sbjct: 317 KRADCRGARSKVMWTQVETGSAITWKYPSCILRGDDSQGEFYSIAIANNAQQADTGTKMI 376

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PYI
Sbjct: 377 HLGKNTRSRIVSKGISAGRAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHTVPYI 436

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEFA+EA
Sbjct: 437 EVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLQALPMEFAMEA 496

Query: 477 QKLIDISLEGSVG 489
           Q L+ ISLEGSVG
Sbjct: 497 QALVAISLEGSVG 509


>gi|302383290|ref|YP_003819113.1| FeS assembly protein SufB [Brevundimonas subvibrioides ATCC 15264]
 gi|302193918|gb|ADL01490.1| FeS assembly protein SufB [Brevundimonas subvibrioides ATCC 15264]
          Length = 488

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 350/490 (71%), Positives = 421/490 (85%), Gaps = 3/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D V  +  ++Y++GF ++I+ + AP+GL+ DI+RFIS KK EP+WMLEWRL 
Sbjct: 1   MAAVQETIDAVAAL--EKYEHGFTSDIETEYAPRGLSADIVRFISEKKGEPEWMLEWRLA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWL M++P+WA ++Y  +D+  L+YYAAPK   GP+SLD+VDPE+L  Y KLGIP+ 
Sbjct: 59  AYERWLAMEEPTWASVKYEPVDYQSLFYYAAPKKKDGPKSLDEVDPEILAIYAKLGIPLG 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ +LAGV+   + AVDAVFDSVSVVTTFK EL K GVIFMPISEA+ E+PDLV++YL +
Sbjct: 119 EQAVLAGVEGAPRYAVDAVFDSVSVVTTFKAELAKVGVIFMPISEALREYPDLVRQYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALNSAVF+DGSFVYIP GVRCPMELSTYFRIN   TGQFERTLIIAD+GS
Sbjct: 179 VVPVSDNYFAALNSAVFSDGSFVYIPPGVRCPMELSTYFRINASQTGQFERTLIIADKGS 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD++GKGGIYNFVTKR 
Sbjct: 239 YVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDAEGKGGIYNFVTKRA 298

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+SWTQ+ETGSA+TWKYPSC+LRGE S GEFYSIAI+NG QQ D+GTKM+HL 
Sbjct: 299 DCRGDRSKVSWTQVETGSAVTWKYPSCVLRGEDSSGEFYSIAITNGHQQADTGTKMIHLG 358

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KN+ SRI++K +SAG S++TYRG VSVH  A   RNFTQCDSLLIG +CG+HT+PYIE++
Sbjct: 359 KNSKSRIIAKAVSAGKSDSTYRGLVSVHPKATGVRNFTQCDSLLIGGDCGSHTVPYIEAR 418

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  LEHEATT+++SD+ LFY  QRG+ +E A+AL+VNGFVR+V+QKLPMEFAVEAQKL
Sbjct: 419 NGSAQLEHEATTTRLSDDQLFYAQQRGLSQEEAVALLVNGFVRDVMQKLPMEFAVEAQKL 478

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 479 VAISLEGSVG 488


>gi|315499748|ref|YP_004088551.1| fes assembly protein sufb [Asticcacaulis excentricus CB 48]
 gi|315417760|gb|ADU14400.1| FeS assembly protein SufB [Asticcacaulis excentricus CB 48]
          Length = 488

 Score =  569 bits (1467), Expect = e-160,   Method: Composition-based stats.
 Identities = 350/490 (71%), Positives = 420/490 (85%), Gaps = 3/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET++ V+K++   Y +GF T+I+ + APKGLN DI+RFISAKKNEP WML++RL 
Sbjct: 1   MAAVKETIETVQKLET--YAHGFVTDIETEYAPKGLNADIVRFISAKKNEPQWMLDYRLA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RW +M +P WA++RY  +D+ DLYYYAAPK      SLD+VDPELL  Y KLGIP++
Sbjct: 59  AFERWQSMDEPDWAKVRYQKVDYQDLYYYAAPKPKPKLNSLDEVDPELLAVYAKLGIPLK 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQE+LAGV +  K AVDAVFDSVSVVTTFKEELKKSGVIF  ISEA+ EHP+LVK+YL +
Sbjct: 119 EQEVLAGVASAPKYAVDAVFDSVSVVTTFKEELKKSGVIFCSISEALREHPELVKEYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALN+AVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIAD+G+
Sbjct: 179 VVPVSDNYFAALNAAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIADKGA 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAAVVELVA+++A IKYSTVQNWYPGD++GKGGIYNFVTKR 
Sbjct: 239 YVSYLEGCTAPMRDENQLHAAVVELVAMEDASIKYSTVQNWYPGDAEGKGGIYNFVTKRA 298

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+SWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIA++NG QQ D+GTKM+HL 
Sbjct: 299 DCRGARSKVSWTQVETGSAVTWKYPSCILRGDDSVGEFYSIAVTNGMQQADTGTKMIHLG 358

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRI+SKG+SAG S+NTYRG VS H  A  +RNFTQCDSLLIG  C AHT+PY+ES 
Sbjct: 359 KNTRSRIISKGVSAGKSSNTYRGLVSAHAKAGGARNFTQCDSLLIGKTCAAHTVPYVESD 418

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
            +S   EHEATT+++S++ LFY +QRG+ +E A+AL+VNGFVREVLQ+LPMEFAVEAQKL
Sbjct: 419 TASAQFEHEATTTRLSEDQLFYAMQRGLSQEEAVALLVNGFVREVLQELPMEFAVEAQKL 478

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 479 LAISLEGSVG 488


>gi|153003771|ref|YP_001378096.1| cysteine desulfurase activator complex subunit SufB
           [Anaeromyxobacter sp. Fw109-5]
 gi|152027344|gb|ABS25112.1| FeS assembly protein SufB [Anaeromyxobacter sp. Fw109-5]
          Length = 479

 Score =  569 bits (1466), Expect = e-160,   Method: Composition-based stats.
 Identities = 326/483 (67%), Positives = 402/483 (83%), Gaps = 6/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T  ++ ++   +Y+YGF T+I+ D+ P+GL+EDI+R ISAKKNEP +MLEWRL AYR WL
Sbjct: 3   TAQQLHELTQQKYRYGFVTDIEADQLPRGLSEDIVRLISAKKNEPQFMLEWRLKAYRHWL 62

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + YP ID+ D+ YY+APK      S+D+VDPEL R +EKLGIP+ EQ+ LA
Sbjct: 63  TLEEPKWANVTYPPIDYQDIVYYSAPKQKKPLASMDEVDPELKRAFEKLGIPLAEQQRLA 122

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
           G     VAVDAVFDSVSV TT+K++L   GVIF   SEA+ EHP LV+K+L +VVP  DN
Sbjct: 123 G-----VAVDAVFDSVSVATTYKKKLADQGVIFCSFSEAVREHPALVEKWLGSVVPYSDN 177

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN K TGQFERTLI+ADEG+YVSYLEG
Sbjct: 178 YFAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAKDTGQFERTLIVADEGAYVSYLEG 237

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAPQRDENQLHAAVVELVALD A+IKYSTVQNWYPGD++GKGGIYNFVTKRG     ++
Sbjct: 238 CTAPQRDENQLHAAVVELVALDGAQIKYSTVQNWYPGDAEGKGGIYNFVTKRGKAM-RKA 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           KISWTQ+ETGSAITWKYPSC+L+G+ + GEFYS+A++N  QQ D+GTKM+H+ +NT S I
Sbjct: 297 KISWTQVETGSAITWKYPSCILQGDDAVGEFYSVALTNHRQQADTGTKMIHVGRNTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           +SKGISAG   NTYRG V + +GA  +RN++QCDSLLIG+ CGAHT PYIE +N S  +E
Sbjct: 357 ISKGISAGRGQNTYRGLVKMMKGAEGARNYSQCDSLLIGDRCGAHTFPYIEVRNPSAKVE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEATTSKIS++ LFYC QRGIP+E A+++IVNGF ++VL++LPMEFAVEAQKL+ +SLEG
Sbjct: 417 HEATTSKISEDQLFYCKQRGIPDEDAVSMIVNGFAKQVLKELPMEFAVEAQKLLGMSLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|319405707|emb|CBI79330.1| ABC transporter subunit [Bartonella sp. AR 15-3]
          Length = 503

 Score =  568 bits (1464), Expect = e-160,   Method: Composition-based stats.
 Identities = 387/503 (76%), Positives = 438/503 (87%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +VR+IDVDQYKYGFET I+ DKAPKGLNEDIIRFISAKK EP+WML WRL 
Sbjct: 1   MSAVQETIRQVREIDVDQYKYGFETKIETDKAPKGLNEDIIRFISAKKCEPEWMLTWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW  MK+P WARI YP I+F +LYYYAAPK+  GP+SL++VDPELL TYEKLGIP++
Sbjct: 61  AFRRWSKMKEPRWARIEYPKINFQELYYYAAPKNHTGPKSLNEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGVQ--------------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV                 KVAVDAVFDSVSVVTTFKEEL ++G+IF  ISEAI
Sbjct: 121 EQEILAGVTKQEDLSTRDDNMYAAGKVAVDAVFDSVSVVTTFKEELARAGIIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP  +++YL  VVP GDN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 IEHPAFIREYLGAVVPAGDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVEL++L NAEIKYSTVQNWYPGD +
Sbjct: 241 QFERTLIIADEDSYVSYLEGCTAPQRDENQLHAAVVELISLKNAEIKYSTVQNWYPGDKE 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+E GSAITWKYPSCLLRG  S GEFYSIA++NG+
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQIEAGSAITWKYPSCLLRGNNSRGEFYSIAVANGY 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL +NT+SRI+SKGISAGFS+NTYRG+V+ HR A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMIHLGENTSSRIISKGISAGFSSNTYRGQVTAHRKAKNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +C AHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGI EE AIALI+NGFV+EV+Q
Sbjct: 421 DCSAHTVPYIETKNATAQFEHEATTSKISDDQLFYVMQRGISEEEAIALIINGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEFAVEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFAVEAQKLIGISLEGSVG 503


>gi|49474207|ref|YP_032249.1| cysteine desulfurase activator complex subunit SufB [Bartonella
           quintana str. Toulouse]
 gi|49239711|emb|CAF26087.1| ABC transporter subunit [Bartonella quintana str. Toulouse]
          Length = 503

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 391/503 (77%), Positives = 439/503 (87%), Gaps = 14/503 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+ +V +I VDQYKYGFET I+ +KAPKGLNEDIIRFISAKK EP+WML WRL 
Sbjct: 1   MPAVQETIRQVHEIGVDQYKYGFETKIKTEKAPKGLNEDIIRFISAKKREPEWMLTWRLQ 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+ RWL M++P WARI YP IDF  L+YYAAPK+  GP+SL++VDPELL TYEKLGIP++
Sbjct: 61  AFHRWLIMQEPDWARIEYPQIDFQGLHYYAAPKNHTGPKSLEEVDPELLATYEKLGIPLK 120

Query: 121 EQEILAGV--------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAI 166
           EQEILAGV               + +VAVDAVFDSVSVVTTFK+EL ++GVIF  ISEAI
Sbjct: 121 EQEILAGVRKQSDLSTFDDRIYASGQVAVDAVFDSVSVVTTFKKELARAGVIFCSISEAI 180

Query: 167 CEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTG 226
            EHP L+K+YL TVVP GDN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRINE+ TG
Sbjct: 181 IEHPTLIKEYLGTVVPAGDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINERNTG 240

Query: 227 QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQ 286
           QFERTLIIADE SYVSYLEGCTAPQRDENQLHAAVVELVAL NAEIKYSTVQNWYPGD  
Sbjct: 241 QFERTLIIADENSYVSYLEGCTAPQRDENQLHAAVVELVALKNAEIKYSTVQNWYPGDKD 300

Query: 287 GKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGF 346
           GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSCLLRG+ S GEF+SIA++NG+
Sbjct: 301 GKGGIYNFVTKRGDCRGDNSKISWTQIETGSAITWKYPSCLLRGDNSRGEFHSIAVANGY 360

Query: 347 QQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGN 406
           QQIDSGTKM+HL KNT+SRIVSKGISAGF+NNTYRG+V  HR A ++RNFTQCDSLLIGN
Sbjct: 361 QQIDSGTKMVHLGKNTSSRIVSKGISAGFANNTYRGQVIAHRKAQNARNFTQCDSLLIGN 420

Query: 407 NCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQ 466
           +CGAHT+PYIE+KN++   EHEATTSKISD+ LFY +QRGIPEE AIALIVNGFV+EV+Q
Sbjct: 421 DCGAHTVPYIEAKNATAQFEHEATTSKISDDQLFYVMQRGIPEEEAIALIVNGFVKEVIQ 480

Query: 467 KLPMEFAVEAQKLIDISLEGSVG 489
           KLPMEF VEAQKLI ISLEGSVG
Sbjct: 481 KLPMEFVVEAQKLIGISLEGSVG 503


>gi|197105183|ref|YP_002130560.1| ABC-type transport system involved in Fe-S cluster assembly,
           permease component [Phenylobacterium zucineum HLK1]
 gi|196478603|gb|ACG78131.1| ABC-type transport system involved in Fe-S cluster assembly,
           permease component [Phenylobacterium zucineum HLK1]
          Length = 489

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 348/491 (70%), Positives = 419/491 (85%), Gaps = 4/491 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV++TV++V+ +  ++YK+GF T I  + APKGLNEDI+RFISAKK+EP+WMLEWRL 
Sbjct: 1   MAAVKQTVEQVQSL--EKYKHGFITEIDQEFAPKGLNEDIVRFISAKKDEPEWMLEWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+RRW  +++P+WA++ +P ID+ D +YYAAPK   GP+SLD+VDPELL TY+KLGIP+R
Sbjct: 59  AFRRWQALEEPAWAKVSFPRIDYQDAHYYAAPKQKAGPKSLDEVDPELLETYKKLGIPLR 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQE+LAGV+   + AVDAVFDSVSVVTTFK+EL  +GVIF  +SEAI +H DLV++YL +
Sbjct: 119 EQEVLAGVEGAPRYAVDAVFDSVSVVTTFKKELAAAGVIFCSMSEAIRDHGDLVRRYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++A LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + +GQFERTLIIAD GS
Sbjct: 179 VVPVSDNYFACLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENSGQFERTLIIADAGS 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD-SQGKGGIYNFVTKR 298
           YVSYLEGCTAP RDENQLHAAVVELVA+D+AEIKYSTVQNWYPGD   GKGGIYNFVTKR
Sbjct: 239 YVSYLEGCTAPMRDENQLHAAVVELVAMDDAEIKYSTVQNWYPGDPETGKGGIYNFVTKR 298

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
            DCRG RSK+SWTQ+ETGS+ITWKYPSC+LRG  S GEFYSIAI+NG QQ D+GTKM+HL
Sbjct: 299 ADCRGDRSKVSWTQVETGSSITWKYPSCVLRGNGSVGEFYSIAITNGRQQADTGTKMIHL 358

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
             NT SRI+SKGISAG S+NTYRG VS H  A  +RNFTQCDSLLIG  C AHT+PYIE+
Sbjct: 359 GANTRSRIISKGISAGKSSNTYRGLVSAHPKAKGARNFTQCDSLLIGKRCAAHTVPYIEA 418

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           +N     EHEATT+++S++ LFY +QRG+ +E A+ L+VNGFVR+VLQ+LPMEFAVEAQK
Sbjct: 419 RNGQAVFEHEATTTRLSEDQLFYAMQRGLSQEEAVQLLVNGFVRDVLQELPMEFAVEAQK 478

Query: 479 LIDISLEGSVG 489
           L+ ISLEGSVG
Sbjct: 479 LVAISLEGSVG 489


>gi|167646550|ref|YP_001684213.1| cysteine desulfurase activator complex subunit SufB [Caulobacter
           sp. K31]
 gi|167348980|gb|ABZ71715.1| FeS assembly protein SufB [Caulobacter sp. K31]
          Length = 489

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 346/491 (70%), Positives = 412/491 (83%), Gaps = 4/491 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV++T+D V  +  ++Y++GF T+I+ + APKGL+EDI+RFISAKK+EP WML+WRL 
Sbjct: 1   MAAVKQTIDTVASL--EKYEHGFTTDIEQEFAPKGLSEDIVRFISAKKDEPQWMLDWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYRRWL +++P+WA++ +P ID+ D YYYAAP    G  SLD+VDP++L  Y KLGIP++
Sbjct: 59  AYRRWLELEEPTWAKVDFPKIDYQDSYYYAAPTQKAGIASLDEVDPDILAVYAKLGIPLK 118

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQE+LAGV    + AVDAVFDSVSVVTTFK+EL   GVIF  +SEAI EHP+LVK+YL +
Sbjct: 119 EQEVLAGVVGAPRYAVDAVFDSVSVVTTFKKELAAVGVIFCSMSEAIGEHPELVKQYLGS 178

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN+YA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN K +GQFERTLIIAD+G+
Sbjct: 179 VVPTSDNYYACLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAKDSGQFERTLIIADKGA 238

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD-SQGKGGIYNFVTKR 298
           Y SYLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD   GKGGIYNFVTKR
Sbjct: 239 YCSYLEGCTAPMRDENQLHAAVVELVLLDDAEIKYSTVQNWYPGDPETGKGGIYNFVTKR 298

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
            DCRG RSK+SWTQ+ETGSAITWKYPSC+LRGE S GEFYSIA++NG QQ D+GTKM+HL
Sbjct: 299 ADCRGDRSKVSWTQVETGSAITWKYPSCVLRGEGSSGEFYSIAVTNGHQQADTGTKMIHL 358

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
             NT SRIV+KGISAG S +TYRG VS H  A  +RNFTQCDSLLIG  C AHT+PYIE+
Sbjct: 359 GANTKSRIVAKGISAGKSTSTYRGLVSAHPKAKGARNFTQCDSLLIGKTCAAHTVPYIEA 418

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           +N     EHEATT+++SD+ LFYC QRG+ +E A+AL+VNGFV++VLQ+LPMEFAVEAQK
Sbjct: 419 RNGQSVFEHEATTTRLSDDQLFYCQQRGLSQEEAVALLVNGFVKDVLQQLPMEFAVEAQK 478

Query: 479 LIDISLEGSVG 489
           L+ ISLEGSVG
Sbjct: 479 LVAISLEGSVG 489


>gi|46203571|ref|ZP_00051333.2| COG0719: ABC-type transport system involved in Fe-S cluster
           assembly, permease component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 486

 Score =  567 bits (1461), Expect = e-159,   Method: Composition-based stats.
 Identities = 376/487 (77%), Positives = 436/487 (89%), Gaps = 2/487 (0%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           ++ET+D+VR ID+DQYKYGFET I+++K+ KGL+ED+IRFISAKKNEP W+LEWRL AY+
Sbjct: 1   MQETIDRVRSIDLDQYKYGFETVIEMEKSEKGLSEDVIRFISAKKNEPAWLLEWRLDAYK 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           RWLTMK+P WAR+ Y  +D++D+YYYAAPK   GP+SLDD+DPE+L+TYEKLGIP+RE E
Sbjct: 61  RWLTMKEPEWARVAYDKVDYNDIYYYAAPK-RQGPESLDDIDPEILKTYEKLGIPLREVE 119

Query: 124 ILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
            L G+    +VAVDAVFDSVSV TTFK+EL+K+GVIFMPISEA+ E+PDLVK YL +VVP
Sbjct: 120 ALEGIAPERRVAVDAVFDSVSVATTFKKELEKAGVIFMPISEAVREYPDLVKTYLGSVVP 179

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           V DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRINE+ TGQFERTLIIAD+GSYVS
Sbjct: 180 VTDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINERDTGQFERTLIIADKGSYVS 239

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP+RD+NQLHAAVVELVAL++AEIKYSTVQNWYPGD++GKGGIYNFVTKRGDCR
Sbjct: 240 YLEGCTAPKRDDNQLHAAVVELVALEDAEIKYSTVQNWYPGDNEGKGGIYNFVTKRGDCR 299

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+SNG QQ+DSGTKM+HL +NT
Sbjct: 300 GARSKISWTQVETGSAITWKYPSCILRGDDSRGEFYSIAVSNGMQQVDSGTKMIHLGRNT 359

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           TSRI+SKGISAG S NTYRG VS H+ A  +RNFT CDSLLIG+ CGAHT+PYIESKN+S
Sbjct: 360 TSRIISKGISAGRSQNTYRGLVSAHKKAKGARNFTNCDSLLIGDQCGAHTVPYIESKNAS 419

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
              EHEATTSKIS++  FYC QRG+ EE A ALIVNGFVR+VLQ+LPMEFAVEAQKLI I
Sbjct: 420 AVFEHEATTSKISEDQKFYCQQRGLSEEEATALIVNGFVRDVLQQLPMEFAVEAQKLISI 479

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 480 SLEGSVG 486


>gi|103486167|ref|YP_615728.1| cysteine desulfurase activator complex subunit SufB [Sphingopyxis
           alaskensis RB2256]
 gi|98976244|gb|ABF52395.1| Iron-regulated ABC transporter membrane component SufB
           [Sphingopyxis alaskensis RB2256]
          Length = 495

 Score =  566 bits (1459), Expect = e-159,   Method: Composition-based stats.
 Identities = 334/473 (70%), Positives = 398/473 (84%), Gaps = 1/473 (0%)

Query: 18  QYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIR 77
            Y++G+  +I+ D APKGL ED +RFISAKKNEP+WML+WRL A+R W TM+ P WA++ 
Sbjct: 23  DYEHGWSADIETDFAPKGLTEDTVRFISAKKNEPEWMLDWRLKAFRHWQTMETPDWAKLN 82

Query: 78  YPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVAVD 136
            P ID+ D YYYAAPK      SLD+VDPE+L  Y KLGIPI EQ++LAGV+   KVAVD
Sbjct: 83  VPPIDYQDAYYYAAPKPKPKLSSLDEVDPEILEVYRKLGIPIEEQKVLAGVEGARKVAVD 142

Query: 137 AVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVF 196
           AVFDSVSV TTF+EELK++GVIF+ ISEAI E+P+LVKK+L  VVP+ DN++A LN AVF
Sbjct: 143 AVFDSVSVATTFREELKRAGVIFLSISEAIREYPELVKKWLGRVVPMHDNYFATLNCAVF 202

Query: 197 TDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQ 256
           +DG+FVY+P+GVRCPMELSTYFRIN + TGQFERTLI+AD+G+YVSYLEGCTAP RDENQ
Sbjct: 203 SDGTFVYVPEGVRCPMELSTYFRINAENTGQFERTLIVADKGAYVSYLEGCTAPMRDENQ 262

Query: 257 LHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETG 316
           LHAAVVELVALD+AEIKYSTVQNWYPG+++G GGIYNFVTKR  C+G RSK+SWTQ+ETG
Sbjct: 263 LHAAVVELVALDDAEIKYSTVQNWYPGNAEGLGGIYNFVTKRALCQGKRSKVSWTQVETG 322

Query: 317 SAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFS 376
           SAITWKYPSC+L G+ S GEFYS+A++N FQQ D+GTKM+H  K T S IVSKGISAG S
Sbjct: 323 SAITWKYPSCVLNGDDSVGEFYSVAVTNNFQQADTGTKMIHNGKRTRSTIVSKGISAGKS 382

Query: 377 NNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISD 436
           NNTYRG V V   A   RNFTQCDSLL+G+ CGAHT+PYIE +N +  +EHEATTSKISD
Sbjct: 383 NNTYRGLVRVAPNAEGVRNFTQCDSLLLGDRCGAHTVPYIEVRNPTATVEHEATTSKISD 442

Query: 437 EHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           + LFY +QRG+ +E A+ALIVNGF +EVLQ+LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 443 DQLFYAMQRGLGQEEAVALIVNGFAKEVLQQLPMEFAVEAQKLLGISLEGSVG 495


>gi|126661120|ref|ZP_01732200.1| component of SufBCD complex [Cyanothece sp. CCY0110]
 gi|126617596|gb|EAZ88385.1| component of SufBCD complex [Cyanothece sp. CCY0110]
          Length = 480

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 314/490 (64%), Positives = 391/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GLNED+IR ISAKKNEP++MLE+RL 
Sbjct: 1   MSAT-----TVKNLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPEFMLEFRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY++WL M +P+W  + YP ID+ ++ YY+APK      ++LD+VDP LL T+EKLGIP+
Sbjct: 56  AYQQWLKMTEPTWPHVNYPKIDYQNIIYYSAPKQKKEKLKNLDEVDPALLETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVSV TT+KE+L + GVIF  ISEA+ EHP+LVKKYL +
Sbjct: 116 SEQKRLS-----NVAVDAIFDSVSVGTTYKEKLAEDGVIFCSISEALEEHPELVKKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPVGDNF+AALN+AVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVGDNFFAALNAAVFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD  GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDSNQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 KNTRSTIISKGISAGNSKNSYRGLVQMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI EE AI+++V+GF ++VL +LPMEFA EA KL
Sbjct: 411 NNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAISMLVSGFCQDVLSELPMEFASEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|172035601|ref|YP_001802102.1| cysteine desulfurase activator complex subunit SufB [Cyanothece sp.
           ATCC 51142]
 gi|171697055|gb|ACB50036.1| iron-sulfur assembly protein [Cyanothece sp. ATCC 51142]
          Length = 494

 Score =  566 bits (1458), Expect = e-159,   Method: Composition-based stats.
 Identities = 315/490 (64%), Positives = 391/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GLNED+IR ISAKKNEPD+MLE+RL 
Sbjct: 15  MSAT-----TVKNLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPDFMLEFRLK 69

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY++WL M +P+W  + YP ID+ ++ YY+APK      ++LD+VDP LL T+EKLGIP+
Sbjct: 70  AYQQWLKMTEPTWPHVNYPKIDYQNIIYYSAPKQKKEKLKNLDEVDPALLETFEKLGIPL 129

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVSV TT+KE+L + GVIF  ISEA+ EHP+LVKKYL +
Sbjct: 130 SEQKRLS-----NVAVDAIFDSVSVGTTYKEKLAEDGVIFCSISEALEEHPELVKKYLGS 184

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPVGDNF+AALN+AVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 185 VVPVGDNFFAALNAAVFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGA 244

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD  GKGGIYNFVTKRG
Sbjct: 245 SVSYLEGCTAPMYDSNQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRG 304

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 305 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 364

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 365 KNTRSTIISKGISAGNSKNSYRGLVQMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVD 424

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI EE AI+++V+GF ++VL +LPMEFA EA KL
Sbjct: 425 NNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAISMLVSGFCQDVLSELPMEFASEADKL 484

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 485 LSLKLEGTVG 494


>gi|296282945|ref|ZP_06860943.1| cysteine desulfurase activator complex subunit SufB [Citromicrobium
           bathyomarinum JL354]
          Length = 497

 Score =  565 bits (1457), Expect = e-159,   Method: Composition-based stats.
 Identities = 340/473 (71%), Positives = 403/473 (85%), Gaps = 1/473 (0%)

Query: 18  QYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIR 77
            Y++G+ ++I+ D APKGL+ED +RFISAKK EP+WMLEWRL AYR+WLTM +P WA+I 
Sbjct: 25  DYEFGWHSDIETDYAPKGLSEDTVRFISAKKKEPEWMLEWRLKAYRKWLTMTEPDWAKIG 84

Query: 78  YPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVAVD 136
           YPAID+ D YYYAAPK     +SLD++DPE+   Y+KLGIP+ EQE+LAGV+   KVAVD
Sbjct: 85  YPAIDYQDAYYYAAPKKKEELESLDELDPEIKSVYDKLGIPLAEQEVLAGVKGARKVAVD 144

Query: 137 AVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVF 196
           AVFDSVSV TTF+EEL+K+GVIF+ ISEAI EHP+LVKK+L  VVP  DN++A LNSAVF
Sbjct: 145 AVFDSVSVATTFREELQKAGVIFLSISEAIREHPELVKKWLGRVVPQNDNYFACLNSAVF 204

Query: 197 TDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQ 256
           +DG+FVYIP+GVRCPMELSTYFRIN + TGQFERTLI+A++GSYVSYLEGCTAP RDENQ
Sbjct: 205 SDGTFVYIPEGVRCPMELSTYFRINAENTGQFERTLIVAEKGSYVSYLEGCTAPMRDENQ 264

Query: 257 LHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETG 316
           LHAAVVELVA+D+AEIKYSTVQNWYPG+S+G GGIYNFVTKRG C+G RSKISWTQ+ETG
Sbjct: 265 LHAAVVELVAMDDAEIKYSTVQNWYPGNSEGVGGIYNFVTKRGLCQGARSKISWTQVETG 324

Query: 317 SAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFS 376
           SA+TWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM+H  K + S I+SKGISAG S
Sbjct: 325 SAVTWKYPSCVLNGENSVGEFYSVAVTNNHQQADTGTKMIHNGKGSRSTIISKGISAGQS 384

Query: 377 NNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISD 436
           NNTYRG V V   A   RN T+CDSLL+G+ CGAHT+PYIE KN +  +EHEATTSKISD
Sbjct: 385 NNTYRGLVRVAANAEGVRNRTECDSLLLGDRCGAHTVPYIEVKNPTAQIEHEATTSKISD 444

Query: 437 EHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           + LFY  QRG+ EEAAIALIVNGF +EVL++LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 445 DQLFYAQQRGLDEEAAIALIVNGFAKEVLKELPMEFAVEAQKLLAISLEGSVG 497


>gi|146278397|ref|YP_001168556.1| cysteine desulfurase activator complex subunit SufB [Rhodobacter
           sphaeroides ATCC 17025]
 gi|145556638|gb|ABP71251.1| Iron-regulated ABC transporter membrane component SufB [Rhodobacter
           sphaeroides ATCC 17025]
          Length = 509

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 345/493 (69%), Positives = 413/493 (83%), Gaps = 9/493 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RET++ V+ +   +YKYG+ET I++D APKGLNEDI+R IS K +EP+WM EWRL AYRR
Sbjct: 18  RETIETVQAM-AGKYKYGWETEIEMDFAPKGLNEDIVRLISTKNDEPEWMTEWRLAAYRR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W+ M++P WA + YP ID+ DLYYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 77  WVQMEEPRWAMLNYPEIDYQDLYYYAKPKSMDVKPKSLDEVDPKLLETYKKLGIPLKEQA 136

Query: 124 ILAGVQT-------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           +LAGV+         +VAVDAVFDSVSV TTFK EL K+GVIF  ISEA+ EHP+LVKKY
Sbjct: 137 LLAGVEGADGPDAPRQVAVDAVFDSVSVGTTFKAELAKAGVIFCSISEAVREHPELVKKY 196

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DN++A LNSAVF+DGSFVYIP G RCPMELSTYFRIN + TGQFERTLIIAD
Sbjct: 197 LGSVVPQSDNYFATLNSAVFSDGSFVYIPPGTRCPMELSTYFRINAENTGQFERTLIIAD 256

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAP+RD NQLHAAVVE+V L++AE+KYSTVQNWYPGD +G+GGIYNFVT
Sbjct: 257 KGAYVSYLEGCTAPKRDTNQLHAAVVEIVVLEDAEVKYSTVQNWYPGDEEGRGGIYNFVT 316

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KR DCRG RSK+ WTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM+
Sbjct: 317 KRADCRGARSKVMWTQVETGSAITWKYPSCILRGDDSQGEFYSIAIANNAQQADTGTKMI 376

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PYI
Sbjct: 377 HLGKNTRSRIVSKGISAGKAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHTVPYI 436

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E +N+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVL+ LPMEFA+EA
Sbjct: 437 EVRNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLRALPMEFAMEA 496

Query: 477 QKLIDISLEGSVG 489
           Q L+ ISLEGSVG
Sbjct: 497 QALVAISLEGSVG 509


>gi|158334403|ref|YP_001515575.1| cysteine desulfurase activator complex subunit SufB [Acaryochloris
           marina MBIC11017]
 gi|158304644|gb|ABW26261.1| FeS assembly protein SufB [Acaryochloris marina MBIC11017]
          Length = 478

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 312/480 (65%), Positives = 385/480 (80%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V  +    YKYGF T+I+V+  PKGL+ED+IR ISAKK EP +MLE+RL AYR+WL MK
Sbjct: 4   TVENLVNQPYKYGFVTDIEVETIPKGLSEDVIRLISAKKEEPAFMLEFRLKAYRQWLKMK 63

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           +P+W  + YPAID+ D+ YY+APK     +SLDDVDP LL T++KLGIP+ EQ+ L+   
Sbjct: 64  EPTWPHVDYPAIDYQDITYYSAPKEQEKKKSLDDVDPALLETFDKLGIPLSEQKRLS--- 120

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTFKE+L K GVIF  ISEA+ + P+LV+KYL +VVP+ DNF++
Sbjct: 121 --NVAVDAVFDSVSVATTFKEQLAKEGVIFCSISEALKDFPELVEKYLGSVVPINDNFFS 178

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFVYIPKGV+CPMELSTYFRIN +G GQFERTLIIA+EGS VSYLEGCTA
Sbjct: 179 ALNSAVFSDGSFVYIPKGVKCPMELSTYFRINTEGAGQFERTLIIAEEGSQVSYLEGCTA 238

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELVALD+A+IKYSTVQNWY GD  GKGGIYNFVTKRG C G  SKIS
Sbjct: 239 PMFDTNQLHAAVVELVALDDADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCAGKNSKIS 298

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SK
Sbjct: 299 WTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMIHVGKNTRSTIISK 358

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S N+YRG V +   A  SRN++QCDS+LIG++  A+T PYI+ +N+   +EHEA
Sbjct: 359 GISAGRSQNSYRGLVRMGPKADGSRNYSQCDSMLIGSDAEANTFPYIQVQNNQTKVEHEA 418

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ LFY  QRGI  E A++++++GF ++V  +LPMEFAVEA +L+ + LEGSVG
Sbjct: 419 STSKIGEDQLFYFAQRGISVEDAVSMMISGFCQDVFNQLPMEFAVEADRLLSLKLEGSVG 478


>gi|94496619|ref|ZP_01303195.1| FeS assembly protein SufB [Sphingomonas sp. SKA58]
 gi|94423979|gb|EAT09004.1| FeS assembly protein SufB [Sphingomonas sp. SKA58]
          Length = 494

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 339/494 (68%), Positives = 401/494 (81%), Gaps = 5/494 (1%)

Query: 1   MVAVRETVDKVRKIDVDQ----YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLE 56
           M     T+     ++  +    Y++G+ + I+ D APKGLNED +RFISAKK EP W+L+
Sbjct: 1   MTDDVTTIRNQEALEAAERASTYEHGWSSAIEQDFAPKGLNEDTVRFISAKKGEPQWLLD 60

Query: 57  WRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLG 116
           WRL A+ +W TM+ P WA++  P ID+ D YYYA PK      SLD+VDPE+L TY+KLG
Sbjct: 61  WRLKAFAQWQTMESPDWAKLNVPPIDYQDAYYYAEPKKKAELNSLDEVDPEILATYQKLG 120

Query: 117 IPIREQEILAGVQTS-KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           IPI EQE+LAGV+ S KVAVDAVFDSVSV TTF++EL+++GVIF  ISEA+ E PDLVKK
Sbjct: 121 IPIAEQEMLAGVKGSRKVAVDAVFDSVSVATTFRKELEEAGVIFRSISEAVREFPDLVKK 180

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           +L  VVP+ DN++A LN AVF+DG+FVYIPKGVRCPMELSTYFRIN + TGQFERTLI+A
Sbjct: 181 WLGKVVPMHDNYFATLNCAVFSDGTFVYIPKGVRCPMELSTYFRINAENTGQFERTLIVA 240

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DEGSYVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFV
Sbjct: 241 DEGSYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFV 300

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR  C+G  SK+SWTQ+ETGSAITWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM
Sbjct: 301 TKRALCQGRNSKVSWTQVETGSAITWKYPSCVLNGENSVGEFYSVALTNNRQQADTGTKM 360

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +H  K T S IVSKGISAG SNNTYRG V V  GA   RNFTQCDSLL+G+ CGAHT+PY
Sbjct: 361 IHNGKGTRSTIVSKGISAGRSNNTYRGLVRVAPGAEGVRNFTQCDSLLLGDQCGAHTVPY 420

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE +N S  +EHEATTSKISD+ LFY +QRG+  E+A++LIVNGF ++VLQ+LPMEFAVE
Sbjct: 421 IEVRNPSAQIEHEATTSKISDDQLFYAMQRGLDTESAVSLIVNGFAKDVLQQLPMEFAVE 480

Query: 476 AQKLIDISLEGSVG 489
           AQKL+ ISLEGSVG
Sbjct: 481 AQKLLGISLEGSVG 494


>gi|85375384|ref|YP_459446.1| cysteine desulfurase activator complex subunit SufB [Erythrobacter
           litoralis HTCC2594]
 gi|84788467|gb|ABC64649.1| ABC-type transport system [Erythrobacter litoralis HTCC2594]
          Length = 493

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 332/473 (70%), Positives = 398/473 (84%), Gaps = 1/473 (0%)

Query: 18  QYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIR 77
            Y++G+ ++I+ D APKGLNED +RFIS KK EP WML+WRL A+R W TM++P WA++ 
Sbjct: 21  DYEHGWSSDIEQDFAPKGLNEDTVRFISEKKGEPQWMLDWRLKAFRLWQTMEEPDWAKLG 80

Query: 78  YPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVAVD 136
           YP ID+ D YYYA P      +SLD++DP +   Y+KLGIP+ EQE+LAGV+   KVAVD
Sbjct: 81  YPKIDYQDAYYYAEPTKKPELESLDELDPAIKEVYDKLGIPLGEQEVLAGVKGARKVAVD 140

Query: 137 AVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVF 196
           AVFDSVSV TTF+EELKK+GVIF+ ISEAI EHP+LVKK+L  VVP  DN++A LN AVF
Sbjct: 141 AVFDSVSVATTFREELKKAGVIFLSISEAIREHPELVKKWLGKVVPQRDNYFATLNCAVF 200

Query: 197 TDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQ 256
           +DG+FVYIP+GVRCPMELSTYFRIN + TGQFERTLI+A++GSYVSYLEGCTAP RDENQ
Sbjct: 201 SDGTFVYIPEGVRCPMELSTYFRINAENTGQFERTLIVAEKGSYVSYLEGCTAPMRDENQ 260

Query: 257 LHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETG 316
           LHAAVVELVA+++AEIKYSTVQNWYPGD++GKGGIYNFVTKRG C+G RSKISWTQ+ETG
Sbjct: 261 LHAAVVELVAMEDAEIKYSTVQNWYPGDAEGKGGIYNFVTKRGLCQGARSKISWTQVETG 320

Query: 317 SAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFS 376
           SA+TWKYPSC+L GE S GEFYS+A++N +QQ D+GTKM+H A  T S I+SKGISAG S
Sbjct: 321 SAVTWKYPSCVLNGEDSVGEFYSVAVTNNYQQADTGTKMIHNAPGTRSTIISKGISAGKS 380

Query: 377 NNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISD 436
           NNTYRG V V   A + RN T+CDSLLIG+ CGAHT+PYIE KN S  +EHEATTSK+SD
Sbjct: 381 NNTYRGLVRVGPNAENVRNRTECDSLLIGDLCGAHTVPYIEVKNPSAQIEHEATTSKVSD 440

Query: 437 EHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           + LFY +QRG+ EE A+ALIVNGF +EVL++LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 441 DQLFYAMQRGLDEEQAMALIVNGFAKEVLKELPMEFAVEAQKLLAISLEGSVG 493


>gi|307152984|ref|YP_003888368.1| FeS assembly protein SufB [Cyanothece sp. PCC 7822]
 gi|306983212|gb|ADN15093.1| FeS assembly protein SufB [Cyanothece sp. PCC 7822]
          Length = 480

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 312/490 (63%), Positives = 390/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +  P+GLNEDIIR ISAKKNEP++MLE+RL 
Sbjct: 1   MSAT-----TVKTLVNQPYKYGFVTDIESETVPRGLNEDIIRLISAKKNEPEFMLEFRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AYR+W  M +P+W  + YP ID+ ++ YY+APK      +SL++VDP LL T+EKLGIP+
Sbjct: 56  AYRQWQKMTEPTWPHVDYPPIDYQNIIYYSAPKQKKAKLESLEEVDPALLETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVS+ TTFKE+L K GVIF  ISEA+ EHP+LV+KYL +
Sbjct: 116 SEQKRLS-----NVAVDAIFDSVSIATTFKEKLAKEGVIFCSISEALQEHPELVQKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVNDNYFAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNW+ GD+ GKGGI+NFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDTNQLHAAVVELVALDNADIKYSTVQNWFAGDANGKGGIFNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHVG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +  GA  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 KNTRSTIISKGISAGNSKNSYRGLVKMGPGAKGARNYSQCDSMLIGDNAEANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI EE AI+++V+GF ++VL  LPMEFA EA KL
Sbjct: 411 NNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAISMLVSGFCKDVLSALPMEFAAEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|114768832|ref|ZP_01446458.1| FeS assembly protein SufB [alpha proteobacterium HTCC2255]
 gi|114549749|gb|EAU52630.1| FeS assembly protein SufB [alpha proteobacterium HTCC2255]
          Length = 501

 Score =  565 bits (1456), Expect = e-159,   Method: Composition-based stats.
 Identities = 345/490 (70%), Positives = 411/490 (83%), Gaps = 7/490 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
           ETV+ V+ +   +YKYGF T+++++ AP GL+EDI+R IS K +EP+WMLEWRL A+ RW
Sbjct: 13  ETVEAVKSL-SGKYKYGFSTDVEIEYAPLGLSEDIVRLISEKNDEPEWMLEWRLQAFERW 71

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSI--VGPQSLDDVDPELLRTYEKLGIPIREQE 123
             MK+P WA + YP IDF D+YYYA PKS+    P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 72  KQMKEPDWAMVDYPKIDFQDIYYYARPKSMSEDKPKSLDEVDPKLLETYEKLGIPLKEQA 131

Query: 124 ILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +LAGV+      KVAVDAVFDSVSV TTF++ELK +GVIFM ISEA+ EHPDLVKKY+ +
Sbjct: 132 LLAGVEVPDGDRKVAVDAVFDSVSVGTTFQKELKNAGVIFMSISEALKEHPDLVKKYIGS 191

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DNFYA LNSAVF+DGSFVYIP+GV+CPMELSTYFRIN + TGQFERTLIIA++GS
Sbjct: 192 VVPQSDNFYATLNSAVFSDGSFVYIPEGVKCPMELSTYFRINAENTGQFERTLIIAEKGS 251

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAPQRD  QLHAAVVELV  ++AEIKYSTVQNWYPGD  GKGGIYNFVTKR 
Sbjct: 252 SVSYLEGCTAPQRDVAQLHAAVVELVIQEDAEIKYSTVQNWYPGDENGKGGIYNFVTKRA 311

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM+HL 
Sbjct: 312 DCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKMIHLG 371

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRIVSKGISAG + NTYRG VS+H  A ++RN+TQCDSLLIG+ CGAHT+PYIE K
Sbjct: 372 KNTKSRIVSKGISAGKAQNTYRGLVSMHPKAENARNYTQCDSLLIGDKCGAHTVPYIEVK 431

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF +EVLQ LPMEFA+EAQ L
Sbjct: 432 NNTARVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKEVLQALPMEFAMEAQAL 491

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 492 VAISLEGSVG 501


>gi|254413199|ref|ZP_05026970.1| FeS assembly protein SufB [Microcoleus chthonoplastes PCC 7420]
 gi|196179819|gb|EDX74812.1| FeS assembly protein SufB [Microcoleus chthonoplastes PCC 7420]
          Length = 479

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 310/481 (64%), Positives = 390/481 (81%), Gaps = 6/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V+K+    YKYGF T+I+ D  P+GL+ED++R ISAKKNEP++MLE+RL AYR+WL M+
Sbjct: 4   TVKKLVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEFRLKAYRQWLKME 63

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           +P+W  + YP I++ D+ YY+APK       SL++VDP LL T+EKLGIP+ EQ+ L+  
Sbjct: 64  EPTWPHVNYPPINYQDIIYYSAPKKKTEKLNSLEEVDPALLETFEKLGIPLSEQKRLS-- 121

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDA+FDSVSV TTFK++L ++GVIF  ISEA+ EHP+LV+KYL +VVPVGDN++
Sbjct: 122 ---NVAVDAIFDSVSVATTFKDKLAEAGVIFCSISEALQEHPELVQKYLGSVVPVGDNYF 178

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EGS VSYLEGCT
Sbjct: 179 AALNSAVFSDGSFVFIPKGVKCPMELSTYFRINTGDTGQFERTLIVAEEGSSVSYLEGCT 238

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D NQLHAAVVELV LDNAEIKYSTVQNW+ GD +GKGGIYNFVTKRG C+G+ SKI
Sbjct: 239 APMYDTNQLHAAVVELVTLDNAEIKYSTVQNWFAGDEKGKGGIYNFVTKRGLCKGVNSKI 298

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+S
Sbjct: 299 SWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMVHIGKNTRSTIIS 358

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N+YRG V V   A  SRN++QCDS+LIG+   A+T PYI+ +N++  +EHE
Sbjct: 359 KGISAGNSKNSYRGLVKVSPKAKRSRNYSQCDSMLIGDTAEANTFPYIQVENNTAKVEHE 418

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LFY  QRGI EE A+++IV+GF ++V  +LPMEFA EA KL+ + LEG+V
Sbjct: 419 ASTSKIGEDQLFYFTQRGISEEDAVSMIVSGFCQDVFNELPMEFAAEADKLLSLKLEGAV 478

Query: 489 G 489
           G
Sbjct: 479 G 479


>gi|220916007|ref|YP_002491311.1| FeS assembly protein SufB [Anaeromyxobacter dehalogenans 2CP-1]
 gi|219953861|gb|ACL64245.1| FeS assembly protein SufB [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 479

 Score =  565 bits (1455), Expect = e-159,   Method: Composition-based stats.
 Identities = 320/484 (66%), Positives = 400/484 (82%), Gaps = 6/484 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
            T ++++++   +Y+YGF T+I+ DK PKGL+ED+IR ISAKK EP +MLEWRL AYRRW
Sbjct: 2   STAEQLKELTEQKYRYGFVTDIEEDKVPKGLSEDVIRLISAKKGEPRFMLEWRLEAYRRW 61

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           L M++P+WA + YP ID+ D+ YY+APK      S+D+VDPEL R + KLGIP+ EQ  L
Sbjct: 62  LAMEEPTWANVHYPKIDYQDIVYYSAPKQKKALGSMDEVDPELKRAFAKLGIPLEEQMRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           AG     VAVDAVFDSVSV TT+K++L   G++F   SEA+ EHP+LV++YL +VVP  D
Sbjct: 122 AG-----VAVDAVFDSVSVATTYKKKLADLGIVFCSFSEAVREHPELVERYLGSVVPSTD 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN K TGQFERTLI+ADEG YVSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAKDTGQFERTLIVADEGGYVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP RDENQLHAAVVELVALD A +KYSTVQNWYPGD++G+GGI+NFVTKRG     +
Sbjct: 237 GCTAPMRDENQLHAAVVELVALDGAHVKYSTVQNWYPGDAEGRGGIFNFVTKRGKAM-RK 295

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           +KISWTQ+ETGSAITWKYPSC+L+G++S GEFYS+A++N  QQ D+GTKM+H+ ++T S 
Sbjct: 296 AKISWTQVETGSAITWKYPSCILQGDESVGEFYSVALTNHRQQADTGTKMIHIGRDTRST 355

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           I+SKGISAG   NTYRG V + +GA  +RN++QCDSLLIG+ CGAHT PYIE +N +  +
Sbjct: 356 IISKGISAGRGQNTYRGLVKMMKGATGARNYSQCDSLLIGDRCGAHTFPYIEVRNPTAKV 415

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEATTSKISD+ LFYC QRGI +E A+++IVNGF ++VL++LPMEFAVEAQKL+ +SLE
Sbjct: 416 EHEATTSKISDDQLFYCRQRGISDEDAVSMIVNGFAKQVLKELPMEFAVEAQKLLGMSLE 475

Query: 486 GSVG 489
           GSVG
Sbjct: 476 GSVG 479


>gi|86157270|ref|YP_464055.1| cysteine desulfurase activator complex subunit SufB
           [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773781|gb|ABC80618.1| Iron-regulated ABC transporter membrane component SufB
           [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 479

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 321/484 (66%), Positives = 401/484 (82%), Gaps = 6/484 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
            T ++++++   +Y+YGF T+I+ DK PKGL+ED+IR ISAKK EP +MLEWRL AYRRW
Sbjct: 2   STAEQLKELTEQKYRYGFVTDIEEDKVPKGLSEDVIRLISAKKGEPRFMLEWRLEAYRRW 61

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           L M++P+WA + YP ID+ ++ YY+APK      S+D+VDPEL R + KLGIP+ EQ  L
Sbjct: 62  LAMEEPTWANVHYPKIDYQEIVYYSAPKQKKALGSMDEVDPELKRAFAKLGIPLEEQMRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           AG     VAVDAVFDSVSV TT+K++L   G++F   SEA+ EHP+LV+KYL +VVP  D
Sbjct: 122 AG-----VAVDAVFDSVSVATTYKKKLADLGIVFCSFSEAVREHPELVEKYLGSVVPATD 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN K TGQFERTLI+ADEG+YVSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAKDTGQFERTLIVADEGAYVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP RDENQLHAAVVELVALD A +KYSTVQNWYPGD++G+GGIYNFVTKRG     +
Sbjct: 237 GCTAPMRDENQLHAAVVELVALDGAHVKYSTVQNWYPGDAEGRGGIYNFVTKRGKAM-RK 295

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           +KISWTQ+ETGSAITWKYPSC+L+G++S GEFYS+A++N  QQ D+GTKM+H+ ++T S 
Sbjct: 296 AKISWTQVETGSAITWKYPSCILQGDESVGEFYSVALTNHRQQADTGTKMIHIGRDTRST 355

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           I+SKGISAG   NTYRG V + +GA  +RN++QCDSLLIG+ CGAHT PYIE +N +  +
Sbjct: 356 IISKGISAGRGQNTYRGLVKMMKGATGARNYSQCDSLLIGDRCGAHTFPYIEVRNPTAKV 415

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEATTSKISD+ LFYC QRGI +E A+++IVNGF ++VL++LPMEFAVEAQKL+ +SLE
Sbjct: 416 EHEATTSKISDDQLFYCRQRGISDEDAVSMIVNGFAKQVLKELPMEFAVEAQKLLGMSLE 475

Query: 486 GSVG 489
           GSVG
Sbjct: 476 GSVG 479


>gi|332186195|ref|ZP_08387940.1| feS assembly protein SufB [Sphingomonas sp. S17]
 gi|332013563|gb|EGI55623.1| feS assembly protein SufB [Sphingomonas sp. S17]
          Length = 487

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 335/475 (70%), Positives = 397/475 (83%), Gaps = 1/475 (0%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWAR 75
             +Y++GF T I+ D APKGL+ED +R+ISAKK EP+WML+WRL A+R W T++ P WA+
Sbjct: 13  NKKYEWGFATEIEQDFAPKGLSEDTVRYISAKKGEPEWMLDWRLKAFRLWQTLETPDWAK 72

Query: 76  IRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVA 134
           +  P ID+ D YYYA PK      SLD++DPE+ RTYEKLGIPI EQE+LAGV+   KVA
Sbjct: 73  LNIPPIDYQDAYYYAEPKQKKTIASLDELDPEIRRTYEKLGIPIAEQEVLAGVEGARKVA 132

Query: 135 VDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSA 194
           VDAVFDSVSV TTF++EL+ +GVIF  ISEAI E+PDLV+K+L  VVP  DN++A LNSA
Sbjct: 133 VDAVFDSVSVATTFRKELEAAGVIFRSISEAIKEYPDLVRKWLGKVVPQRDNYFATLNSA 192

Query: 195 VFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDE 254
           VF+DG+FVYIP+GVRCPMELSTYFRIN + TGQFERTLI+AD+G+YVSYLEGCTAP RDE
Sbjct: 193 VFSDGTFVYIPEGVRCPMELSTYFRINAENTGQFERTLIVADKGAYVSYLEGCTAPMRDE 252

Query: 255 NQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLE 314
           NQLHAAVVELVALD+AEIKYSTVQNWYPGD  G GGIYNFVTKR  C+G  SK+SWTQ+E
Sbjct: 253 NQLHAAVVELVALDDAEIKYSTVQNWYPGDENGVGGIYNFVTKRALCQGKNSKVSWTQVE 312

Query: 315 TGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAG 374
           TGSA+TWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+HL KNT S IVSKGISAG
Sbjct: 313 TGSAVTWKYPSCVLAGDGSVGEFYSVAVTNNRQQADTGTKMIHLGKNTRSTIVSKGISAG 372

Query: 375 FSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKI 434
            S+NTYRG V V   A + RNFTQCDSLL+G+ CGAHT+PYIE KN S  +EHEATTSKI
Sbjct: 373 RSDNTYRGLVRVAATAENVRNFTQCDSLLLGDQCGAHTVPYIEVKNPSAQIEHEATTSKI 432

Query: 435 SDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           S++ LFY + RG+ +EAA+ALIVNGF REVLQ+LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 433 SEDQLFYAMSRGLDQEAAVALIVNGFAREVLQQLPMEFAVEAQKLLGISLEGSVG 487


>gi|303276547|ref|XP_003057567.1| ATP-binding cassette superfamily [Micromonas pusilla CCMP1545]
 gi|226460224|gb|EEH57518.1| ATP-binding cassette superfamily [Micromonas pusilla CCMP1545]
          Length = 561

 Score =  564 bits (1454), Expect = e-159,   Method: Composition-based stats.
 Identities = 302/487 (62%), Positives = 386/487 (79%), Gaps = 5/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A +E VDK++++    YK GF+T+I+ D  PKGL+ED +R ISAKKNEP+WMLE+RL A+
Sbjct: 80  AKQEEVDKIQQMLSKPYKPGFKTDIETDTIPKGLSEDTVRIISAKKNEPEWMLEFRLKAF 139

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R+WLTM++P W+  RYP ID+  + YY+APK +   +SLD+VDPELL+T++KLGIP+ EQ
Sbjct: 140 RKWLTMEEPDWSDNRYPDIDYQAVSYYSAPKVMEKKKSLDEVDPELLKTFDKLGIPLSEQ 199

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           + +     + VAVDAVFDSVS+ TTF+E+L K GVIF  ISEAI E+P+L+K++L +VVP
Sbjct: 200 KRM-----TNVAVDAVFDSVSIATTFREDLAKVGVIFCSISEAIREYPELIKQHLGSVVP 254

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN+++ALN+AVF+DGSF YIPKGV+ PMELSTYFRIN + +GQFERTLI+A+EGSYVS
Sbjct: 255 VGDNYFSALNAAVFSDGSFCYIPKGVKSPMELSTYFRINAESSGQFERTLIVAEEGSYVS 314

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP  DENQLHAAVVE+ A  +AE+KYSTVQNWY G+  G GGIYNFVTKRG C+
Sbjct: 315 YLEGCTAPAYDENQLHAAVVEISAAKDAEVKYSTVQNWYAGNEDGVGGIYNFVTKRGLCK 374

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGS+ITWKYPS +L G+ S GEF+S+A++N  QQ D+GTKM+H+ KNT
Sbjct: 375 GDNSKISWTQVETGSSITWKYPSVVLAGDNSVGEFFSVALTNNKQQADTGTKMIHVGKNT 434

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            SRIVSKGISAG S N YRG V V   A  +RN++QCDS+LIG+  GA+T PYI  +  S
Sbjct: 435 RSRIVSKGISAGKSRNCYRGLVQVSPSAVGARNYSQCDSMLIGDKAGANTYPYISVREPS 494

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKI ++ LFY  QRGI  E A+ +I++GF  EV  +LP+EFA E   L+ +
Sbjct: 495 ARVEHEASTSKIGEDQLFYFQQRGIDPETAVGIIISGFCNEVFNELPLEFAAEVNALMSL 554

Query: 483 SLEGSVG 489
            LEGSVG
Sbjct: 555 KLEGSVG 561


>gi|67924846|ref|ZP_00518242.1| FeS assembly protein SufB [Crocosphaera watsonii WH 8501]
 gi|67853305|gb|EAM48668.1| FeS assembly protein SufB [Crocosphaera watsonii WH 8501]
          Length = 480

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 312/490 (63%), Positives = 391/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +  P+GL+ED+IR ISAKKNEP++MLE+RL 
Sbjct: 1   MSAT-----TVKNLVNQPYKYGFVTDIETETIPRGLSEDVIRLISAKKNEPEFMLEFRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY++WL M +P+W  + YP ID+ ++ YY+APK      +SLDDVDP L+ T+EKLGIP+
Sbjct: 56  AYKQWLKMTEPTWPHVHYPKIDYQNIIYYSAPKQKKEKLKSLDDVDPTLIETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVSV TTFKE+L + GVIF  ISEA+ EHP+LV+KYL +
Sbjct: 116 SEQKRLS-----NVAVDAIFDSVSVATTFKEKLAEDGVIFCSISEALEEHPELVRKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+AALNSAVF+DGSF++IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVADNFFAALNSAVFSDGSFIFIPKGVKCPMELSTYFRINTGDTGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD +GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDSNQLHAAVVELVALDNADIKYSTVQNWYAGDEKGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+HL 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLAGDNSVGEFYSIALTNNMQQADTGTKMIHLG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 KNTRSTIISKGISAGNSKNSYRGLVQMGPRAKGARNYSQCDSMLIGDNAEANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI EE A++++V+GF ++VL +LPMEFA EA KL
Sbjct: 411 NNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSELPMEFASEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|254491515|ref|ZP_05104694.1| FeS assembly protein SufB [Methylophaga thiooxidans DMS010]
 gi|224462993|gb|EEF79263.1| FeS assembly protein SufB [Methylophaga thiooxydans DMS010]
          Length = 482

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 330/487 (67%), Positives = 397/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +   ++  I   +YK GF T+I+VD  P GL+ED++R IS  KNEP+WMLEWRL AYR
Sbjct: 1   MTDQSQQLESITQKEYKAGFVTDIEVDSLPPGLSEDVVRQISMIKNEPEWMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM  P WA + YP ID+ ++ YY+APK    GP+SLD+VDPELL+TYEKLG+P+ E+
Sbjct: 61  HWLTMDTPEWAHVHYPEIDYQEVSYYSAPKKKTDGPKSLDEVDPELLKTYEKLGVPLDER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV  TFK++L + G++FMPISEAI EHP+LVKKY+ +VVP
Sbjct: 121 ARLAG-----VAVDAVFDSVSVSNTFKDKLAEEGILFMPISEAIQEHPELVKKYIGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIAD+ +YVS
Sbjct: 176 HKDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADDDAYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVA+D AEIKYSTVQNWYPGD  GKGGIYNFVTKR  CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVAMDRAEIKYSTVQNWYPGDENGKGGIYNFVTKRAACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SK+SWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N  QQ D+GTKM+HL KNT
Sbjct: 296 GESSKVSWTQVETGSAITWKYPSVVLQGDNSIGEFYSVAVTNNMQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           +S I+SKGISAG S N YRG V V   A ++RN+T+CDSLL+G+ CGAHT PYIE KN +
Sbjct: 356 SSTIISKGISAGRSQNAYRGLVRVGPNADNARNYTECDSLLMGDTCGAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKIS++ LFYC QRG+  E A+++IVNGF ++V+++LPMEFAVEAQ L+ +
Sbjct: 416 AKVEHEASTSKISEDQLFYCKQRGLDTEDAVSMIVNGFCKQVIRELPMEFAVEAQNLLGL 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|197121303|ref|YP_002133254.1| cysteine desulfurase activator complex subunit SufB
           [Anaeromyxobacter sp. K]
 gi|196171152|gb|ACG72125.1| FeS assembly protein SufB [Anaeromyxobacter sp. K]
          Length = 479

 Score =  564 bits (1454), Expect = e-158,   Method: Composition-based stats.
 Identities = 319/484 (65%), Positives = 401/484 (82%), Gaps = 6/484 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
            T ++++++   +Y+YGF T+I+ DK PKGL+ED+IR ISAKK EP +MLEWRL AYRRW
Sbjct: 2   STAEQLKELTEQKYRYGFVTDIEEDKVPKGLSEDVIRLISAKKAEPRFMLEWRLEAYRRW 61

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           L M++P+WA + YP ID+ D+ YY+APK      S+D+VDPEL R + KLGIP+ EQ  L
Sbjct: 62  LAMEEPTWANVHYPKIDYQDIVYYSAPKQKKALGSMDEVDPELKRAFAKLGIPLEEQMRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           AG     VAVDAVFDSVSV TT+K++L   G++F   SEA+ EHP+LV++YL +VVP  D
Sbjct: 122 AG-----VAVDAVFDSVSVATTYKKKLADLGIVFCSFSEAVREHPELVERYLGSVVPSTD 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN K TGQFERTLI+ADEG+YVSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAKDTGQFERTLIVADEGAYVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP RDENQLHAAVVELVALD A +KYSTVQNWYPGD++G+GGI+NFVTKRG     +
Sbjct: 237 GCTAPMRDENQLHAAVVELVALDGAHVKYSTVQNWYPGDAEGRGGIFNFVTKRGKAM-RK 295

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           +KISWTQ+ETGSAITWKYPSC+L+G++S GEFYS+A++N  QQ D+GTKM+H+ ++T S 
Sbjct: 296 AKISWTQVETGSAITWKYPSCILQGDESVGEFYSVALTNHRQQADTGTKMIHIGRDTRST 355

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           I+SKGISAG   NTYRG V + +GA  +RN++QCDSLLIG+ CGAHT PYIE +N +  +
Sbjct: 356 IISKGISAGRGQNTYRGLVKMMKGATGARNYSQCDSLLIGDRCGAHTFPYIEVRNPTAKV 415

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEATTSKIS++ LFYC QRGI +E A+++IVNGF ++VL++LPMEFAVEAQKL+ +SLE
Sbjct: 416 EHEATTSKISEDQLFYCRQRGISDEDAVSMIVNGFAKQVLKELPMEFAVEAQKLLGMSLE 475

Query: 486 GSVG 489
           GSVG
Sbjct: 476 GSVG 479


>gi|119493191|ref|ZP_01624066.1| ABC transporter subunit [Lyngbya sp. PCC 8106]
 gi|119452756|gb|EAW33933.1| ABC transporter subunit [Lyngbya sp. PCC 8106]
          Length = 478

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 309/479 (64%), Positives = 386/479 (80%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +  + YKYGF T+I+ D  P GLNED++R ISAKKNEP++ML +RL AYR+WL M +
Sbjct: 5   VKTLVNEPYKYGFVTDIESDSIPAGLNEDVVRLISAKKNEPEFMLNFRLKAYRQWLKMSE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P+W  + YPAI++ ++ YY+APK      SLD+VDP LL T+EKLGI + EQ+ LA    
Sbjct: 65  PTWPHVNYPAINYQNIVYYSAPKVNEKKGSLDEVDPTLLETFEKLGISLSEQKRLA---- 120

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVS+ TTFKE+L + GVIF  ISEA+ EHP+L++KYL +VVPVGDNF+AA
Sbjct: 121 -NVAVDAVFDSVSIGTTFKEKLAEDGVIFCSISEAVKEHPELIEKYLGSVVPVGDNFFAA 179

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV+CPM+LSTYFRIN   +GQFERTLI+A+EGS V+YLEGCTAP
Sbjct: 180 LNSAVFSDGSFVYIPKGVKCPMDLSTYFRINNGDSGQFERTLIVAEEGSSVTYLEGCTAP 239

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D NQLHAAVVELV LDNAEIKYSTVQNW+ GD  GKGGIYNFVTKRG C+G+ SKISW
Sbjct: 240 MFDTNQLHAAVVELVTLDNAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISW 299

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SKG
Sbjct: 300 TQVETGSAITWKYPSCILIGDNSVGEFYSVALTNNMQQADTGTKMVHIGKNTRSTIISKG 359

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI+  N++  +EHEA+
Sbjct: 360 ISAGNSSNSYRGLVKIGPKAKGARNYSQCDSMLIGDRGQANTFPYIQVDNNTAKVEHEAS 419

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFY  QRGI EE A++LI++GF ++V  +LPMEFAVEA KL+ + LEGSVG
Sbjct: 420 TSKIGEDQLFYLTQRGISEEDAVSLIISGFCKDVFNELPMEFAVEADKLLSLKLEGSVG 478


>gi|86608874|ref|YP_477636.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. JA-2-3B'a(2-13)]
 gi|86557416|gb|ABD02373.1| FeS assembly protein SufB [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 478

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 314/479 (65%), Positives = 384/479 (80%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           VR +    YKYGF T+I  +   KGLNE++IR I AKK EPD+MLE+RL AYR+WL M +
Sbjct: 5   VRALVNQPYKYGFVTDIPSESIGKGLNEEVIRQIWAKKGEPDFMLEFRLRAYRQWLKMSE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P+W  + YP ID+ ++ YY+APK     +SLD+VDP LL T+EKLGIP+ EQ+ LA    
Sbjct: 65  PTWPNVSYPPIDYQNIVYYSAPKVQPKKKSLDEVDPVLLETFEKLGIPLSEQKRLA---- 120

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDA+FDSVSV TTF+E+L K GVIF  +SEA+ E+P+LV+KYL +VVP+ DN+YAA
Sbjct: 121 -NVAVDAIFDSVSVATTFREKLAKEGVIFCSMSEALREYPELVRKYLGSVVPIADNYYAA 179

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVY+PKGVRCPMELSTYFRIN   +GQFERTLIIADEGSYVSYLEGCTAP
Sbjct: 180 LNSAVFSDGSFVYVPKGVRCPMELSTYFRINNGESGQFERTLIIADEGSYVSYLEGCTAP 239

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D NQLHAAVVEL+ LDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG C+G  SKISW
Sbjct: 240 MFDTNQLHAAVVELIVLDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGANSKISW 299

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPSC+L GE S GEFYS+A++N +QQ D+GTKM+H+ +NT S+I+SKG
Sbjct: 300 TQVETGSAITWKYPSCVLVGENSVGEFYSVALTNNYQQADTGTKMIHVGRNTRSKIISKG 359

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  +RNF+QCDS+LIG+ C A+T PYIE +N++  +EHEA+
Sbjct: 360 ISAGHSKNSYRGLVKIGPKAEGARNFSQCDSMLIGDQCSANTFPYIEVQNNTAKVEHEAS 419

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI +E LFY   RGI  E A+++I++GF REV  +LPMEFAVEA +L+ + LEGSVG
Sbjct: 420 TSKIGEEQLFYFQSRGISAEDAVSMIISGFCREVFNQLPMEFAVEADRLLSLKLEGSVG 478


>gi|292490816|ref|YP_003526255.1| FeS assembly protein SufB [Nitrosococcus halophilus Nc4]
 gi|291579411|gb|ADE13868.1| FeS assembly protein SufB [Nitrosococcus halophilus Nc4]
          Length = 482

 Score =  564 bits (1453), Expect = e-158,   Method: Composition-based stats.
 Identities = 328/487 (67%), Positives = 399/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++  KV  +   +Y+ GF T+I+ D  P GLNED+IR IS+KKNEP++MLEWRL AYR
Sbjct: 1   MSKSPLKVENLVHQEYRAGFITDIEADAIPPGLNEDVIRLISSKKNEPEFMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WL MK+P WA + YP +D+  + YY+APKS   GP+SLD+VDP+LL TYEKLG+P+ E+
Sbjct: 61  HWLEMKEPKWAHVHYPPVDYQSIVYYSAPKSKKDGPKSLDEVDPKLLETYEKLGVPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTFKE+L ++GVIF   SEA+ ++P+LV+KYL TVVP
Sbjct: 121 ARLAG-----VAVDAVFDSVSVATTFKEKLAEAGVIFCSFSEAVQKYPELVEKYLGTVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+PKGVRCP+ELSTYFRIN   TGQFERTLI+ADEG++VS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPKGVRCPLELSTYFRINAAQTGQFERTLIVADEGAHVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVALDNAEIKYSTVQNWYPGD +G+GGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDEEGRGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ +NT
Sbjct: 296 GANSKISWTQVETGSAITWKYPSVILQGDHSVGEFYSVALTNNFQQADTGTKMIHMGRNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG   N YRG V +   A  +RN+TQCDSLL+G+ CGAHT PYIE K+ S
Sbjct: 356 RSTIISKGISAGRGQNAYRGLVRMMPTAVGARNYTQCDSLLLGDRCGAHTFPYIEVKHPS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKIS++ LFYC QRGI  E A+++IVNGF +EV ++LPMEFAVEAQ L+ +
Sbjct: 416 AQVEHEASTSKISEDQLFYCKQRGISAEDAVSMIVNGFCKEVFKELPMEFAVEAQNLLGV 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|22298033|ref|NP_681280.1| cysteine desulfurase activator complex subunit SufB
           [Thermosynechococcus elongatus BP-1]
 gi|22294211|dbj|BAC08042.1| ABC transporter subunit [Thermosynechococcus elongatus BP-1]
          Length = 478

 Score =  563 bits (1452), Expect = e-158,   Method: Composition-based stats.
 Identities = 317/489 (64%), Positives = 386/489 (78%), Gaps = 11/489 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T I+ +  PKGLNEDIIR ISAKKNEP++MLE+RL 
Sbjct: 1   MSAT------VQSLVNQPYKYGFVTPIETETIPKGLNEDIIRLISAKKNEPEFMLEFRLR 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR+WL M +P W R+ YP I++ D+ YY+APK     +SLD+VDP LL T+EKLGIP+ 
Sbjct: 55  AYRQWLKMSEPQWPRVSYPPINYQDIVYYSAPKQKEKLKSLDEVDPVLLETFEKLGIPLS 114

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ L     + VAVDA+FDSVSV TTF+EEL K G+IF  ISEA+ ++P+LV+KYL +V
Sbjct: 115 EQKRL-----TNVAVDAIFDSVSVATTFREELAKQGIIFCSISEALQDYPELVQKYLGSV 169

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP+GDNFYAALNSAVF+DGSFVY+PK  RCPMELSTYFRIN   +GQFERTLIIAD GSY
Sbjct: 170 VPIGDNFYAALNSAVFSDGSFVYVPKNTRCPMELSTYFRINNGESGQFERTLIIADAGSY 229

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP  D NQLHAAVVELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG 
Sbjct: 230 VSYLEGCTAPMFDTNQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGL 289

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C G  SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+H+ K
Sbjct: 290 CLGRNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNHYQQADTGTKMIHIGK 349

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRIVSKGISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI+ +N
Sbjct: 350 NTRSRIVSKGISAGHSQNSYRGLVKIGPKATGARNYSQCDSMLIGDTAAANTFPYIQVQN 409

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEA+TSKI ++ LFY  QRGI  E A++++++GF R+V  +LPMEFAVEA +L+
Sbjct: 410 PTAQVEHEASTSKIGEDQLFYFAQRGISAEDAVSMMISGFCRDVFNQLPMEFAVEADRLL 469

Query: 481 DISLEGSVG 489
            + LEGSVG
Sbjct: 470 SLKLEGSVG 478


>gi|294013385|ref|YP_003546845.1| Fe-S cluster assembly protein SufB [Sphingobium japonicum UT26S]
 gi|292676715|dbj|BAI98233.1| Fe-S cluster assembly protein SufB [Sphingobium japonicum UT26S]
          Length = 494

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 341/494 (69%), Positives = 403/494 (81%), Gaps = 8/494 (1%)

Query: 4   VRETVDKVRKIDVDQ-------YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLE 56
           + E    VR ++  +       Y++G+ + I+ D APKGLNED +RFISAKK EP+W+LE
Sbjct: 1   MTEEATTVRNLEAHEAAERASAYEHGWSSAIEQDFAPKGLNEDTVRFISAKKKEPEWLLE 60

Query: 57  WRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLG 116
           WRL A+  W  M+ P WA++  P ID+ D YYYA PK     +SLD++DPE+  TYEKLG
Sbjct: 61  WRLKAFAMWQQMESPDWAKLNIPPIDYQDAYYYAEPKKKAELESLDELDPEIRATYEKLG 120

Query: 117 IPIREQEILAGVQTS-KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           IPI EQE+LAGV+ S KVAVDAVFDSVSV TTF++EL+++GVIF  ISEA+ E+PDLVKK
Sbjct: 121 IPIAEQEVLAGVKNSRKVAVDAVFDSVSVATTFRKELEEAGVIFRSISEAVREYPDLVKK 180

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           +L  VVP+ DN++A LN AVF+DG+FVYIPKGVRCPMELSTYFRIN + TGQFERTLI+A
Sbjct: 181 WLGKVVPMHDNYFATLNCAVFSDGTFVYIPKGVRCPMELSTYFRINAENTGQFERTLIVA 240

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DEGSYVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFV
Sbjct: 241 DEGSYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFV 300

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR  C+G  SK+SWTQ+ETGSAITWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM
Sbjct: 301 TKRALCQGRNSKVSWTQVETGSAITWKYPSCVLNGENSVGEFYSVALTNNLQQADTGTKM 360

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +H  K + S IVSKGISAG SNNTYRG V V  GA   RNFTQCDSLL+G+ CGAHT+PY
Sbjct: 361 IHNGKGSRSTIVSKGISAGRSNNTYRGLVRVAPGAEGVRNFTQCDSLLLGDQCGAHTVPY 420

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE +N S  +EHEATTSKISD+ LFY +QRG+ +EAA++LIVNGF REVLQ+LPMEFAVE
Sbjct: 421 IEVRNPSAQIEHEATTSKISDDQLFYAMQRGLDQEAAVSLIVNGFAREVLQQLPMEFAVE 480

Query: 476 AQKLIDISLEGSVG 489
           AQKL+ ISLEGSVG
Sbjct: 481 AQKLLGISLEGSVG 494


>gi|326801402|ref|YP_004319221.1| FeS assembly protein SufB [Sphingobacterium sp. 21]
 gi|326552166|gb|ADZ80551.1| FeS assembly protein SufB [Sphingobacterium sp. 21]
          Length = 483

 Score =  563 bits (1451), Expect = e-158,   Method: Composition-based stats.
 Identities = 329/489 (67%), Positives = 394/489 (80%), Gaps = 6/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    + +  ++++ V++YKYGF TNI++D A KGL+E+ +RFISAKK EP W+L+WRL 
Sbjct: 1   MSTKDDNI--LQELAVEEYKYGFTTNIEMDIAKKGLSEETVRFISAKKGEPAWLLDWRLK 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A R +  M  P W    +P +DF D+ YYAAPK      S+D+VDPELL T+ KLGIP+ 
Sbjct: 59  ALRHFEKMTMPKWQNFEHPKVDFQDISYYAAPKEKPKVNSMDEVDPELLDTFAKLGIPLD 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ++LAGV    VAVDAVFDSVSV TTF+E+LK+ GVIF    EA+ EHPDLVK+YL TV
Sbjct: 119 EQKVLAGV----VAVDAVFDSVSVKTTFREKLKEYGVIFCSFGEAVKEHPDLVKQYLGTV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN YAALN+AVF+DGSFVYIPKGV CPMELSTYFRIN + TGQFERTLIIADEGSY
Sbjct: 175 VPQTDNIYAALNAAVFSDGSFVYIPKGVNCPMELSTYFRINAQNTGQFERTLIIADEGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+AL+NAEIKYSTVQNWYPGD +G+GGIYNFVTKRG 
Sbjct: 235 VSYLEGCTAPMRDENQLHAAVVELIALENAEIKYSTVQNWYPGDKEGRGGIYNFVTKRGI 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C+G  SKISWTQ+ETGS+ITWKYPS +L+G+ S GEFYS+A++   Q  D+G+KM H+ K
Sbjct: 295 CKGDNSKISWTQVETGSSITWKYPSVILKGDNSVGEFYSVALTRNHQIADTGSKMYHIGK 354

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S+IVSKGISAG S N+YRG V + +GA  +RNFTQCDSLLIG+ CGAHT PYIE+KN
Sbjct: 355 NTRSKIVSKGISAGVSQNSYRGLVQIGKGAEKARNFTQCDSLLIGDKCGAHTFPYIEAKN 414

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  LEHEATTSKI ++ +FY  QRGI  E A+ LIVNG+ +EVL +LPMEFAVEAQKL+
Sbjct: 415 KTAKLEHEATTSKIGEDQIFYLTQRGIDPEKAVGLIVNGYAKEVLNQLPMEFAVEAQKLL 474

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 475 AISLEGSVG 483


>gi|312130463|ref|YP_003997803.1| iroN-regulated abc transporter membrane component sufb
           [Leadbetterella byssophila DSM 17132]
 gi|311907009|gb|ADQ17450.1| Iron-regulated ABC transporter membrane component SufB
           [Leadbetterella byssophila DSM 17132]
          Length = 481

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 330/486 (67%), Positives = 398/486 (81%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +  D + +I   +YKYGF T+I+ D+AP GL+EDI+RFISAKKNEP+WMLEWRL AYR
Sbjct: 1   MSKDTDILEEITSSEYKYGFYTDIEADEAPPGLSEDIVRFISAKKNEPEWMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W  M +P+WA + Y   DF  + YY+APK      SLD+VDPEL +T+EKLGI + EQ+
Sbjct: 61  EWEKMTEPNWANVTYEKPDFQAIKYYSAPKQQKKLNSLDEVDPELRKTFEKLGISLSEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            ++G     VAVDAV DSVSV TTF+ EL + G+IF  ISEAI E+PDLVKKYL +VVPV
Sbjct: 121 RISG-----VAVDAVIDSVSVATTFRAELAEKGIIFCSISEAIKEYPDLVKKYLGSVVPV 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNFY+ALNSAVF+DGSF YIPKGVRCPMELSTYFRIN  GTGQFERTLIIADEG+YVSY
Sbjct: 176 KDNFYSALNSAVFSDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTLIIADEGAYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVE+ A +NAE+KYSTVQNWYPGD +GKGG++NFVTKRG C G
Sbjct: 236 LEGCTAPMRDENQLHAAVVEIFAHENAEVKYSTVQNWYPGDKEGKGGVFNFVTKRGLCFG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
            RSKISWTQ+ETGSA+TWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ KNT 
Sbjct: 296 DRSKISWTQVETGSAVTWKYPSVILKGDNSIGEFYSVAVTNNFQQADTGTKMIHIGKNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N+YRG V + + A ++RNF+QCDS+L+G+ CGAHT PYIE  N + 
Sbjct: 356 SRIVSKGISAGRSQNSYRGLVEISKRADNARNFSQCDSMLLGDRCGAHTFPYIECNNPTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
           N+EHEATTSKI ++ LFYC QRGI  E A+ALI+NG+ +EVL +LPMEFAVEAQKL+ +S
Sbjct: 416 NVEHEATTSKIGEDQLFYCNQRGIDTETAVALIINGYAKEVLNQLPMEFAVEAQKLLAVS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|85709851|ref|ZP_01040916.1| ABC-type transport system [Erythrobacter sp. NAP1]
 gi|85688561|gb|EAQ28565.1| ABC-type transport system [Erythrobacter sp. NAP1]
          Length = 495

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 330/470 (70%), Positives = 397/470 (84%), Gaps = 1/470 (0%)

Query: 21  YGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPA 80
           +G+ ++I+ + A KGL+E+ +RFISAKK EP+WML+WRL A+R W  MK+P WA++ YPA
Sbjct: 26  HGWSSDIETEYAEKGLSEETVRFISAKKGEPEWMLDWRLKAFRLWQEMKEPDWAKVGYPA 85

Query: 81  IDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVAVDAVF 139
           ID+ D YYYAAPK     +SLD++DPE+   Y+KLGIP+ EQE+LAGV+   KVAVDAVF
Sbjct: 86  IDYQDAYYYAAPKKKPTLKSLDELDPEIKAVYDKLGIPVAEQEVLAGVEGARKVAVDAVF 145

Query: 140 DSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDG 199
           DSVSV TTF+EELKK+GVIF+ ISEAI E+PDLVKK+L  VVP  DN++A LNSAVF+DG
Sbjct: 146 DSVSVATTFREELKKAGVIFLSISEAIKEYPDLVKKWLGRVVPQRDNYFACLNSAVFSDG 205

Query: 200 SFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHA 259
           +FVY+P+GVRCPMELSTYFRIN + TGQFERTLI+A++GSYVSYLEGCTAP RDENQLHA
Sbjct: 206 TFVYVPEGVRCPMELSTYFRINAENTGQFERTLIVAEKGSYVSYLEGCTAPMRDENQLHA 265

Query: 260 AVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAI 319
           AVVELVA+++AEIKYSTVQNWYPG+S+G GGIYNFVTKRG C+G RSKISWTQ+ETGSA+
Sbjct: 266 AVVELVAMEDAEIKYSTVQNWYPGNSEGVGGIYNFVTKRGLCQGDRSKISWTQVETGSAV 325

Query: 320 TWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNT 379
           TWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H    + S I+SKGISAG SNNT
Sbjct: 326 TWKYPSCVLNGKDSVGEFYSVAVTNNHQQADTGTKMIHNGAGSRSTIISKGISAGKSNNT 385

Query: 380 YRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHL 439
           YRG V V   A   RNFTQCDSLL+GN CGAHT+PYIE KN    +EHEATTSKISDE L
Sbjct: 386 YRGLVRVGPKAEGVRNFTQCDSLLLGNECGAHTVPYIEVKNPGAQIEHEATTSKISDEQL 445

Query: 440 FYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           FY +QRG+ EE A+ALIVNGF ++VL++LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 446 FYAMQRGLDEEDAVALIVNGFAKDVLKELPMEFAVEAQKLLAISLEGSVG 495


>gi|218245297|ref|YP_002370668.1| cysteine desulfurase activator complex subunit SufB [Cyanothece sp.
           PCC 8801]
 gi|218165775|gb|ACK64512.1| FeS assembly protein SufB [Cyanothece sp. PCC 8801]
          Length = 480

 Score =  563 bits (1450), Expect = e-158,   Method: Composition-based stats.
 Identities = 316/490 (64%), Positives = 387/490 (78%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GLNEDIIR ISAKKNEPD+ML +RL 
Sbjct: 1   MSATS-----VKTLVNQPYKYGFVTDIETDTIPRGLNEDIIRLISAKKNEPDFMLAFRLR 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY++W  M +P+W  + YP ID+ ++ YY+APK       SLD+VDP LL T+EKLGIP+
Sbjct: 56  AYQQWQKMTEPTWPHVTYPPIDYQNIIYYSAPKQKKEKLGSLDEVDPTLLETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L       VAVDA+FDSVS+ TTFKE+L +SGVIF  ISEA+ EHP+LVKKYL T
Sbjct: 116 SEQKRL-----GNVAVDAIFDSVSIATTFKEKLAESGVIFCSISEALQEHPELVKKYLGT 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVADNFFAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAA+VELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDSNQLHAAIVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 KNTRSTIISKGISAGGSKNSYRGLVKIGPKADGARNYSQCDSMLIGDNAQANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI EE A++++V+GF ++VL +LPMEFA EA KL
Sbjct: 411 NNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|255532928|ref|YP_003093300.1| cysteine desulfurase activator complex subunit SufB [Pedobacter
           heparinus DSM 2366]
 gi|255345912|gb|ACU05238.1| FeS assembly protein SufB [Pedobacter heparinus DSM 2366]
          Length = 481

 Score =  562 bits (1449), Expect = e-158,   Method: Composition-based stats.
 Identities = 327/486 (67%), Positives = 396/486 (81%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           ++E  D +    +++YKYGF T I  D  PKGLNED+IR IS KKNEP+WMLEWRL AY+
Sbjct: 1   MKEQQDAIDHAVLNEYKYGFVTEIDTDAIPKGLNEDVIRLISNKKNEPEWMLEWRLKAYK 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WL+M++P+W  ++YP I++ D+ YYAAPK      SLD+VDPELL T+EKLGI I EQ+
Sbjct: 61  YWLSMEEPTWPNVKYPPINYQDIIYYAAPKPKKQLNSLDEVDPELLSTFEKLGISISEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     VA+D V DSVS+ T+FKE+L + GVIF  ISEAI  HP+LVKKYL +VVP+
Sbjct: 121 RLSG-----VAIDVVMDSVSIATSFKEQLSEIGVIFCSISEAIQLHPELVKKYLGSVVPM 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN++AALNSAVFTDGSF +IPKGVRCPMELSTYFRIN + +GQFERTLI+A++ SYVSY
Sbjct: 176 TDNYFAALNSAVFTDGSFCFIPKGVRCPMELSTYFRINTENSGQFERTLIVAEDESYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVEL+A++ AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPMRDENQLHAAVVELIAMEKAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGICKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A +N  QQ D+GTKM+HL KNT 
Sbjct: 296 NHSKISWTQVETGSAITWKYPSVILKGDNSIGEFYSVAFTNNHQQADTGTKMIHLGKNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIV+KGISAG S N+YRG V   + A ++RN++QCDSLL+G+ CGAHT PYIE KN S 
Sbjct: 356 SRIVAKGISAGHSQNSYRGLVRTSKQALNARNYSQCDSLLLGDKCGAHTFPYIEVKNKSA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ LFYC QRGI  EAA+ALIVNGF +EV+ +LPMEFA+EAQKL+ IS
Sbjct: 416 IVEHEATTSKIGEDQLFYCRQRGIDPEAAVALIVNGFAKEVMNQLPMEFAIEAQKLLAIS 475

Query: 484 LEGSVG 489
           +EGSVG
Sbjct: 476 MEGSVG 481


>gi|218441628|ref|YP_002379957.1| cysteine desulfurase activator complex subunit SufB [Cyanothece sp.
           PCC 7424]
 gi|218174356|gb|ACK73089.1| FeS assembly protein SufB [Cyanothece sp. PCC 7424]
          Length = 480

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 314/490 (64%), Positives = 389/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +  P+GLNEDIIR ISAKKNEP++ML++RL 
Sbjct: 1   MSATS-----VKTLVNQPYKYGFITDIESETVPRGLNEDIIRLISAKKNEPEFMLDFRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AYR+W  M +P+W  + YP ID+ ++ YY+APK+      SLD+VDP LL T+EKLGIP+
Sbjct: 56  AYRQWQKMTEPTWPHVSYPPIDYQNIIYYSAPKTKKVKLDSLDEVDPALLETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVS+ TTFKE+L + GVIF  ISEA+ EHPDLV+KYL +
Sbjct: 116 SEQKRLS-----NVAVDAIFDSVSIATTFKEKLAEEGVIFCSISEALQEHPDLVQKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN++AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLIIA+EG+
Sbjct: 171 VVPVNDNYFAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINNGETGQFERTLIIAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP  D NQLHAAVVELV LDNAEIKYSTVQNW+ GD  GKGGIYNFVTKRG
Sbjct: 231 YVSYLEGCTAPMYDTNQLHAAVVELVTLDNAEIKYSTVQNWFAGDENGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +  GA  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 KNTRSTIISKGISAGNSKNSYRGLVKMSPGAKGARNYSQCDSMLIGDNAEANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRG+ EE AI+++V+GF ++VL  LPMEFA EA KL
Sbjct: 411 NNTAKVEHEASTSKIGEDQLFYFAQRGVSEEDAISMLVSGFCKDVLSALPMEFAAEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|254464031|ref|ZP_05077442.1| FeS assembly protein SufB [Rhodobacterales bacterium Y4I]
 gi|206684939|gb|EDZ45421.1| FeS assembly protein SufB [Rhodobacterales bacterium Y4I]
          Length = 507

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 349/494 (70%), Positives = 411/494 (83%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ET+I+++ APKGL  DI+R IS K  EP+WML WRL AY R
Sbjct: 15  QETVDAVREVG-GAYKYGWETDIEMEYAPKGLTTDIVRLISEKNEEPEWMLNWRLEAYDR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL  ++P+WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WLQKEEPTWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF++ELK++GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAGQTPEEGRKVAVDAVFDSVSVGTTFQKELKEAGVIFCSISEAIREHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TVVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGTVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPARDIAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 IHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|220908824|ref|YP_002484135.1| cysteine desulfurase activator complex subunit SufB [Cyanothece sp.
           PCC 7425]
 gi|219865435|gb|ACL45774.1| FeS assembly protein SufB [Cyanothece sp. PCC 7425]
          Length = 479

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 310/480 (64%), Positives = 385/480 (80%), Gaps = 6/480 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +    YKYGF T+I+ +  P+GLNED+IR ISAKKNEP +ML++RL AYR+WL M +
Sbjct: 5   VKSLVNQPYKYGFVTDIESETIPRGLNEDVIRLISAKKNEPQFMLDFRLKAYRQWLKMTE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           P W  ++YP I++ D+ YY+APK       SL++VDP LL T+EKLGIP+ EQ+ L    
Sbjct: 65  PDWPNVKYPPINYQDIVYYSAPKQPKKKLNSLEEVDPVLLETFEKLGIPLSEQKRL---- 120

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDA+FDSVSV TTF+E+L K GVIF  ISEA+ E+P+LV+KY+ +VVPVGDN+YA
Sbjct: 121 -GNVAVDAIFDSVSVATTFREKLAKEGVIFCSISEALQEYPELVEKYIGSVVPVGDNYYA 179

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFVYIPK   CPMELSTYFRIN   +GQFERTLI+A+EGSYVSYLEGCTA
Sbjct: 180 ALNSAVFSDGSFVYIPKNTHCPMELSTYFRINNGESGQFERTLIVAEEGSYVSYLEGCTA 239

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG C+G  SKIS
Sbjct: 240 PMFDTNQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGKNSKIS 299

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SK
Sbjct: 300 WTQVETGSAITWKYPSCVLIGDNSVGEFYSVALTNNCQQADTGTKMIHIGKNTRSTIISK 359

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG SNN+YRG V +   A  +RN++QCDS+LIG+N GA+T PYI+ +N++  +EHEA
Sbjct: 360 GISAGRSNNSYRGLVKMGPKAEGARNYSQCDSMLIGDNAGANTFPYIQVQNNTAKVEHEA 419

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ LFY  QRGI  E AI+++++GF ++V  +LPMEFAVEA +L+ + LEGSVG
Sbjct: 420 STSKIGEDQLFYFAQRGISAEDAISMMISGFCKDVFNQLPMEFAVEADRLLSLKLEGSVG 479


>gi|258593120|emb|CBE69431.1| transport protein associated with Fe-S cluster assembly [NC10
           bacterium 'Dutch sediment']
          Length = 491

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 322/492 (65%), Positives = 393/492 (79%), Gaps = 10/492 (2%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A+      +  +   +YKYGF T I+ +  P GLNE+I+R ISAKK+EPDWML+WRL AY
Sbjct: 5   AMNSRSKAIEALTNQEYKYGFVTEIEEEAVPHGLNEEIVRLISAKKHEPDWMLQWRLKAY 64

Query: 63  RRWLTMK----DPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGI 117
           R W  ++    +P WA ++YP ID+  + YYAAPK    GP+SLD+VDP+LL T+EKLGI
Sbjct: 65  RHWAKLEKSEAEPKWANVKYPPIDYQGIRYYAAPKQKTEGPKSLDEVDPKLLETFEKLGI 124

Query: 118 PIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYL 177
           P+ E++ L+G+     AVDAVFDSVSV TTFK +L + G+IF   SEA+  HPDL++KYL
Sbjct: 125 PLAERKRLSGI-----AVDAVFDSVSVATTFKGKLGELGIIFCSFSEAVQNHPDLIRKYL 179

Query: 178 STVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADE 237
            +VVP  DNF+A LNSAVF+DGSF YIPKGVRCPMELSTYFRIN   TGQFERTLIIADE
Sbjct: 180 GSVVPYTDNFFATLNSAVFSDGSFCYIPKGVRCPMELSTYFRINAAETGQFERTLIIADE 239

Query: 238 GSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTK 297
           G+YVSYLEGCTAP RDENQLHAAVVEL+A D+A+IKYSTVQNWYPGD +GKGGIYNFVTK
Sbjct: 240 GAYVSYLEGCTAPMRDENQLHAAVVELIAHDDAQIKYSTVQNWYPGDKEGKGGIYNFVTK 299

Query: 298 RGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLH 357
           RG C G R+KISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+H
Sbjct: 300 RGKCLGRRAKISWTQVETGSAITWKYPSCILQGDDSTGEFYSVALTNHYQQADTGTKMIH 359

Query: 358 LAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIE 417
           L K+T S I+SKGISAG   N+YRG V + +GA  +RN++QCDSLL+G+ CGAHT PY+E
Sbjct: 360 LGKHTRSTIISKGISAGHGQNSYRGLVKIMKGATGARNYSQCDSLLLGDQCGAHTFPYLE 419

Query: 418 SKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQ 477
             N S  LEHEA+TSKI ++ LFYC QRGI  E A+ LIVNGF + VL++LPMEFAVEAQ
Sbjct: 420 VNNDSSQLEHEASTSKIGEDQLFYCKQRGISAEDAVNLIVNGFCKTVLRELPMEFAVEAQ 479

Query: 478 KLIDISLEGSVG 489
           KL+ +SLEGSVG
Sbjct: 480 KLLGVSLEGSVG 491


>gi|302841908|ref|XP_002952498.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
 gi|300262137|gb|EFJ46345.1| iron-sulfur cluster assembly protein [Volvox carteri f.
           nagariensis]
          Length = 535

 Score =  562 bits (1448), Expect = e-158,   Method: Composition-based stats.
 Identities = 312/485 (64%), Positives = 382/485 (78%), Gaps = 5/485 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            +    ++KI    YKYGF+T I+ D  PKGLNED++R ISAKK EP+WMLE+RL AYR+
Sbjct: 56  SDEKRDIQKILDRPYKYGFKTIIESDTFPKGLNEDVVRAISAKKGEPEWMLEFRLKAYRK 115

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
           WLTM++P W+   YP ID+ D+ YY+ PK     +SL++VDPELL+T+EKLGIP+ EQ+ 
Sbjct: 116 WLTMEEPKWSDNAYPEIDYQDVSYYSEPKVKEKLKSLEEVDPELLKTFEKLGIPLNEQKR 175

Query: 125 LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVG 184
           LA      VAVDAVFDSVS+ TTFKE+LKK GVIF  ISEA+ E+PDLVKKY+ +VVPVG
Sbjct: 176 LA-----NVAVDAVFDSVSIATTFKEDLKKHGVIFCSISEALKEYPDLVKKYMGSVVPVG 230

Query: 185 DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYL 244
           DN++AALNSAVF+DGSFV++PKGV+CPMELSTYFRIN   TGQFERTLI+A+EGSYVSYL
Sbjct: 231 DNYFAALNSAVFSDGSFVFVPKGVKCPMELSTYFRINASETGQFERTLIVAEEGSYVSYL 290

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           EGCTAP  D NQLHAAVVEL    +AEIKYSTVQNWY GD+ GKGGIYNFVTKRG C G 
Sbjct: 291 EGCTAPAYDSNQLHAAVVELYCEKDAEIKYSTVQNWYAGDANGKGGIYNFVTKRGMCAGP 350

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            SKISWTQ+ETGS+ITWKYPS +L G+ S GEFYS+A++N  QQ D+GTKM+H+ +NT S
Sbjct: 351 NSKISWTQVETGSSITWKYPSVVLAGDNSVGEFYSVALTNNCQQADTGTKMIHVGRNTRS 410

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
           RIVSKGISAG S N YRG V V   A  +RNF+QCDS+LIG+  GA+T PYI+ +  S  
Sbjct: 411 RIVSKGISAGTSRNCYRGLVQVMPSAKGARNFSQCDSMLIGDRAGANTYPYIQVREPSAV 470

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISL 484
           +EHEA+TSKI ++ LFY  QRGI  E A+  I++GF REV  +LP+EFA E  +L+ + L
Sbjct: 471 VEHEASTSKIGEDQLFYFQQRGIDPEKAVGAIISGFCREVFNELPLEFAAEVNELMSLKL 530

Query: 485 EGSVG 489
           EG+VG
Sbjct: 531 EGTVG 535


>gi|149185218|ref|ZP_01863535.1| component of SufBCD complex [Erythrobacter sp. SD-21]
 gi|148831329|gb|EDL49763.1| component of SufBCD complex [Erythrobacter sp. SD-21]
          Length = 493

 Score =  562 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 332/472 (70%), Positives = 396/472 (83%), Gaps = 1/472 (0%)

Query: 19  YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRY 78
           Y++G+ ++I+ + A KGL ED +RFISAKKNEP+WML+WRL A+R W  M++P WA++ Y
Sbjct: 22  YEHGWSSDIETEFAEKGLTEDTVRFISAKKNEPEWMLDWRLKAFRMWQEMEEPDWAKLGY 81

Query: 79  PAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVAVDA 137
           P ID+ D YYYAAPK     +SLD++DP +  TYEKLGIPI EQE+LAGV+   KVAVDA
Sbjct: 82  PEIDYQDAYYYAAPKKKPELESLDELDPAIRETYEKLGIPIAEQEVLAGVKGARKVAVDA 141

Query: 138 VFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFT 197
           VFDSVSV TTF+EELKK+GVIF+ ISEAI E+P+LVKK+L  VVP  DNF+A LN AVF+
Sbjct: 142 VFDSVSVATTFREELKKAGVIFLSISEAIREYPELVKKWLGKVVPQKDNFFATLNCAVFS 201

Query: 198 DGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQL 257
           DG+FVY+P+GVRCPMELSTYFRIN + TGQFERTLI+A++GSYVSYLEGCTAP RDENQL
Sbjct: 202 DGTFVYVPEGVRCPMELSTYFRINAENTGQFERTLIVAEKGSYVSYLEGCTAPMRDENQL 261

Query: 258 HAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGS 317
           HAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKR  C+G RSK+SWTQ+ETGS
Sbjct: 262 HAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFVTKRALCQGARSKVSWTQVETGS 321

Query: 318 AITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSN 377
           A+TWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+H  K + S I+SKGISAG SN
Sbjct: 322 AVTWKYPSCVLNGQDSVGEFYSVAVTNNYQQADTGTKMVHNGKGSRSTIISKGISAGKSN 381

Query: 378 NTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDE 437
           NTYRG V V   A   RN T+CDSLLIG+ CGAHT+PYIE KN    +EHEATTSKISD+
Sbjct: 382 NTYRGLVRVAANADGVRNRTECDSLLIGDECGAHTVPYIEVKNPGAQIEHEATTSKISDD 441

Query: 438 HLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
            LFY +QRG+ +E AIALIVNGF +EVL++LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 442 QLFYAMQRGLDDEEAIALIVNGFAKEVLKELPMEFAVEAQKLLAISLEGSVG 493


>gi|254461529|ref|ZP_05074945.1| FeS assembly protein SufB [Rhodobacterales bacterium HTCC2083]
 gi|206678118|gb|EDZ42605.1| FeS assembly protein SufB [Rhodobacteraceae bacterium HTCC2083]
          Length = 511

 Score =  562 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 357/495 (72%), Positives = 416/495 (84%), Gaps = 11/495 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ T+I+++ APKGLNEDI+R IS+K +EP WMLEWRL AYRR
Sbjct: 18  QETVDAVREVG-GAYKYGWSTDIEMEYAPKGLNEDIVRLISSKNDEPKWMLEWRLEAYRR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT  +P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY KLGIP++EQ 
Sbjct: 77  WLTKVEPDWAMVDYPEIDFQDQYYYARPKSMAVKPKSLDEVDPKLLATYAKLGIPLKEQM 136

Query: 124 ILAGVQT---------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVK 174
           ILAGV+           KVAVDAVFDSVSV TTF++ELKK+GVIF  ISEAI +HP+LVK
Sbjct: 137 ILAGVEGAEDIDAKAPRKVAVDAVFDSVSVGTTFQDELKKAGVIFCSISEAIKDHPELVK 196

Query: 175 KYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLII 234
           KYL TVVPV DN+YA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFERTLII
Sbjct: 197 KYLGTVVPVSDNYYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFERTLII 256

Query: 235 ADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNF 294
           AD+GSYVSYLEGCTAPQRDE+QLHAAVVE++  ++AE+KYSTVQNWYPGD +GKGGIYNF
Sbjct: 257 ADKGSYVSYLEGCTAPQRDESQLHAAVVEIIIEEDAEVKYSTVQNWYPGDEEGKGGIYNF 316

Query: 295 VTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTK 354
           VTKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTK
Sbjct: 317 VTKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTK 376

Query: 355 MLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIP 414
           M+HL KNT SRIVSKGISAG + NTYRG VS+H  A  +RNFTQCDSLLIG+ CGAHT+P
Sbjct: 377 MIHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDARNFTQCDSLLIGDQCGAHTVP 436

Query: 415 YIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAV 474
           YIE KN+S  +EHEATTSK+ DE LFYC QRGI EE A+AL+VNGF +EVLQ LPMEFA+
Sbjct: 437 YIEVKNNSARVEHEATTSKVDDEQLFYCRQRGIGEEDAVALVVNGFCKEVLQALPMEFAM 496

Query: 475 EAQKLIDISLEGSVG 489
           EAQ+L+ ISLEGSVG
Sbjct: 497 EAQQLVAISLEGSVG 511


>gi|260574651|ref|ZP_05842654.1| FeS assembly protein SufB [Rhodobacter sp. SW2]
 gi|259023068|gb|EEW26361.1| FeS assembly protein SufB [Rhodobacter sp. SW2]
          Length = 502

 Score =  562 bits (1447), Expect = e-158,   Method: Composition-based stats.
 Identities = 346/490 (70%), Positives = 410/490 (83%), Gaps = 6/490 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RET++ V  +   +YKYG+ET I++D APKG++EDI+R ISAK  EP+WML+WRL AYRR
Sbjct: 14  RETIEAVHAM-SGKYKYGWETEIEMDFAPKGVSEDIVRLISAKNGEPEWMLDWRLAAYRR 72

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W+TM +P WA + YP ID+ D+YYYA PKS+   P+SLD+VDP+LL TY KLGIP++EQ 
Sbjct: 73  WVTMTEPRWAMLHYPEIDYQDIYYYAKPKSMAGKPKSLDEVDPKLLATYAKLGIPLKEQA 132

Query: 124 ILAGVQ----TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            LAGVQ      +VAVDAVFDSVSV TTFK EL K+GVIF  ISEA+ +HPDLV+KY+ +
Sbjct: 133 FLAGVQDEAAPRRVAVDAVFDSVSVGTTFKAELAKAGVIFCSISEALRDHPDLVRKYIGS 192

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++A LNSAVF+DGSFVYIP+GVRCPMELSTYFRIN + TGQFERTLIIA++GS
Sbjct: 193 VVPQTDNYFATLNSAVFSDGSFVYIPEGVRCPMELSTYFRINAENTGQFERTLIIAEKGS 252

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           +VSYLEGCTAP+RD NQLHAAVVE+V L++AE+KYSTVQNWYPGD  G GGIYNFVTKR 
Sbjct: 253 HVSYLEGCTAPKRDTNQLHAAVVEIVILEDAEVKYSTVQNWYPGDENGVGGIYNFVTKRA 312

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG R+K+ WTQ+ETGSAITWKYPSC+LRGE S GEFYSIAI+N  QQ D+GTKM+HL 
Sbjct: 313 DCRGARAKVMWTQVETGSAITWKYPSCILRGEASQGEFYSIAIANNAQQADTGTKMIHLG 372

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PYIE K
Sbjct: 373 KNTRSRIVSKGISAGRAQNTYRGLVSMHPKATGSRNYTQCDSLLIGDKCGAHTVPYIEVK 432

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S  +EHEATTSK+ DE LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEFA+EAQ L
Sbjct: 433 NNSSRVEHEATTSKVDDEQLFYCRSRGMDEEEAVALVVNGFCKEVLQSLPMEFALEAQAL 492

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 493 VAISLEGSVG 502


>gi|288940479|ref|YP_003442719.1| FeS assembly protein SufB [Allochromatium vinosum DSM 180]
 gi|288895851|gb|ADC61687.1| FeS assembly protein SufB [Allochromatium vinosum DSM 180]
          Length = 481

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 323/481 (67%), Positives = 392/481 (81%), Gaps = 6/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V  I   +Y++GF T I+ D  P GL+E+++R IS +K EP++M E RL AYR WLTM+
Sbjct: 6   AVEDIVKSEYEHGFTTEIESDTLPPGLDEEVVRAISKRKGEPEFMTEQRLKAYRHWLTMR 65

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           +P WA + YP IDF  + YY+APK     P+SLD++DP LL TY KLGIPI EQ+ LAG+
Sbjct: 66  EPEWAAVDYPRIDFQAISYYSAPKRPEDMPKSLDEIDPALLETYNKLGIPIEEQKALAGI 125

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
                AVDAVFDSVSV TTF+  L ++GVIF  ISEA+ E+P+LVK YL TVVP  DNFY
Sbjct: 126 -----AVDAVFDSVSVATTFRATLAEAGVIFCSISEALHEYPELVKPYLGTVVPYTDNFY 180

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           A LN+AVF+DG+FVY+PKGVRCPMELSTYFRIN + TGQFERTLI+A+ GSYVSYLEGCT
Sbjct: 181 ACLNAAVFSDGTFVYVPKGVRCPMELSTYFRINARNTGQFERTLIVAEAGSYVSYLEGCT 240

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           APQRDENQLHAAVVEL+A+++AEIKYSTVQNWYPGD++G+GGIYNFVTKRGDCRG RSKI
Sbjct: 241 APQRDENQLHAAVVELIAMEDAEIKYSTVQNWYPGDAEGRGGIYNFVTKRGDCRGARSKI 300

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++ G QQ D+GTKM+H+ +NT+S IVS
Sbjct: 301 SWTQVETGSAITWKYPSCILRGDGSIGEFYSVAVTKGRQQADTGTKMIHIGRNTSSTIVS 360

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG  + TYRG V + + A  +RN TQCDSLLIG+ C A+T+PYIE KN S  +EHE
Sbjct: 361 KGISAGEGSQTYRGLVRIGQRAEGARNHTQCDSLLIGDRCAANTVPYIEVKNPSAKMEHE 420

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSKISD+ LFYC  RG+ EE A+++IVNGF +EV  +LPMEFAVEAQKL+ ISLEG+V
Sbjct: 421 ATTSKISDDQLFYCRSRGLTEEDAVSMIVNGFCKEVFNELPMEFAVEAQKLLSISLEGAV 480

Query: 489 G 489
           G
Sbjct: 481 G 481


>gi|87198221|ref|YP_495478.1| cysteine desulfurase activator complex subunit SufB
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87133902|gb|ABD24644.1| Iron-regulated ABC transporter membrane component SufB
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 493

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 339/493 (68%), Positives = 409/493 (82%), Gaps = 4/493 (0%)

Query: 1   MVAVRETVDKVRKIDVDQ---YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEW 57
           M    E  D+  +    +   Y++G+ ++I+ +  PKGL+ED +RFISAKK+EP+WMLEW
Sbjct: 1   MTDNTEVKDQAAREAAARVAEYEHGWVSDIEQEYGPKGLSEDTVRFISAKKDEPEWMLEW 60

Query: 58  RLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGI 117
           RL AYR WLTM  P WA++  P ID+ + YY+AAPK+     SLD+VDPE+LR YEKLGI
Sbjct: 61  RLKAYRHWLTMPTPEWAKLNIPPIDYQEAYYWAAPKAKPKLGSLDEVDPEILRVYEKLGI 120

Query: 118 PIREQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           P+ EQ++LAGV+   KVAVDAVFDSVSV TTF++EL+ +GVIF  ISEAI E+PDLV+K+
Sbjct: 121 PLEEQKVLAGVEGARKVAVDAVFDSVSVATTFRKELEAAGVIFRSISEAIREYPDLVRKW 180

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L  VVP+ DN++A LN AVF+DG+FVYIP+GVRCPMELSTYFRIN + TGQFERTLI+AD
Sbjct: 181 LGKVVPMHDNYFATLNCAVFSDGTFVYIPEGVRCPMELSTYFRINAENTGQFERTLIVAD 240

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD++G+GGIYNFVT
Sbjct: 241 KGSYVSYLEGCTAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDAEGRGGIYNFVT 300

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KR  C+G RSK+SWTQ+ETGSAITWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM+
Sbjct: 301 KRALCQGARSKVSWTQVETGSAITWKYPSCVLNGEDSVGEFYSVAVTNNHQQADTGTKMI 360

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           H  K + S IVSKGISAG SNNTYRG V V   A   RNFTQCDSLL+G++CGAHT+PYI
Sbjct: 361 HNGKGSRSTIVSKGISAGKSNNTYRGLVRVAPQAEGVRNFTQCDSLLLGSDCGAHTVPYI 420

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E +N S  +EHEATTSKISD+ LFY +QRG+ +E+A+ALIVNGF REVLQ+LPMEFAVEA
Sbjct: 421 EVRNPSATIEHEATTSKISDDQLFYAMQRGLDQESAVALIVNGFAREVLQQLPMEFAVEA 480

Query: 477 QKLIDISLEGSVG 489
           QKL+ ISLEGSVG
Sbjct: 481 QKLLGISLEGSVG 493


>gi|307294772|ref|ZP_07574614.1| FeS assembly protein SufB [Sphingobium chlorophenolicum L-1]
 gi|306879246|gb|EFN10464.1| FeS assembly protein SufB [Sphingobium chlorophenolicum L-1]
          Length = 494

 Score =  561 bits (1446), Expect = e-158,   Method: Composition-based stats.
 Identities = 342/494 (69%), Positives = 403/494 (81%), Gaps = 8/494 (1%)

Query: 4   VRETVDKVRKIDVDQ-------YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLE 56
           + E    VR ++  +       Y++G+ + I+ D APKGLNED +RFISAKK EP+W+LE
Sbjct: 1   MTEEATTVRNLEAHEAAERASAYEHGWSSAIEQDFAPKGLNEDTVRFISAKKKEPEWLLE 60

Query: 57  WRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLG 116
           WRL A+  W  M+ P WA++  P ID+ D YYYA PK     +SLD++DPE+  TYEKLG
Sbjct: 61  WRLKAFAMWQKMESPDWAKLNIPPIDYQDAYYYAEPKKKAELESLDELDPEIRATYEKLG 120

Query: 117 IPIREQEILAGVQTS-KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           IPI EQE+LAGV+ S KVAVDAVFDSVSV TTF++EL+++GVIF  ISEA+ E+PDLVKK
Sbjct: 121 IPIAEQEVLAGVKNSRKVAVDAVFDSVSVATTFRKELEEAGVIFRSISEAVREYPDLVKK 180

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           +L  VVP+ DN++A LN AVF+DG+FVYIPKGVRCPMELSTYFRIN + TGQFERTLI+A
Sbjct: 181 WLGKVVPMHDNYFATLNCAVFSDGTFVYIPKGVRCPMELSTYFRINAENTGQFERTLIVA 240

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DEGSYVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFV
Sbjct: 241 DEGSYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFV 300

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR  C+G  SK+SWTQ+ETGSAITWKYPSC+L GE S GEFYS+A++N  QQ D+GTKM
Sbjct: 301 TKRALCQGRNSKVSWTQVETGSAITWKYPSCVLNGENSVGEFYSVALTNNLQQADTGTKM 360

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +H  K + S IVSKGISAG SNNTYRG V V  GA   RNFTQCDSLL+G+ CGAHT+PY
Sbjct: 361 IHNGKGSRSTIVSKGISAGRSNNTYRGLVRVAPGAEGVRNFTQCDSLLLGDQCGAHTVPY 420

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE +N S  +EHEATTSKISD+ LFY LQRG+ +EAA++LIVNGF REVLQ+LPMEFAVE
Sbjct: 421 IEVRNPSAQIEHEATTSKISDDQLFYALQRGLDQEAAVSLIVNGFAREVLQQLPMEFAVE 480

Query: 476 AQKLIDISLEGSVG 489
           AQKL+ ISLEGSVG
Sbjct: 481 AQKLLGISLEGSVG 494


>gi|99081083|ref|YP_613237.1| cysteine desulfurase activator complex subunit SufB [Ruegeria sp.
           TM1040]
 gi|99037363|gb|ABF63975.1| Iron-regulated ABC transporter membrane component SufB [Ruegeria
           sp. TM1040]
          Length = 506

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 347/494 (70%), Positives = 413/494 (83%), Gaps = 11/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG++T+I+++ APKG+N+DI+R IS K  EP+WM EWRL A+ R
Sbjct: 15  QETVDAVREV--STYKYGWDTDIEMEYAPKGVNQDIVRLISEKNEEPEWMTEWRLQAFER 72

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  MK+P+WA + YP IDF + YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 73  WEGMKEPNWAMVNYPEIDFQNQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 132

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF++ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 133 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQDELKKAGVIFCSISEAIREHPELVKK 192

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 193 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 252

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNW+PGD  GKGGIYNFV
Sbjct: 253 DKGSYVSYLEGCTAPQRDTAQLHAAVVEIIIEEDAEVKYSTVQNWFPGDENGKGGIYNFV 312

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM
Sbjct: 313 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKM 372

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K+T SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 373 IHLGKDTKSRIVSKGISAGKAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDKCGAHTVPY 432

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S   EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 433 IEVKNNSSRCEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 492

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 493 AQQLVAISLEGSVG 506


>gi|254476697|ref|ZP_05090083.1| FeS assembly protein SufB [Ruegeria sp. R11]
 gi|214030940|gb|EEB71775.1| FeS assembly protein SufB [Ruegeria sp. R11]
          Length = 507

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 351/494 (71%), Positives = 411/494 (83%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ET+I+++ APKG+N DI+R IS K  EP+WM EWRL A+ R
Sbjct: 15  QETVDAVREVG-GAYKYGWETDIEMEYAPKGVNPDIVRLISDKNEEPEWMTEWRLQAFER 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  M +P+WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WEKMDEPNWAMVNYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAEDMPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPVTDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPQRDTAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRGE+S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGEESQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 VHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|84516299|ref|ZP_01003659.1| FeS assembly protein SufB [Loktanella vestfoldensis SKA53]
 gi|84509995|gb|EAQ06452.1| FeS assembly protein SufB [Loktanella vestfoldensis SKA53]
          Length = 507

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 345/494 (69%), Positives = 406/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD V  +    YKYG+ET I++D APKG+N DI+R IS+K  EP+WM EWRL A+ R
Sbjct: 15  QDTVDAVTAL-SGNYKYGWETEIEMDYAPKGVNPDIVRLISSKNEEPEWMTEWRLQAFTR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  M +P+WA + YP IDF D+YYYA PKS+   P+SLDDVDP+LL TY KLGIP++EQ 
Sbjct: 74  WEKMNEPTWAMVSYPPIDFQDIYYYARPKSMAVKPKSLDDVDPKLLATYAKLGIPLKEQA 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI +HP+LVKK
Sbjct: 134 ILAGVEGAEDMPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIRDHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVP  DN+YA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPQSDNYYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP+RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPKRDVAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 VHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDQCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 494 AQALVAISLEGSVG 507


>gi|326386611|ref|ZP_08208233.1| cysteine desulfurase activator complex subunit SufB
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326208926|gb|EGD59721.1| cysteine desulfurase activator complex subunit SufB
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 512

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 334/469 (71%), Positives = 402/469 (85%), Gaps = 1/469 (0%)

Query: 22  GFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAI 81
           G+ ++I+ +  PKGL+ED +RFIS++KNEP+WMLEWRL AYR WLTM  P WA+++ P I
Sbjct: 44  GWVSDIEQEFGPKGLSEDTVRFISSRKNEPEWMLEWRLKAYRHWLTMPMPDWAKLKIPPI 103

Query: 82  DFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT-SKVAVDAVFD 140
           D+   YY+AAPKS  GP+SLD+VDPE+LR YEKLGIP+ EQ++LAGV+   KVAVDAVFD
Sbjct: 104 DYQAAYYWAAPKSKDGPKSLDEVDPEILRVYEKLGIPLEEQKVLAGVEGARKVAVDAVFD 163

Query: 141 SVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGS 200
           SVSV TTF++EL+ +GVIF  ISEAI E PDLV+++L  VVP+ DN+++ALN AVF+DG+
Sbjct: 164 SVSVATTFRKELEAAGVIFRSISEAIREFPDLVRRWLGKVVPMHDNYFSALNCAVFSDGT 223

Query: 201 FVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAA 260
           FVYIP+GVRCPMELSTYFRIN + TGQFERTLI+AD+G+YVSYLEGCTAPQRDENQLHAA
Sbjct: 224 FVYIPEGVRCPMELSTYFRINAENTGQFERTLIVADKGAYVSYLEGCTAPQRDENQLHAA 283

Query: 261 VVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAIT 320
           VVELVALD+AEIKYSTVQNWYPGD+QG+GGIYNFVTKR  C+G RSK+SWTQ+ETGSAIT
Sbjct: 284 VVELVALDDAEIKYSTVQNWYPGDAQGRGGIYNFVTKRALCQGARSKVSWTQVETGSAIT 343

Query: 321 WKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTY 380
           WKYPSC+L GE S GEFYS+A++N +QQ D+GTKM+H  K + S IVSKGISAG SNNTY
Sbjct: 344 WKYPSCVLNGEDSVGEFYSVAVTNNYQQADTGTKMIHNGKRSRSTIVSKGISAGHSNNTY 403

Query: 381 RGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLF 440
           RG V V   A   RNFTQCDSLL+G +CGAHT+PYIE +N +  +EHEATTSKISD+ +F
Sbjct: 404 RGLVRVAPQAEGVRNFTQCDSLLLGADCGAHTVPYIEVRNPTATVEHEATTSKISDDQMF 463

Query: 441 YCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           Y +QRG+ +E A+ALIVNGF REVLQ+LPMEFAVEAQKL+ ISLEGSVG
Sbjct: 464 YAMQRGLSQEDAVALIVNGFAREVLQQLPMEFAVEAQKLLGISLEGSVG 512


>gi|224823960|ref|ZP_03697068.1| FeS assembly protein SufB [Lutiella nitroferrum 2002]
 gi|224603379|gb|EEG09554.1| FeS assembly protein SufB [Lutiella nitroferrum 2002]
          Length = 482

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 314/487 (64%), Positives = 399/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  +  K+ ++   +Y++GF T+++ D  P+GL+E++IR ISAKK EPD++LEWRL AYR
Sbjct: 1   MASSTVKLDELISQEYRHGFFTSVETDTVPRGLSEEVIRLISAKKGEPDFLLEWRLRAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM +P W+ + +P ID+ D+ YY+APKS   GP+SLD++DPEL RTYEKLG+P+ E+
Sbjct: 61  HWLTMAEPHWSTVHHPPIDYQDIAYYSAPKSRQDGPKSLDEIDPELRRTYEKLGVPLEER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
            +LAG     VAVDAVFDSVSV TTFK++L   G+IF   SEA+ EHP+LV++YL +VVP
Sbjct: 121 ALLAG-----VAVDAVFDSVSVATTFKDKLAGLGIIFCSFSEAVREHPELVQQYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+A+LNSAVF+DGSF YIP GVRCPMELSTYFRIN + TGQFERTLIIAD+G+YVS
Sbjct: 176 YTDNFFASLNSAVFSDGSFCYIPPGVRCPMELSTYFRINARNTGQFERTLIIADKGAYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+AL++A+IKY+TVQNWYPGD +G GGIYNFVTKRGDCR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALEDAQIKYATVQNWYPGDKEGHGGIYNFVTKRGDCR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSAITWKYPS +L+G+ + GEFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 296 GDNSKISWTQVETGSAITWKYPSVILQGDNAVGEFYSVALTNHYQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG  +N YRG V V + A  +RN+TQCDSLL+G+ C AHT PYIE KN +
Sbjct: 356 RSTILSKGISAGHGSNAYRGLVKVAKSAVGARNYTQCDSLLLGDRCAAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TS+I ++ LFYC  RGI  E A+++IV+GF +EV ++LPMEFAVEAQKL+ +
Sbjct: 416 ARVEHEASTSRIGEDQLFYCQSRGIAPEDAVSMIVSGFCKEVFKELPMEFAVEAQKLLGV 475

Query: 483 SLEGSVG 489
           SLEGS+G
Sbjct: 476 SLEGSIG 482


>gi|300113346|ref|YP_003759921.1| FeS assembly protein SufB [Nitrosococcus watsonii C-113]
 gi|299539283|gb|ADJ27600.1| FeS assembly protein SufB [Nitrosococcus watsonii C-113]
          Length = 482

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 329/487 (67%), Positives = 397/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  +  KV  +   +Y+ GF T+I+ D  P GLNE++IR IS+KKNEP++MLEWRL AYR
Sbjct: 1   MTNSTLKVENLVQKEYRAGFITDIEADSIPPGLNENVIRLISSKKNEPEFMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WL MK P WA + YP +D+  + YY+APKS   GP+SLD+VDP+LL TYEKLG+P+ E+
Sbjct: 61  HWLEMKTPEWAHVHYPPVDYQSIIYYSAPKSKKDGPKSLDEVDPKLLETYEKLGVPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTFKE+L ++GVIF P SEA+ +HP+LV+KYL TVVP
Sbjct: 121 ARLAG-----VAVDAVFDSVSVATTFKEKLSEAGVIFCPFSEAVRDHPELVEKYLGTVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+PKGVRCP+ELSTYFRIN   TGQFERTLIIADEG++VS
Sbjct: 176 CRDNFYAALNSAVFSDGSFVYVPKGVRCPLELSTYFRINAAQTGQFERTLIIADEGAHVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVAL NAEIKYSTVQNWYPGD +G+GGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALGNAEIKYSTVQNWYPGDEEGRGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  +KISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ +NT
Sbjct: 296 GANAKISWTQVETGSAITWKYPSVILQGDNSVGEFYSVALTNNFQQADTGTKMIHMGRNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG   N YRG V V   A  +RN+TQCDSLL+G+ CGAHT PYIE K+ S
Sbjct: 356 RSTIISKGISAGRGQNAYRGLVRVTPTAVGARNYTQCDSLLLGDRCGAHTFPYIEVKHPS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKIS++ LFYC QRGI  E AI++IVNGF +EV ++LPMEFAVEA+ L+ +
Sbjct: 416 AQVEHEASTSKISEDQLFYCKQRGISAEDAISMIVNGFCKEVFKELPMEFAVEARNLLSV 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|16331744|ref|NP_442472.1| cysteine desulfurase activator complex subunit SufB [Synechocystis
           sp. PCC 6803]
 gi|3024872|sp|Q55790|Y074_SYNY3 RecName: Full=UPF0051 protein slr0074
 gi|1001705|dbj|BAA10542.1| ABC transporter subunit [Synechocystis sp. PCC 6803]
          Length = 480

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 313/481 (65%), Positives = 387/481 (80%), Gaps = 6/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V+ +    YKYGF TNI+ D  P+GL+ED++R ISAKKNEP++ML++RL AYR WLTM 
Sbjct: 5   TVKNLVNQPYKYGFVTNIEADAIPRGLSEDVVRLISAKKNEPEFMLDFRLRAYRHWLTMA 64

Query: 70  DPSWARIRYPAIDFDDLYYYAAPK-SIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           +P+W  + YP ID+ D+ YY+APK S    +SLD+VDP LL T+EKLGIP+ EQ+ L+  
Sbjct: 65  EPTWPAVHYPPIDYQDIIYYSAPKQSKKKLESLDEVDPALLETFEKLGIPLSEQKRLS-- 122

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDA+FDSVS+ TTFKE+L + GVIF  ISEA+ EHPDLV+KYL +VVP  DNF+
Sbjct: 123 ---NVAVDAIFDSVSIGTTFKEKLAEDGVIFCSISEALQEHPDLVQKYLGSVVPTADNFF 179

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLIIA+EG+ VSYLEGCT
Sbjct: 180 AALNSAVFSDGSFVFIPKGVKCPMELSTYFRINNGDTGQFERTLIIAEEGASVSYLEGCT 239

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD  GKGGIYNFVTKRG C+G+ SKI
Sbjct: 240 APMYDTNQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRGLCKGVNSKI 299

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ KNT S I+S
Sbjct: 300 SWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIGKNTRSIIIS 359

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI+  N++  +EHE
Sbjct: 360 KGISAGNSANSYRGLVKMGPKAQGARNYSQCDSMLIGDRAAANTFPYIQVDNNTAKVEHE 419

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LFY  QRGI EE A++++V+GF ++VL +LPMEFA EA KL+ + LEG+V
Sbjct: 420 ASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKLLSLKLEGTV 479

Query: 489 G 489
           G
Sbjct: 480 G 480


>gi|257058332|ref|YP_003136220.1| cysteine desulfurase activator complex subunit SufB [Cyanothece sp.
           PCC 8802]
 gi|256588498|gb|ACU99384.1| FeS assembly protein SufB [Cyanothece sp. PCC 8802]
          Length = 480

 Score =  561 bits (1445), Expect = e-157,   Method: Composition-based stats.
 Identities = 316/490 (64%), Positives = 387/490 (78%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GLNEDIIR ISAKKNEPD+ML +RL 
Sbjct: 1   MSATS-----VKTLVNQPYKYGFVTDIETDTIPRGLNEDIIRLISAKKNEPDFMLAFRLR 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY++W  M +P+W  + YP ID+ ++ YY+APK       SLD+VDP LL T+EKLGIP+
Sbjct: 56  AYQQWQKMTEPTWPHVTYPPIDYQNMIYYSAPKQKKEKLGSLDEVDPTLLETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L       VAVDA+FDSVS+ TTFKE+L +SGVIF  ISEA+ EHP+LVKKYL T
Sbjct: 116 SEQKRL-----GNVAVDAIFDSVSIATTFKEKLAESGVIFCSISEALQEHPELVKKYLGT 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNF+AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVADNFFAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAA+VELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDSNQLHAAIVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 KNTRSTIISKGISAGGSKNSYRGLVKIGPKADGARNYSQCDSMLIGDNAQANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI EE A++++V+GF ++VL +LPMEFA EA KL
Sbjct: 411 NNTAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLNELPMEFAAEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|255264718|ref|ZP_05344060.1| FeS assembly protein SufB [Thalassiobium sp. R2A62]
 gi|255107053|gb|EET49727.1| FeS assembly protein SufB [Thalassiobium sp. R2A62]
          Length = 503

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 350/490 (71%), Positives = 412/490 (84%), Gaps = 6/490 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD V+++    YKYG+ET I+++ APKGL+EDI+R IS+K +EP+WMLEWRL AYRR
Sbjct: 15  QDTVDAVKEL-SGTYKYGWETEIEMEYAPKGLSEDIVRLISSKNDEPEWMLEWRLAAYRR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL + +P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 74  WLELTEPDWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLETYKKLGIPLKEQA 133

Query: 124 ILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +LAGV+      KVAVDAVFDSVSV TTF+ EL K+GVIF  ISEAI EHP+LV+KYL +
Sbjct: 134 LLAGVEAPEEERKVAVDAVFDSVSVGTTFQAELAKAGVIFCSISEAIKEHPELVQKYLGS 193

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+YA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFERTLIIAD+ S
Sbjct: 194 VVPVSDNYYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFERTLIIADKES 253

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRD  QLHAAVVELV +D+AEIKYSTVQNW+PGD  GKGGIYNFVTKR 
Sbjct: 254 YVSYLEGCTAPQRDVAQLHAAVVELVLMDDAEIKYSTVQNWFPGDENGKGGIYNFVTKRA 313

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM+HL 
Sbjct: 314 DCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKMVHLG 373

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PYIE K
Sbjct: 374 KNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPYIEVK 433

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+EAQ L
Sbjct: 434 NNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAMEAQAL 493

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 494 VAISLEGSVG 503


>gi|91790107|ref|YP_551059.1| cysteine desulfurase activator complex subunit SufB [Polaromonas
           sp. JS666]
 gi|91699332|gb|ABE46161.1| Iron-regulated ABC transporter membrane component SufB [Polaromonas
           sp. JS666]
          Length = 482

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 323/487 (66%), Positives = 399/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  +  ++ K+    Y++GF T ++ D  P+GL+ED++R ISAKK EPD+ML+WRL AYR
Sbjct: 1   MANSTVQLDKLISQGYQHGFYTTVETDTVPRGLSEDVVRLISAKKGEPDFMLDWRLQAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM +P WA +R+P I + D+ YY+APKS   GPQSLDDVDPELLRTYEKLG+P+ E+
Sbjct: 61  HWLTMTEPRWATVRHPPITYQDIAYYSAPKSRKDGPQSLDDVDPELLRTYEKLGVPLEER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
            +LAG     VAVDAVFDSVSV TTFKE+L + G++F   SEA+ +HPDLV+KYL +VVP
Sbjct: 121 ALLAG-----VAVDAVFDSVSVATTFKEKLGELGIVFCSFSEAVQQHPDLVRKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+A LNSAVF+DGSF YIP GVRCPMELSTYFRIN + TGQFERTLIIAD+G+YVS
Sbjct: 176 YTDNFFATLNSAVFSDGSFCYIPPGVRCPMELSTYFRINAQNTGQFERTLIIADKGAYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+AL+ A+IKY+TVQNWYPGD +GKGGIYNFVTKRGDCR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALEGAQIKYATVQNWYPGDKEGKGGIYNFVTKRGDCR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSAITWKYPS +L+G+ + GEFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 296 GANSKISWTQVETGSAITWKYPSVILQGDNAVGEFYSVALTNHYQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG   N YRG V V +GAA +RN+TQCDSLL+G+ C AHT PYIE KN +
Sbjct: 356 RSTILSKGISAGHGQNAYRGLVKVAKGAAGARNYTQCDSLLLGDRCAAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TS+I ++ LFYC  RG+  E A+++IVNGF +EV ++LPMEFAVEAQKL+ +
Sbjct: 416 ARVEHEASTSRIGEDQLFYCQSRGLAPEDAVSMIVNGFCKEVFKELPMEFAVEAQKLLGV 475

Query: 483 SLEGSVG 489
           SLEGS+G
Sbjct: 476 SLEGSIG 482


>gi|77165948|ref|YP_344473.1| cysteine desulfurase activator complex subunit SufB [Nitrosococcus
           oceani ATCC 19707]
 gi|254434462|ref|ZP_05047970.1| FeS assembly protein SufB [Nitrosococcus oceani AFC27]
 gi|76884262|gb|ABA58943.1| Iron-regulated ABC transporter membrane component SufB
           [Nitrosococcus oceani ATCC 19707]
 gi|207090795|gb|EDZ68066.1| FeS assembly protein SufB [Nitrosococcus oceani AFC27]
          Length = 482

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 327/487 (67%), Positives = 397/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  +  KV  +   +Y+ GF T+I+ D  P GLNE++IR IS+KKNEP++MLEWRL AYR
Sbjct: 1   MTNSTLKVENLVQKEYRAGFVTDIEADSIPPGLNENVIRLISSKKNEPEFMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WL MK P WA + YP +D+  + YY+APKS   GP+SLD+VDP+LL TYEKLG+P+ E+
Sbjct: 61  HWLEMKTPEWAHVHYPPVDYQSIIYYSAPKSKKDGPKSLDEVDPKLLETYEKLGVPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTFKE+L ++GVIF P SEA+ ++P+LV+KYL TVVP
Sbjct: 121 ARLAG-----VAVDAVFDSVSVATTFKEKLSEAGVIFCPFSEAVRDYPELVEKYLGTVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+PKGVRCP+ELSTYFRIN   TGQFERTLIIADEG++VS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPKGVRCPLELSTYFRINAAQTGQFERTLIIADEGAHVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVAL +AEIKYSTVQNWYPGD +G+GGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALGDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  +KISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ +NT
Sbjct: 296 GANAKISWTQVETGSAITWKYPSVILQGDNSVGEFYSVALTNNFQQADTGTKMIHMGRNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG   N YRG V V   A  +RN+TQCDSLL+G+ CGAHT PYIE K+ S
Sbjct: 356 RSTIISKGISAGQGQNAYRGLVRVTPTAVGARNYTQCDSLLLGDRCGAHTFPYIEVKHPS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKIS++ LFYC QRGI  E AI++IVNGF +EV ++LPMEFAVEA+ L+ +
Sbjct: 416 AQVEHEASTSKISEDQLFYCKQRGISAEDAISMIVNGFCKEVFKELPMEFAVEARNLLSV 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|126736368|ref|ZP_01752110.1| FeS assembly protein SufB [Roseobacter sp. CCS2]
 gi|126714189|gb|EBA11058.1| FeS assembly protein SufB [Roseobacter sp. CCS2]
          Length = 507

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 345/494 (69%), Positives = 407/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD V+++    YKYG+ET I+++ APKG+N DI+R IS+K  EP+WM EWRL A+ R
Sbjct: 15  QDTVDAVKEL-SGNYKYGWETEIEMEYAPKGVNPDIVRLISSKNKEPEWMTEWRLSAFER 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  +++P+WA + YP IDF D+YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WEKIEEPTWAMVNYPDIDFQDIYYYARPKSMEEKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI  HP+LVKK
Sbjct: 134 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIENHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TVVP  DNFYA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGTVVPPSDNFYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP+RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  G GGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPKRDTAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDEDGNGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 VHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAQASRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 494 AQALVAISLEGSVG 507


>gi|227539031|ref|ZP_03969080.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Sphingobacterium spiritivorum ATCC 33300]
 gi|227241087|gb|EEI91102.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Sphingobacterium spiritivorum ATCC 33300]
          Length = 499

 Score =  560 bits (1444), Expect = e-157,   Method: Composition-based stats.
 Identities = 334/485 (68%), Positives = 395/485 (81%), Gaps = 4/485 (0%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            +  D +++++ ++YKYGF T+I++D AP GL ED +R IS KKNEP+W+LEWRL A+R 
Sbjct: 19  TKDDDILKELEQEEYKYGFTTDIEMDIAPTGLTEDTVRLISEKKNEPEWLLEWRLKAFRH 78

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
           +LT+K P+W   R P +DF  + YYAAPK+     SLD+VDPELL T+ KLGIP+ EQ+I
Sbjct: 79  FLTLKMPTWQNFRNPDVDFQAISYYAAPKAKPQLNSLDEVDPELLATFAKLGIPLDEQKI 138

Query: 125 LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVG 184
           LAGV    VAVDAVFDSVSV TTF+E+LK+ GVIF    EA+ E+P+LVK+YL TVVP  
Sbjct: 139 LAGV----VAVDAVFDSVSVKTTFREKLKEQGVIFCSFGEAVQEYPELVKEYLGTVVPQT 194

Query: 185 DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYL 244
           DN YAALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLIIADEGSYVSYL
Sbjct: 195 DNIYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAQNTGQFERTLIIADEGSYVSYL 254

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           EGCTAP RDENQLHAAVVELVA  +AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C+G 
Sbjct: 255 EGCTAPTRDENQLHAAVVELVAQRDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGICKGD 314

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            SKISWTQ+ETGSAITWKYP  +L+G+ S GEFYS+A++   Q  D+GTKM+HL KNT S
Sbjct: 315 NSKISWTQVETGSAITWKYPGVILKGDNSVGEFYSVALTRNMQVADTGTKMIHLGKNTRS 374

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
           +IVSKGISAG S+N+YRG V +   A +SRNFTQCDSLLIG+ CGAHT PYIE+KN +  
Sbjct: 375 KIVSKGISAGKSHNSYRGLVKIGPNADNSRNFTQCDSLLIGDKCGAHTFPYIENKNRTAV 434

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISL 484
           LEHEATTSKI ++ +FY  QRGI  E A+ LIVNG+ +EVL +LPMEFAVEAQKL+ ISL
Sbjct: 435 LEHEATTSKIGEDQVFYLNQRGIDSEKAVGLIVNGYAKEVLNQLPMEFAVEAQKLLAISL 494

Query: 485 EGSVG 489
           EGSVG
Sbjct: 495 EGSVG 499


>gi|300770539|ref|ZP_07080418.1| FeS assembly ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33861]
 gi|300763015|gb|EFK59832.1| FeS assembly ABC superfamily ATP binding cassette transporter,
           membrane protein [Sphingobacterium spiritivorum ATCC
           33861]
          Length = 499

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 334/485 (68%), Positives = 395/485 (81%), Gaps = 4/485 (0%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            +  D +++++ ++YKYGF T+I++D AP GL ED +R IS KKNEP+W+LEWRL A+R 
Sbjct: 19  TKDDDILKELEQEEYKYGFTTDIEMDIAPTGLTEDTVRLISEKKNEPEWLLEWRLKAFRH 78

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
           +LT+K P+W   R P +DF  + YYAAPK+     SLD+VDPELL T+ KLGIP+ EQ+I
Sbjct: 79  FLTLKMPTWQNFRNPDVDFQAISYYAAPKAKPQLNSLDEVDPELLSTFAKLGIPLDEQKI 138

Query: 125 LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVG 184
           LAGV    VAVDAVFDSVSV TTF+E+LK+ GVIF    EA+ E+P+LVK+YL TVVP  
Sbjct: 139 LAGV----VAVDAVFDSVSVKTTFREKLKEQGVIFCSFGEAVQEYPELVKEYLGTVVPQT 194

Query: 185 DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYL 244
           DN YAALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLIIADEGSYVSYL
Sbjct: 195 DNIYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAQNTGQFERTLIIADEGSYVSYL 254

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           EGCTAP RDENQLHAAVVELVA  +AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C+G 
Sbjct: 255 EGCTAPTRDENQLHAAVVELVAQRDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGICKGD 314

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            SKISWTQ+ETGSAITWKYP  +L+G+ S GEFYS+A++   Q  D+GTKM+HL KNT S
Sbjct: 315 NSKISWTQVETGSAITWKYPGVILKGDNSVGEFYSVALTRNMQVADTGTKMIHLGKNTRS 374

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
           +IVSKGISAG S+N+YRG V +   A +SRNFTQCDSLLIG+ CGAHT PYIE+KN +  
Sbjct: 375 KIVSKGISAGKSHNSYRGLVKIGPNADNSRNFTQCDSLLIGDKCGAHTFPYIENKNRTAV 434

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISL 484
           LEHEATTSKI ++ +FY  QRGI  E A+ LIVNG+ +EVL +LPMEFAVEAQKL+ ISL
Sbjct: 435 LEHEATTSKIGEDQVFYLNQRGIDSEKAVGLIVNGYAKEVLNQLPMEFAVEAQKLLAISL 494

Query: 485 EGSVG 489
           EGSVG
Sbjct: 495 EGSVG 499


>gi|56752365|ref|YP_173066.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           elongatus PCC 6301]
 gi|81300544|ref|YP_400752.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           elongatus PCC 7942]
 gi|56687324|dbj|BAD80546.1| ABC transporter subunit [Synechococcus elongatus PCC 6301]
 gi|81169425|gb|ABB57765.1| Iron-regulated ABC transporter membrane component SufB
           [Synechococcus elongatus PCC 7942]
          Length = 479

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 315/490 (64%), Positives = 391/490 (79%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +K  KGL+E+++R ISAKK EP+WMLE+RL 
Sbjct: 1   MSAT------VQALVNQPYKYGFVTDIETEKIAKGLSEEVVRLISAKKEEPEWMLEFRLK 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPI 119
           AYRRWLTM++P WA + YPAID+ ++ YYAAPK      QSLD+VDP LL T+EKLGIP+
Sbjct: 55  AYRRWLTMEEPDWAAVGYPAIDYQNIVYYAAPKQKAEKKQSLDEVDPTLLETFEKLGIPL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ LA      VAVDAVFDSVS+ TTF+E+L + GVIF  ISEA+ E+P++VK+YL +
Sbjct: 115 SEQKRLA-----NVAVDAVFDSVSIATTFREKLAEEGVIFCSISEAVREYPEMVKQYLGS 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP+GDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+A+EGS
Sbjct: 170 VVPIGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINSGDTGQFERTLIVAEEGS 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           +VSYLEGCTAP  D NQLHAAVVELVALD+AEIKYSTVQNWY GD  GKGGIYNFVTKRG
Sbjct: 230 HVSYLEGCTAPMFDTNQLHAAVVELVALDDAEIKYSTVQNWYAGDENGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G  SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ 
Sbjct: 290 LCKGRNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNCQQADTGTKMVHIG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGISAG S N+YRG V V   A  +RN++QCDS+LIG+   A+T PYI+ +
Sbjct: 350 KNTRSTIVSKGISAGRSQNSYRGLVKVGPQATGARNYSQCDSMLIGDRAAANTFPYIQVQ 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+   +EHEA+TSKI ++ LFY  QRGI  E A++++++GF ++V  +LPMEFAVEA +L
Sbjct: 410 NAGAQVEHEASTSKIGEDQLFYFQQRGISLEDAVSMLISGFCKDVFNQLPMEFAVEADRL 469

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 470 LSLKLEGSVG 479


>gi|126726561|ref|ZP_01742402.1| FeS assembly protein SufB [Rhodobacterales bacterium HTCC2150]
 gi|126704424|gb|EBA03516.1| FeS assembly protein SufB [Rhodobacterales bacterium HTCC2150]
          Length = 503

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 342/491 (69%), Positives = 409/491 (83%), Gaps = 6/491 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
             ETV+ V+ +    YKYG+ T+I+++ APKGL+ DI+R IS+K +EP+WMLEWRL AY 
Sbjct: 14  EEETVEAVKSL-AGAYKYGWNTDIEMEYAPKGLSTDIVRLISSKNDEPEWMLEWRLAAYE 72

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL + +P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ
Sbjct: 73  RWLKLTEPDWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLETYKKLGIPLKEQ 132

Query: 123 EILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLS 178
            +LAGV+      KVAVDAVFDSVSV TTFK+EL K+GVIF  ISEAI EHP+LV+KYL 
Sbjct: 133 ALLAGVEAPEEERKVAVDAVFDSVSVGTTFKDELAKAGVIFCSISEAIKEHPELVRKYLG 192

Query: 179 TVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEG 238
           TVVPV DN+YA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLII D+ 
Sbjct: 193 TVVPVSDNYYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIICDKE 252

Query: 239 SYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKR 298
           +YVSYLEGCTAPQRD  QLHAAVVE+V +++AE+KYSTVQNWYPGD  GKGGIYNFVTKR
Sbjct: 253 AYVSYLEGCTAPQRDIAQLHAAVVEIVIMEDAEVKYSTVQNWYPGDEDGKGGIYNFVTKR 312

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
            DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM+HL
Sbjct: 313 ADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKMVHL 372

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
            KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PYIE 
Sbjct: 373 GKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDKCGAHTVPYIEV 432

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           +N+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+EAQ 
Sbjct: 433 RNNSSRVEHEATTSKVDDDQLFYCRQRGMGEEEAVALVVNGFCKDVLQALPMEFAMEAQA 492

Query: 479 LIDISLEGSVG 489
           L+ ISLEGSVG
Sbjct: 493 LVAISLEGSVG 503


>gi|54293584|ref|YP_125999.1| cysteine desulfurase activator complex subunit SufB [Legionella
           pneumophila str. Lens]
 gi|53753416|emb|CAH14869.1| hypothetical protein lpl0636 [Legionella pneumophila str. Lens]
          Length = 482

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 327/487 (67%), Positives = 402/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ +++  +   +Y++GF T+I+V+  P GL+ED+IR +SA K EP+++LEWRL A+R
Sbjct: 1   MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIKGEPEFLLEWRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM  P W+ + Y  ID+  + YY+APKS    P+SLD+VDPELL+TYEKLGIP+REQ
Sbjct: 61  HWLTMPHPEWSSVHYSPIDYQSISYYSAPKSKKDAPKSLDEVDPELLKTYEKLGIPLREQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E+LAG     VAVDAVFDSVSV TTFK +L + GVIF P+SEA+ ++PDLVKKYL +VVP
Sbjct: 121 EMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYPDLVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN   TGQFERTLI+AD  SYVS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAASTGQFERTLIVADVDSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+ALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G +SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+HL KNT
Sbjct: 296 GKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN +
Sbjct: 356 RSTIISKGISAGRAHNAYRGLVRIAPTATNARNYTQCDSMLMGSQCSAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+ I
Sbjct: 416 AQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGI 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|56696893|ref|YP_167255.1| cysteine desulfurase activator complex subunit SufB [Ruegeria
           pomeroyi DSS-3]
 gi|56678630|gb|AAV95296.1| FeS assembly protein SufB [Ruegeria pomeroyi DSS-3]
          Length = 506

 Score =  560 bits (1443), Expect = e-157,   Method: Composition-based stats.
 Identities = 348/494 (70%), Positives = 406/494 (82%), Gaps = 11/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR+     YKYG+ET I+++ APKG+N DI+R IS K  EP+WM EWRL A+ R
Sbjct: 15  QETVDAVRE--AGTYKYGWETEIEMEYAPKGVNPDIVRLISDKNEEPEWMTEWRLAAFER 72

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  M +P WA + YP IDF D YYYA PKS+   P+SLDDVDP+LL TYEKLGIP++EQ 
Sbjct: 73  WTGMSEPKWAMVSYPEIDFQDQYYYARPKSMSEKPKSLDDVDPKLLATYEKLGIPLKEQM 132

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 133 ILAGVEGAENAPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPELVKK 192

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 193 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 252

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP+RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 253 DKGSYVSYLEGCTAPKRDVAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 312

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 313 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 372

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 373 IHLGKNTKSRIVSKGISAGRAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDKCGAHTVPY 432

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S   EHEATTSK+ ++ LFYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 433 IEVKNNSSRCEHEATTSKVDEDQLFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 492

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 493 AQQLVAISLEGSVG 506


>gi|113477759|ref|YP_723820.1| cysteine desulfurase activator complex subunit SufB [Trichodesmium
           erythraeum IMS101]
 gi|110168807|gb|ABG53347.1| Iron-regulated ABC transporter membrane component SufB
           [Trichodesmium erythraeum IMS101]
          Length = 478

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 309/480 (64%), Positives = 385/480 (80%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           KV  +    YKYGF T+I+ D  P+GL+EDI+R ISAKKNEP++ML +RL AY++WL MK
Sbjct: 4   KVTSLVNQPYKYGFVTDIESDTIPRGLSEDIVRLISAKKNEPEFMLNFRLKAYKKWLQMK 63

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           +P WA + YP ID+ ++ YY+APK     +SL++VDP LL T+EKLGIP+ EQ+ L+   
Sbjct: 64  EPLWAHVDYPKIDYQNIIYYSAPKLQDKKKSLEEVDPTLLETFEKLGIPLSEQKRLS--- 120

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTFKE+L + GVIF  ISEA+ EHP+LV+KYL +VVPVGDNF+A
Sbjct: 121 --NVAVDAVFDSVSVATTFKEKLAEEGVIFGSISEAVQEHPELVEKYLGSVVPVGDNFFA 178

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IPKGV+CPM+LSTYFRIN   +GQFERTLI+A+EGS V+YLEGCTA
Sbjct: 179 ALNSAVFSDGSFVFIPKGVKCPMDLSTYFRINNGESGQFERTLIVAEEGSSVTYLEGCTA 238

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELV LDNAEIKYSTVQNW+ GD  GKGGIYNFVTKRG C+G+ SKIS
Sbjct: 239 PMFDTNQLHAAVVELVTLDNAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKIS 298

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SK
Sbjct: 299 WTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNKQQADTGTKMVHVGKNTRSTIISK 358

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S N+YRG V +  GA  SRN++QCDS+LIG+   A+T PYI+  N++  +EHEA
Sbjct: 359 GISAGNSANSYRGLVKMGPGAKGSRNYSQCDSMLIGDRAQANTFPYIQVDNNTAKVEHEA 418

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI  + LFY  QRGI  E A+++I++GF ++V  +LPMEFA EA KL+ + LEG+VG
Sbjct: 419 STSKIGVDQLFYFAQRGISPEDAVSMIISGFCKDVFNELPMEFAAEADKLLSLKLEGTVG 478


>gi|186684916|ref|YP_001868112.1| cysteine desulfurase activator complex subunit SufB [Nostoc
           punctiforme PCC 73102]
 gi|186467368|gb|ACC83169.1| FeS assembly protein SufB [Nostoc punctiforme PCC 73102]
          Length = 479

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 310/490 (63%), Positives = 389/490 (79%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GL+ED+IR IS+KKNEP +ML++RL 
Sbjct: 1   MSAT------VKTLVNQPYKYGFVTDIEADTIPRGLDEDVIRLISSKKNEPQFMLDFRLR 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPK-SIVGPQSLDDVDPELLRTYEKLGIPI 119
           AYR+W  M +P+W  ++YP I++ D+ YY+APK       SLD+VDP LL T+EKLGI +
Sbjct: 55  AYRQWQKMTEPTWPNVKYPPINYQDIIYYSAPKRKKEKLNSLDEVDPTLLETFEKLGISL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ LA      VAVDA+FDSVSV TTFKE+L + GVIF   SEA+ EHP+L+KKYL +
Sbjct: 115 SEQKRLA-----NVAVDAIFDSVSVATTFKEKLAEDGVIFCSFSEALQEHPELIKKYLGS 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP+ DN++AALN+AVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+EGS
Sbjct: 170 VVPIADNYFAALNAAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGS 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP  D NQLHAAVVELVALDNAEIKYSTVQNWY GD+ GKGGIYNFVTKRG
Sbjct: 230 YVSYLEGCTAPMYDSNQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+G+KM+H+ 
Sbjct: 290 LCQGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNHQQQADTGSKMIHVG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S+N+YRG V V+  A  +RN++QCDS+LIG+N  A+T PYI+ +
Sbjct: 350 KNTRSTIISKGISAGNSSNSYRGLVKVNPTANGARNYSQCDSMLIGDNAHANTFPYIQVQ 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+   +EHEA+TSKI ++ LFY  QRGI  E AI+++++GF ++V  +LPMEFAVEA KL
Sbjct: 410 NNGAKVEHEASTSKIGEDQLFYFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKL 469

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 470 LSLKLEGSVG 479


>gi|84503549|ref|ZP_01001600.1| FeS assembly protein SufB [Oceanicola batsensis HTCC2597]
 gi|84388039|gb|EAQ01087.1| FeS assembly protein SufB [Oceanicola batsensis HTCC2597]
          Length = 510

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 355/498 (71%), Positives = 409/498 (82%), Gaps = 15/498 (3%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR +    YKYG+ET I+ D AP GLNEDI+R IS K  EPDWMLEWRL A+ R
Sbjct: 15  QETVDAVRAV--GTYKYGWETEIETDYAPMGLNEDIVRLISEKNGEPDWMLEWRLQAFER 72

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W   ++P WA + YP IDF   YYYA PKS+   P+SLD+VDP+LL TYEKLGIP+REQ 
Sbjct: 73  WKGKEEPDWAMVDYPEIDFQKQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLREQM 132

Query: 124 ILAGVQT------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           ILAGV+              KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+
Sbjct: 133 ILAGVEGAEEVPAQGRDTGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPE 192

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LVKKYL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERT
Sbjct: 193 LVKKYLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERT 252

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+GSYVSYLEGCTAPQRD +QLHAAVVE++A ++AE+KYSTVQNWYPGD  GKGGI
Sbjct: 253 LIIADKGSYVSYLEGCTAPQRDTSQLHAAVVEIIAEEDAEVKYSTVQNWYPGDENGKGGI 312

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG  S GEFYSIAI+N +QQ D+
Sbjct: 313 YNFVTKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGNDSQGEFYSIAITNNWQQADT 372

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAH
Sbjct: 373 GTKMVHLGKNTKSRIVSKGISAGQAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDKCGAH 432

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF R+VLQ LPME
Sbjct: 433 TVPYIEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCRDVLQALPME 492

Query: 472 FAVEAQKLIDISLEGSVG 489
           FA+EAQ+L+ ISLEGSVG
Sbjct: 493 FAMEAQQLVAISLEGSVG 510


>gi|86606830|ref|YP_475593.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. JA-3-3Ab]
 gi|86555372|gb|ABD00330.1| FeS assembly protein SufB [Synechococcus sp. JA-3-3Ab]
          Length = 478

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 316/479 (65%), Positives = 385/479 (80%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           VR +    YKYGF T+I  +   KGLNEDIIR I AKK EPD+MLE+RL AYR+WL M +
Sbjct: 5   VRTLISQPYKYGFVTDIPSESIGKGLNEDIIRQIWAKKGEPDFMLEFRLRAYRQWLKMSE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P+W  + YP ID+ ++ YY+APK     +SLD+VDP LL T+EKLGIP+ EQ+ LA    
Sbjct: 65  PTWPNVSYPPIDYQNIVYYSAPKVQPKKKSLDEVDPVLLETFEKLGIPLSEQKRLA---- 120

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDA+FDSVSV TTF+E+L K G+IF  +SEA+ E+P+LV+KYL +VVP+ DN+YAA
Sbjct: 121 -NVAVDAIFDSVSVATTFREKLAKEGIIFCSMSEALREYPELVRKYLGSVVPIADNYYAA 179

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVY+PKGVRCPMELSTYFRIN   +GQFERTLIIADEGSYVSYLEGCTAP
Sbjct: 180 LNSAVFSDGSFVYVPKGVRCPMELSTYFRINNGESGQFERTLIIADEGSYVSYLEGCTAP 239

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D NQLHAAVVEL+ALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG C+G  SKISW
Sbjct: 240 MFDTNQLHAAVVELIALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGANSKISW 299

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPSC+L GE S GEFYS+A++N +QQ D+GTKM+H+ +NT S+I+SKG
Sbjct: 300 TQVETGSAITWKYPSCVLVGENSVGEFYSVALTNNYQQADTGTKMIHVGRNTRSKIISKG 359

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  +RNF+QCDS+LIG+ C A+T PYIE +N++  +EHEA+
Sbjct: 360 ISAGHSKNSYRGLVKIGPKAEGARNFSQCDSMLIGDQCSANTFPYIEVQNNTAKVEHEAS 419

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI +E LFY   RGI  E A+++I++GF REV  +LPMEFAVEA +L+ + LEGSVG
Sbjct: 420 TSKIGEEQLFYFQSRGIGMEDAVSMIISGFCREVFNQLPMEFAVEADRLLSLKLEGSVG 478


>gi|163736411|ref|ZP_02143830.1| FeS assembly protein SufB [Phaeobacter gallaeciensis BS107]
 gi|161390281|gb|EDQ14631.1| FeS assembly protein SufB [Phaeobacter gallaeciensis BS107]
          Length = 507

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 351/494 (71%), Positives = 409/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ET+I+++ APKGL  DI+R IS K  EP+WML WRL AY R
Sbjct: 15  QETVDAVREVG-GAYKYGWETDIEMEYAPKGLTTDIVRLISEKNEEPEWMLNWRLEAYDR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL  ++P+WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WLQKEEPTWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAENMPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TVVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGTVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPARDIAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 VHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|313675020|ref|YP_004053016.1| iron-regulated ABC transporter membrane component sufb [Marivirga
           tractuosa DSM 4126]
 gi|312941718|gb|ADR20908.1| Iron-regulated ABC transporter membrane component SufB [Marivirga
           tractuosa DSM 4126]
          Length = 481

 Score =  560 bits (1442), Expect = e-157,   Method: Composition-based stats.
 Identities = 316/486 (65%), Positives = 390/486 (80%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +    + +    +Y++G+  + + D AP GLNEDI+RFISAKK EP+W+LEWRL AYR
Sbjct: 1   MSKDDQILEEFASKEYEHGWTVDFEADSAPPGLNEDIVRFISAKKEEPEWLLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W  M +P WA + YP  +F+D+ YY+APK    P+SLD+VDPE+ +T+E+LGI + EQ+
Sbjct: 61  NWRKMAEPKWANVHYPKPEFEDIIYYSAPKPKDKPKSLDEVDPEMRKTFERLGISLTEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L G     VAVDAV DSVSV TTFK++L + G+IF   SEA+ EHP+LVKKY+ +VVP 
Sbjct: 121 RLTG-----VAVDAVMDSVSVGTTFKKQLGELGIIFCSFSEAVKEHPELVKKYIGSVVPS 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNFYAALNSAVF+DGSF YIPKGVRCP+ELSTYFRIN   TGQFERTLI+A++ SYVSY
Sbjct: 176 NDNFYAALNSAVFSDGSFCYIPKGVRCPVELSTYFRINAANTGQFERTLIVAEDDSYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVE+ A  NAE+KYSTVQNWYPGD  GKGGIYNFVTKRG C G
Sbjct: 236 LEGCTAPMRDENQLHAAVVEIYAAKNAEVKYSTVQNWYPGDKNGKGGIYNFVTKRGICAG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             +KI+WTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT 
Sbjct: 296 DYAKIAWTQVETGSAVTWKYPSCILKGDYSQGEFYSVAVTNNMQQADTGTKMIHIGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKG+S G S N+YRG V +H+ A +SRNF+QCDSLL+G+ CGAHT PYIE KN S 
Sbjct: 356 SRIVSKGVSGGKSQNSYRGLVEIHKRAENSRNFSQCDSLLMGDKCGAHTFPYIEIKNKSA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ +FYC QRGI EE+A+ALIVNG+ +EVL  LPMEFAVEAQKL+ ++
Sbjct: 416 QVEHEATTSKIGEDQIFYCQQRGIDEESAVALIVNGYCKEVLNNLPMEFAVEAQKLLALT 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|163741054|ref|ZP_02148446.1| FeS assembly protein SufB [Phaeobacter gallaeciensis 2.10]
 gi|161385407|gb|EDQ09784.1| FeS assembly protein SufB [Phaeobacter gallaeciensis 2.10]
          Length = 512

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 352/494 (71%), Positives = 410/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ET+I+++ APKGL  DI+R IS K  EP+WML WRL AY R
Sbjct: 20  QETVDAVREVG-GAYKYGWETDIEMEYAPKGLTTDIVRLISEKNEEPEWMLNWRLEAYDR 78

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL  ++P+WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 79  WLQKEEPTWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 138

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 139 ILAGVEGAENMPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPELVKK 198

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TVVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 199 YLGTVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 258

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 259 DKGSYVSYLEGCTAPARDIAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 318

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRGE+S GEFYSIAI+N  QQ D+GTKM
Sbjct: 319 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGEESQGEFYSIAIANNMQQADTGTKM 378

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 379 VHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 438

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 439 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 498

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 499 AQQLVAISLEGSVG 512


>gi|110637388|ref|YP_677595.1| cysteine desulfurase activator complex subunit SufB [Cytophaga
           hutchinsonii ATCC 33406]
 gi|110280069|gb|ABG58255.1| Iron-regulated ABC transporter membrane component SufB [Cytophaga
           hutchinsonii ATCC 33406]
          Length = 481

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 324/486 (66%), Positives = 399/486 (82%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++   + +I   +YK+GF T+I  D  PKGLNED +R+ISAKKNEP+W+LEWRL A+R
Sbjct: 1   MSDSNKILEEITSSEYKWGFVTDIDNDSLPKGLNEDTVRYISAKKNEPEWLLEWRLDAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           +WL M++P+W  ++YP IDF D+ YY+APK  V   SLD++DPEL  T+EKLGI + EQ+
Sbjct: 61  KWLKMEEPTWPNVKYPKIDFQDIIYYSAPKPKVTLNSLDEIDPELRATFEKLGISLDEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            + G     VAVDAV DSVS+ TTFK +L + G+IF  +SEA+ EHP+LV+KYL +VVPV
Sbjct: 121 RMTG-----VAVDAVIDSVSITTTFKGKLSELGIIFCSMSEAVQEHPELVRKYLGSVVPV 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN+YAALNSAVF+DGSF YIPKGVR PMELSTYFRIN   TGQFERTL+IADEG+YVSY
Sbjct: 176 TDNYYAALNSAVFSDGSFCYIPKGVRSPMELSTYFRINAANTGQFERTLLIADEGAYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVELVA++ AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C G
Sbjct: 236 LEGCTAPVRDENQLHAAVVELVAMEKAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGICAG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT 
Sbjct: 296 DYAKISWTQVETGSAVTWKYPSCILKGDHSIGEFYSVAVTNNYQQADTGTKMIHIGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S+N+YRG V V + A  +RN++QCDSLL+G+ CGAHT PYIE +N++ 
Sbjct: 356 SRIVSKGISAGHSHNSYRGLVKVMKRAEGARNYSQCDSLLMGDQCGAHTFPYIEVENNTS 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ +FYC QRGI  E A+ALIVNG+ +EVL +LPMEFAVEAQKL+ IS
Sbjct: 416 TVEHEATTSKIGEDQIFYCNQRGIDTEKAVALIVNGYCKEVLNQLPMEFAVEAQKLLAIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|159044180|ref|YP_001532974.1| cysteine desulfurase activator complex subunit SufB
           [Dinoroseobacter shibae DFL 12]
 gi|157911940|gb|ABV93373.1| sufB [Dinoroseobacter shibae DFL 12]
          Length = 503

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 340/490 (69%), Positives = 412/490 (84%), Gaps = 6/490 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RETV+ V+ +  ++YK+G+ T+I+++ APKG++EDI+R IS K  EP+WM EWRL A+ R
Sbjct: 15  RETVEAVQSVG-ERYKHGWATDIEMEYAPKGIDEDIVRLISEKNEEPEWMTEWRLEAFAR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  +K+P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 74  WKKLKEPKWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLETYKKLGIPLKEQA 133

Query: 124 ILAGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +LAGV+      +VAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKKYL +
Sbjct: 134 LLAGVEAPEEDRRVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIKEHPELVKKYLGS 193

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+YA LNSAVF+DGSFVY+P GV+CPMELSTYFRIN + TGQFERTLIIAD+GS
Sbjct: 194 VVPVSDNYYATLNSAVFSDGSFVYVPPGVKCPMELSTYFRINAENTGQFERTLIIADKGS 253

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRD  QLHAAVVE+V L++AE+KYSTVQNWYPGD  GKGGIYNFVTKR 
Sbjct: 254 YVSYLEGCTAPQRDIAQLHAAVVEIVLLEDAEVKYSTVQNWYPGDENGKGGIYNFVTKRA 313

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ + GEFYSIAI+N  QQ D+GTKM+HL 
Sbjct: 314 DCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDTQGEFYSIAIANNMQQADTGTKMVHLG 373

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRIVSKGISAG + NTYRG VS+H  A + RN+TQCDSLLIG+ CGAHT+PYIE +
Sbjct: 374 KNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKNGRNYTQCDSLLIGDKCGAHTVPYIEVR 433

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S  +EHEATTSK+ ++ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+EAQ+L
Sbjct: 434 NNSSRVEHEATTSKVDEDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAMEAQQL 493

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 494 VAISLEGSVG 503


>gi|77464010|ref|YP_353514.1| cysteine desulfurase activator complex subunit SufB [Rhodobacter
           sphaeroides 2.4.1]
 gi|77388428|gb|ABA79613.1| putative SufB [Rhodobacter sphaeroides 2.4.1]
          Length = 513

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 343/497 (69%), Positives = 410/497 (82%), Gaps = 13/497 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RET++  + +   +YKYG+ET I++D APKGLNEDI+R ISAK +EP+WM EWRL AYRR
Sbjct: 18  RETIETAQAM-AGKYKYGWETEIEMDFAPKGLNEDIVRLISAKNDEPEWMTEWRLQAYRR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL M++P WA + YP ID+ D+YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 77  WLQMEEPRWAMLDYPEIDYQDIYYYAKPKSMDVKPKSLDEVDPKLLETYKKLGIPLKEQA 136

Query: 124 ILAGVQT-------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           ILAGV+         +VAVDAVFDSVSV TTF++EL K+GVIF  ISEA+ EHP+LVKKY
Sbjct: 137 ILAGVEGAEVPDAPRQVAVDAVFDSVSVGTTFQKELAKAGVIFCSISEAVREHPELVKKY 196

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L +VVP  DN++A LNSAVF+DGSFVYIP G RCPMELSTYFRIN + TGQFERTLIIAD
Sbjct: 197 LGSVVPQSDNYFATLNSAVFSDGSFVYIPPGTRCPMELSTYFRINAENTGQFERTLIIAD 256

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +G+YVSYLEGCTAP+RD NQLHAAVVE+V L++AE+KYSTVQNWYPGD +G+GGIYNF  
Sbjct: 257 KGAYVSYLEGCTAPKRDTNQLHAAVVEIVVLEDAEVKYSTVQNWYPGDEEGRGGIYNFRW 316

Query: 297 KRGD----CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSG 352
            R      CRG RSK+ WTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAI+N  QQ D+G
Sbjct: 317 TRKMPGPDCRGARSKVMWTQVETGSAITWKYPSCILRGDDSQGEFYSIAIANNAQQADTG 376

Query: 353 TKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHT 412
           TKM+HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT
Sbjct: 377 TKMIHLGKNTRSRIVSKGISAGRAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHT 436

Query: 413 IPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEF 472
           +PYIE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEF
Sbjct: 437 VPYIEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLQALPMEF 496

Query: 473 AVEAQKLIDISLEGSVG 489
           A+EAQ L+ ISLEGSVG
Sbjct: 497 AMEAQALVAISLEGSVG 513


>gi|154491952|ref|ZP_02031578.1| hypothetical protein PARMER_01582 [Parabacteroides merdae ATCC
           43184]
 gi|154088193|gb|EDN87238.1| hypothetical protein PARMER_01582 [Parabacteroides merdae ATCC
           43184]
          Length = 481

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 316/486 (65%), Positives = 387/486 (79%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ D + ++    YKYGF T+I  +   +GL+E+ +R ISAKKNEP+W+LE+RL A+R
Sbjct: 1   MEDSNDILNEVTTGDYKYGFVTDIDTEVIHRGLDEETVRIISAKKNEPEWLLEFRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W T++ P+W  +  P ID+ D+ YYAAPK   GP+SLD+VDPEL++T++KLGIP+ E+ 
Sbjct: 61  HWQTLEMPTWPHLNIPPIDYQDIIYYAAPKKKEGPKSLDEVDPELMKTFDKLGIPLHERA 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+  HPDLV+KYL +VV  
Sbjct: 121 QLSG-----MAVDAVMDSVSVKTTFKETLAEKGIIFCSFSEAVQHHPDLVQKYLGSVVSY 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ +YVSY
Sbjct: 176 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDEAYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+VA + AE+KYSTVQNWYPGD  GKGGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPMRDENQLHAAIVEIVAHERAEVKYSTVQNWYPGDKDGKGGIYNFVTKRGLCKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+HL +NT 
Sbjct: 296 EGSKISWTQVETGSAITWKYPSCILAGDNSVGEFYSVAVTNNYQQADTGTKMIHLGRNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A  +RN +QCDSLL+ + CGAHT PY + +N + 
Sbjct: 356 STIVSKGISAGHSQNSYRGLVKVSPRAEGARNHSQCDSLLLSSTCGAHTFPYADIQNETA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS+E LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ IS
Sbjct: 416 VVEHEATTSKISEEQLFYCRQRGISVEEAVGLIVNGYAREVMNKLPMEFAVEAQKLLTIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|84686884|ref|ZP_01014768.1| FeS assembly protein SufB [Maritimibacter alkaliphilus HTCC2654]
 gi|84665081|gb|EAQ11561.1| FeS assembly protein SufB [Rhodobacterales bacterium HTCC2654]
          Length = 510

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 354/499 (70%), Positives = 416/499 (83%), Gaps = 14/499 (2%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
            +ETVD V+ +  D+YKYG+ET+I+++ APKGL EDI+R IS K +EP+WM EWRL AYR
Sbjct: 13  EQETVDAVKSLG-DKYKYGWETDIEMEYAPKGLTEDIVRLISQKNDEPEWMTEWRLSAYR 71

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL M++P WA + YP I+F D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ
Sbjct: 72  RWLQMEEPDWAMVEYPEINFQDQYYYARPKSMETKPKSLDEVDPKLLATYEKLGIPLKEQ 131

Query: 123 EILAGVQT------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
            ILAGV+              KVAVDAVFDSVSV TTFK+EL+++GVIF  ISEAI EHP
Sbjct: 132 MILAGVEGAGEVPADGDNSERKVAVDAVFDSVSVGTTFKKELEQAGVIFCSISEAIREHP 191

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LVKKYL +VVP  DNFYA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFER
Sbjct: 192 ELVKKYLGSVVPPTDNFYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFER 251

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLIIAD+ +YVSYLEGCTAPQRD  QLHAAVVE+V LD+AE+KYSTVQNW+PGD +GKGG
Sbjct: 252 TLIIADKEAYVSYLEGCTAPQRDTAQLHAAVVEIVILDDAEVKYSTVQNWFPGDEEGKGG 311

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           I+NFVTKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG++S GEFYSIAI+N  QQ D
Sbjct: 312 IFNFVTKRADCRGDRSKVMWTQVETGSAVTWKYPSCVLRGDESQGEFYSIAITNNMQQAD 371

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           +GTKM HL KNT SRIVSKGISAG SNNTYRG VS+H  A +SRN+TQCDSLLIG+ CGA
Sbjct: 372 TGTKMTHLGKNTRSRIVSKGISAGKSNNTYRGLVSMHPKATNSRNYTQCDSLLIGDQCGA 431

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT+PYIE KN S  +EHEATTSK+ D+ +FYC QRG+ EE A+ALIVNGF +EVLQ LPM
Sbjct: 432 HTVPYIEVKNPSSRVEHEATTSKVDDDQMFYCRQRGMDEEEAVALIVNGFAKEVLQALPM 491

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFA+EAQ+L+ ISLEGSVG
Sbjct: 492 EFAMEAQQLVAISLEGSVG 510


>gi|75906649|ref|YP_320945.1| cysteine desulfurase activator complex subunit SufB [Anabaena
           variabilis ATCC 29413]
 gi|75700374|gb|ABA20050.1| Iron-regulated ABC transporter membrane component SufB [Anabaena
           variabilis ATCC 29413]
          Length = 479

 Score =  559 bits (1441), Expect = e-157,   Method: Composition-based stats.
 Identities = 310/490 (63%), Positives = 393/490 (80%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GL+ED++R ISAKKNEP++MLE+RL 
Sbjct: 1   MSAT------VKTLVNQPYKYGFVTDIEADTIPRGLSEDVVRLISAKKNEPEFMLEYRLK 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+R+W  M +P+W  ++YP ID+ ++ YY+APK       SLD+VDP L+ T+EKLGIP+
Sbjct: 55  AFRQWQKMTEPTWPSVKYPPIDYQNIIYYSAPKQKKAKLNSLDEVDPTLIETFEKLGIPL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ LA      VAVDA+FDSVSV TTFKE+L K GVIF  ISEA+ EHP+L+KKYL +
Sbjct: 115 SEQKRLA-----NVAVDAIFDSVSVATTFKEKLAKDGVIFCSISEALQEHPELIKKYLGS 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP+ DN++AALN+AVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+EGS
Sbjct: 170 VVPIADNYFAALNAAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGS 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP  D NQLHAAVVEL+ALDNAEIKYSTVQNWY GD+ GKGGIYNFVTKRG
Sbjct: 230 YVSYLEGCTAPMYDSNQLHAAVVELIALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ 
Sbjct: 290 LCQGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHVG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S+N+YRG V ++  A  +RN++QCDS+LIG+N  A+T PYI+ +
Sbjct: 350 KNTRSTIISKGISAGQSSNSYRGLVKINPTATGARNYSQCDSMLIGDNAHANTFPYIQVQ 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LF+  QRGI  E AI+++++GF ++V  +LPMEFAVEA KL
Sbjct: 410 NNTGKVEHEASTSKIGEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKL 469

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 470 LSLKLEGSVG 479


>gi|54296621|ref|YP_122990.1| cysteine desulfurase activator complex subunit SufB [Legionella
           pneumophila str. Paris]
 gi|53750406|emb|CAH11800.1| hypothetical protein lpp0652 [Legionella pneumophila str. Paris]
          Length = 482

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 328/487 (67%), Positives = 402/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ +++  +   +Y++GF T+I+V+  P GL+ED+IR +SA K EP+++LEWRL A+R
Sbjct: 1   MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIKGEPEFLLEWRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM  P W+ + YP ID+  + YY+APKS    P+SLD+VDPELL+TYEKLGIP+REQ
Sbjct: 61  HWLTMPHPEWSSVHYPPIDYQSVSYYSAPKSKKDAPKSLDEVDPELLKTYEKLGIPLREQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E+LAG     VAVDAVFDSVSV TTFK +L + GVIF P+SEA+ ++PDLVKKYL +VVP
Sbjct: 121 EMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYPDLVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+P GVRCPMELSTYFRIN   TGQFERTLIIAD  SYVS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPNGVRCPMELSTYFRINAASTGQFERTLIIADVDSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+ALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G +SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+HL KNT
Sbjct: 296 GKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN +
Sbjct: 356 RSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGSQCSAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+ I
Sbjct: 416 AQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGI 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|148360749|ref|YP_001251956.1| ABC transporter permease [Legionella pneumophila str. Corby]
 gi|296106186|ref|YP_003617886.1| ycf24 ABC transporter, permease [Legionella pneumophila 2300/99
           Alcoy]
 gi|148282522|gb|ABQ56610.1| ABC transporter, permease [Legionella pneumophila str. Corby]
 gi|295648087|gb|ADG23934.1| ycf24 ABC transporter, permease [Legionella pneumophila 2300/99
           Alcoy]
          Length = 482

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 329/487 (67%), Positives = 403/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ +++  +   +Y++GF T+I+V+  P GL+ED+IR +SA K EP+++LEWRL A+R
Sbjct: 1   MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIKGEPEFLLEWRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM  P W+ + YP ID+  + YY+APKS    P+SLD+VDPELL+TYEKLGIP+REQ
Sbjct: 61  HWLTMPHPEWSSVHYPPIDYQSVSYYSAPKSKKDAPKSLDEVDPELLKTYEKLGIPLREQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E+LAG     VAVDAVFDSVSV TTFK +L + GVIF P+SEA+ ++PDLVKKYL +VVP
Sbjct: 121 EMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYPDLVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN   TGQFERTLIIAD  SYVS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAASTGQFERTLIIADVDSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+ALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G +SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+HL KNT
Sbjct: 296 GKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN +
Sbjct: 356 RSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGSQCSAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+ I
Sbjct: 416 AQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGI 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|259417024|ref|ZP_05740944.1| FeS assembly protein SufB [Silicibacter sp. TrichCH4B]
 gi|259348463|gb|EEW60240.1| FeS assembly protein SufB [Silicibacter sp. TrichCH4B]
          Length = 506

 Score =  559 bits (1440), Expect = e-157,   Method: Composition-based stats.
 Identities = 349/493 (70%), Positives = 410/493 (83%), Gaps = 11/493 (2%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
           ETVD VR++    YKYG++T+I+++ APKG+N DI+R IS K  EP+WM EWRL A+ RW
Sbjct: 16  ETVDAVREV--STYKYGWDTDIEMEYAPKGVNPDIVRLISEKNEEPEWMTEWRLQAFERW 73

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQEI 124
             MK+P+WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ I
Sbjct: 74  QGMKEPNWAMVNYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQMI 133

Query: 125 LAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKY 176
           LAGV+          KVAVDAVFDSVSV TTF+EELKK+GVIF  ISEAI EHP+LVKKY
Sbjct: 134 LAGVEGAEDAPSEGRKVAVDAVFDSVSVGTTFQEELKKAGVIFCSISEAIREHPELVKKY 193

Query: 177 LSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIAD 236
           L TVVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIAD
Sbjct: 194 LGTVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIAD 253

Query: 237 EGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVT 296
           +GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNW+PGD  GKGGIYNFVT
Sbjct: 254 KGSYVSYLEGCTAPQRDTAQLHAAVVEIIVEEDAEVKYSTVQNWFPGDENGKGGIYNFVT 313

Query: 297 KRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKML 356
           KR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM+
Sbjct: 314 KRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKMI 373

Query: 357 HLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYI 416
           HL K+T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PYI
Sbjct: 374 HLGKDTKSRIVSKGISAGKAQNTYRGLVSMHPKAKSSRNYTQCDSLLIGDKCGAHTVPYI 433

Query: 417 ESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEA 476
           E KN+S   EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+EA
Sbjct: 434 EVKNNSSRCEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAMEA 493

Query: 477 QKLIDISLEGSVG 489
           Q+L+ ISLEGSVG
Sbjct: 494 QQLVAISLEGSVG 506


>gi|254293807|ref|YP_003059830.1| cysteine desulfurase activator complex subunit SufB [Hirschia
           baltica ATCC 49814]
 gi|254042338|gb|ACT59133.1| FeS assembly protein SufB [Hirschia baltica ATCC 49814]
          Length = 512

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 352/496 (70%), Positives = 418/496 (84%), Gaps = 11/496 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           + TVD  R ++ D Y  GF T+I+ + APKGL+E+ +RFISAKKNEP+WMLEWRL AY R
Sbjct: 17  QATVDAARALESDNYNAGFTTDIEQEFAPKGLSEETVRFISAKKNEPEWMLEWRLQAYER 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
           WLTM++P WA + YP ID+ D YYYAAPK     +S+DDV  E+L TY+KLGIP+RE E+
Sbjct: 77  WLTMEEPDWAMVNYPKIDYQDAYYYAAPKGQTKYESIDDVPEEILETYKKLGIPLREAEV 136

Query: 125 LAGVQT-----------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           L GV+             ++AVDAVFDSVSVVTTF++ELKK+GVIFM ISEAI E+P+LV
Sbjct: 137 LLGVEGAAESAAEAREKPRIAVDAVFDSVSVVTTFQKELKKAGVIFMSISEAIVEYPELV 196

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           KKYL TVVP  DNF+A LN AVF+DG+FVYIPKGVRCPMELSTYFR+N +GTGQFERTLI
Sbjct: 197 KKYLGTVVPQSDNFFATLNCAVFSDGTFVYIPKGVRCPMELSTYFRMNAQGTGQFERTLI 256

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           IADEG+YVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNW+PGD+ GKGG+YN
Sbjct: 257 IADEGAYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWWPGDADGKGGVYN 316

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRGDCRG RSKISWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIA++NG QQ D+GT
Sbjct: 317 FVTKRGDCRGKRSKISWTQVETGSAVTWKYPSCILRGDDSVGEFYSIAVTNGHQQADTGT 376

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+HL + T SRI+SKG+SAG SN+TYRG VSV   A  SRNFTQCDSLLIG  CGAHT+
Sbjct: 377 KMIHLGERTKSRIISKGVSAGKSNSTYRGLVSVGGKAKGSRNFTQCDSLLIGQTCGAHTV 436

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIE+K +   LEHEATT+++S++ LFYC QRG+ EE A+AL+VNGFVR+V+QKLPMEFA
Sbjct: 437 PYIENKRADAQLEHEATTTRLSEDQLFYCRQRGLGEEEAVALLVNGFVRDVIQKLPMEFA 496

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+++SLEGSVG
Sbjct: 497 VEAQKLLEVSLEGSVG 512


>gi|37520939|ref|NP_924316.1| cysteine desulfurase activator complex subunit SufB [Gloeobacter
           violaceus PCC 7421]
 gi|35211934|dbj|BAC89311.1| ycf24 [Gloeobacter violaceus PCC 7421]
          Length = 482

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 331/490 (67%), Positives = 400/490 (81%), Gaps = 9/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    +T++++      +Y+YGF T+I+ +  P GL+E++IR ISAKK EP++MLEWRL 
Sbjct: 1   MTTSTQTIEQLAG---KEYQYGFVTDIEQETVPPGLSEEVIRLISAKKQEPEFMLEWRLK 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPI 119
           AYR WL+M  P WA + YP ID+ ++ YYAA K    GP+SLD+VDPELLRTYEKLGIP+
Sbjct: 58  AYRHWLSMTTPEWANVHYPPIDYQNIVYYAALKPKTDGPKSLDEVDPELLRTYEKLGIPL 117

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +E+  LAG     VAVDAVFDSVSV TTFK++L   G+IF   SEA+ EHP+LV+KYL +
Sbjct: 118 QERAALAG-----VAVDAVFDSVSVATTFKDKLGAMGIIFCSFSEAVREHPELVRKYLGS 172

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP GDNFYAALNSAVFTDGSFVY+PKGVRCPMELSTYFRIN K TGQFERTLIIAD GS
Sbjct: 173 VVPTGDNFYAALNSAVFTDGSFVYVPKGVRCPMELSTYFRINAKNTGQFERTLIIADAGS 232

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAAVVEL+A D+A IKYSTVQNWYPGD +GKGGIYNFVTKRG
Sbjct: 233 YVSYLEGCTAPMRDENQLHAAVVELIAHDDATIKYSTVQNWYPGDKEGKGGIYNFVTKRG 292

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C G  SKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+H+ 
Sbjct: 293 RCEGRNSKISWTQVETGSAITWKYPSCILKGDNSVGEFYSVALTNNYQQADTGTKMIHIG 352

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGISAG   NTYRG V +  GA  +RN++QCDSLLIG +CGAHT PYI+ +
Sbjct: 353 KNTKSTIVSKGISAGHGQNTYRGAVKILSGADGARNYSQCDSLLIGEDCGAHTFPYIDVQ 412

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEA+TSKI ++ +FYC QRGI  E A+++IVNGF +EV ++LPMEFAVEAQKL
Sbjct: 413 NPTARMEHEASTSKIGEDQIFYCNQRGIATEDAVSMIVNGFCKEVFRELPMEFAVEAQKL 472

Query: 480 IDISLEGSVG 489
           +++SLEGSVG
Sbjct: 473 LEVSLEGSVG 482


>gi|83952082|ref|ZP_00960814.1| FeS assembly protein SufB [Roseovarius nubinhibens ISM]
 gi|83837088|gb|EAP76385.1| FeS assembly protein SufB [Roseovarius nubinhibens ISM]
          Length = 507

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 349/494 (70%), Positives = 409/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ T+I+++ APKGL  DI+R IS K  EP WM EWRL AY R
Sbjct: 15  QETVDAVREVG-GAYKYGWNTDIEMEYAPKGLTPDIVRLISEKNEEPAWMTEWRLEAYER 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT ++P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WLTKEEPDWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRD +QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPQRDTSQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+KI WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRAKIMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG++CGAHT+PY
Sbjct: 374 IHLGKRTKSRIVSKGISAGRAQNTYRGLVSMHPKAKESRNYTQCDSLLIGSDCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ +FYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQMFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|313204298|ref|YP_004042955.1| iroN-regulated ABC transporter membrane component sufb
           [Paludibacter propionicigenes WB4]
 gi|312443614|gb|ADQ79970.1| Iron-regulated ABC transporter membrane component SufB
           [Paludibacter propionicigenes WB4]
          Length = 478

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 321/481 (66%), Positives = 390/481 (81%), Gaps = 6/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           D + ++    YKYGF T+I+ D  P GL+E+++R ISAKKNEP+WMLE+RL AYR WLTM
Sbjct: 4   DILDQVTQGDYKYGFTTDIETDIIPIGLSEEVVRLISAKKNEPEWMLEFRLKAYRHWLTM 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           + P+WA +  P ID+  + YYAAP+    P+SLD+VDPELL+T+EKLGIP+ E+  L+G+
Sbjct: 64  EMPTWAHLTVPEIDYQSISYYAAPR-KNAPKSLDEVDPELLKTFEKLGIPLHERMALSGI 122

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
                AVDAV DSVSV TTFKE L + G+IF   SEA+  HPDLV+KY+S+VVP  DNF+
Sbjct: 123 -----AVDAVMDSVSVKTTFKESLSELGIIFCSFSEAVEHHPDLVQKYMSSVVPYTDNFF 177

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           A LN AVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADE SYVSYLEGCT
Sbjct: 178 ATLNCAVFSDGSFVYIPKGVRCPMELSTYFRINAMNTGQFERTLIVADEDSYVSYLEGCT 237

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RDENQLHAA+VE+VA+ NAE+KYSTVQNWYPGD  GKGGIYNFVTKRG C+G  SKI
Sbjct: 238 APMRDENQLHAAIVEIVAMKNAEVKYSTVQNWYPGDKDGKGGIYNFVTKRGICKGDNSKI 297

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSA+TWKYPSC+L G+ S  EFYS+A++N  QQ D+GTKMLH+ KNT+S I+S
Sbjct: 298 SWTQVETGSAVTWKYPSCILLGDNSSAEFYSVAVTNHHQQADTGTKMLHIGKNTSSHILS 357

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N+YRG V V+  A ++RNF+QCDSLL+G+ CGAHT PY+E  N +  +EHE
Sbjct: 358 KGISAGKSQNSYRGLVKVNPAAENARNFSQCDSLLLGDKCGAHTFPYMEVNNDTAIVEHE 417

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSKI+++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ I+LEGSV
Sbjct: 418 ATTSKINEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLQITLEGSV 477

Query: 489 G 489
           G
Sbjct: 478 G 478


>gi|255036336|ref|YP_003086957.1| cysteine desulfurase activator complex subunit SufB [Dyadobacter
           fermentans DSM 18053]
 gi|254949092|gb|ACT93792.1| FeS assembly protein SufB [Dyadobacter fermentans DSM 18053]
          Length = 481

 Score =  558 bits (1439), Expect = e-157,   Method: Composition-based stats.
 Identities = 329/486 (67%), Positives = 393/486 (80%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +  + + +I   +YKYGF T+I+ D+AP GL++DI+RFISAKKNEP+WML+WRL AY 
Sbjct: 1   MSKEEELLEEITSSEYKYGFVTDIEADEAPAGLSDDIVRFISAKKNEPEWMLQWRLKAYH 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WLTM +P W  + YP I+F  + YY+APK     +S+DD+DPEL  T+E+LGI + EQ+
Sbjct: 61  LWLTMDEPKWPNVHYPPIEFQAIKYYSAPKKKKAVESIDDIDPELRNTFERLGISLNEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            ++G+     AVDAV DS SV TTFK+ LK+ G+IF  ISEAI EHP+LVKKYL +VVP 
Sbjct: 121 RISGI-----AVDAVMDSESVFTTFKDTLKEKGIIFCSISEAIREHPELVKKYLGSVVPP 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN+YAALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN  GTGQFERTLII DE S+VSY
Sbjct: 176 KDNYYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAAGTGQFERTLIIGDEDSHVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVE+ A DNA +KYSTVQNWYPGD  GKGGIYNFVTKRG C G
Sbjct: 236 LEGCTAPMRDENQLHAAVVEIFAHDNANVKYSTVQNWYPGDKDGKGGIYNFVTKRGLCDG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT 
Sbjct: 296 PNSKISWTQVETGSAITWKYPSVILKGDNSIGEFYSVAVTNNMQQADTGTKMIHIGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N+YRG V V + A  +RNF+QCDSLL+G+ CGAHT PYIE  N S 
Sbjct: 356 SRIVSKGISAGKSQNSYRGLVQVFKKAEKARNFSQCDSLLLGDKCGAHTFPYIEVNNPSA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ LFYC QRGIP E A+ALIVNG+ +EVL +LPMEFAVEAQKL++IS
Sbjct: 416 TVEHEATTSKIGEDILFYCNQRGIPTEQAVALIVNGYAKEVLNQLPMEFAVEAQKLLEIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|254510950|ref|ZP_05123017.1| FeS assembly protein SufB [Rhodobacteraceae bacterium KLH11]
 gi|221534661|gb|EEE37649.1| FeS assembly protein SufB [Rhodobacteraceae bacterium KLH11]
          Length = 507

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 345/494 (69%), Positives = 413/494 (83%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ET I+++ APKG+N DI+R IS K +EP+WM EWRL A+ R
Sbjct: 15  QETVDAVREVG-GAYKYGWETEIEMEYAPKGVNPDIVRLISDKNDEPEWMTEWRLAAFER 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  M++P+WA + YP IDF + YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WTKMEEPNWAMVNYPEIDFQNQYYYARPKSMEEKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF++ELK++GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAENAPAEGRKVAVDAVFDSVSVGTTFQKELKEAGVIFCSISEAIKEHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNW+PGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPQRDTAQLHAAVVEIIIEEDAEVKYSTVQNWFPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N +QQ D+GTKM
Sbjct: 314 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNYQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG V++H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 VHLGKNTKSRIVSKGISAGKAQNTYRGLVAMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE +N+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 434 IEVRNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|307609397|emb|CBW98886.1| hypothetical protein LPW_06731 [Legionella pneumophila 130b]
          Length = 482

 Score =  558 bits (1438), Expect = e-157,   Method: Composition-based stats.
 Identities = 328/487 (67%), Positives = 404/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ +++  +   +Y++GF T+I+V+  P GL+ED+IR +SA K EP+++LEWRL A+R
Sbjct: 1   MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIKGEPEFLLEWRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM+ P W+ + YP ID+  + YY+APKS    P+SLD+VDPELL+TYEKLGIP+REQ
Sbjct: 61  HWLTMQHPEWSSVHYPPIDYQSISYYSAPKSKKDAPKSLDEVDPELLKTYEKLGIPLREQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E+LAG     VAVDAVFDSVSV TTFK +L + GVIF P+SEA+ ++PDLVKKYL +VVP
Sbjct: 121 EMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYPDLVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN   TGQFERTLI+AD  SYVS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINAASTGQFERTLIVADVDSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+ALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G +SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+HL KNT
Sbjct: 296 GKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN +
Sbjct: 356 RSTIISKGISAGRAHNAYRGLVRIAPTATNARNYTQCDSMLMGSQCSAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+ I
Sbjct: 416 AQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGI 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|294677418|ref|YP_003578033.1| FeS assembly protein SufB [Rhodobacter capsulatus SB 1003]
 gi|294476238|gb|ADE85626.1| FeS assembly protein SufB [Rhodobacter capsulatus SB 1003]
          Length = 504

 Score =  558 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 345/494 (69%), Positives = 413/494 (83%), Gaps = 11/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RETV+ V+ +    YKYG+ET I+++ APKG++EDI+R ISAK NEPDWMLEWRL AYRR
Sbjct: 13  RETVETVQNM--GSYKYGWETEIEMEYAPKGISEDIVRLISAKNNEPDWMLEWRLEAYRR 70

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQE 123
           W+ M+ P WA ++ P ID+ DLYYYA PKS+   P+SL++VDP+LL TYEKLGIP++EQ 
Sbjct: 71  WVEMEMPDWALLKLPEIDYQDLYYYARPKSMVEKPKSLEEVDPKLLATYEKLGIPLKEQM 130

Query: 124 ILAGVQ--------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          +VAVDAVFDSVSV TTFKE+L ++GVIF  ISEAI EHP+LVK+
Sbjct: 131 ILAGVEGAENIDLSNRQVAVDAVFDSVSVGTTFKEKLAEAGVIFCSISEAIKEHPELVKQ 190

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TVVP  DNF+A LN AVF+DGSFVY+P G RCPMELSTYFRIN + TGQFERTLII 
Sbjct: 191 YLGTVVPQTDNFFATLNCAVFSDGSFVYVPPGTRCPMELSTYFRINAENTGQFERTLIIC 250

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+G+YVSYLEGCTAP+RD  QLHAAVVE+V L+++E+KYSTVQNW+PGD +GKGGIYNFV
Sbjct: 251 DKGAYVSYLEGCTAPKRDTAQLHAAVVEIVVLEDSEVKYSTVQNWFPGDEEGKGGIYNFV 310

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSAITWKYPSC+LRG++S GEFYSIAI+N +QQ D+GTKM
Sbjct: 311 TKRADCRGARAKVMWTQVETGSAITWKYPSCILRGDESQGEFYSIAIANNYQQADTGTKM 370

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 371 VHLGKNTRSRIVSKGISAGQAQNTYRGLVSMHPRAKNSRNYTQCDSLLIGDKCGAHTVPY 430

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF REVLQ LPMEFA+E
Sbjct: 431 IEVKNNSSRVEHEATTSKVDDDQLFYCRARGVGEEEAVALVVNGFCREVLQALPMEFAME 490

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 491 AQSLVAISLEGSVG 504


>gi|284038484|ref|YP_003388414.1| FeS assembly protein SufB [Spirosoma linguale DSM 74]
 gi|283817777|gb|ADB39615.1| FeS assembly protein SufB [Spirosoma linguale DSM 74]
          Length = 497

 Score =  558 bits (1437), Expect = e-157,   Method: Composition-based stats.
 Identities = 329/497 (66%), Positives = 393/497 (79%), Gaps = 11/497 (2%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +  D +  I   +YKYGFET I+ D+AP GL+E  IRFISAKKNEPDW+LE RL A+R
Sbjct: 1   MSKDADILESITNSEYKYGFETLIEADEAPVGLDESTIRFISAKKNEPDWLLENRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W  M +P W  + YP ID+  + YY+APK      SLD++DPELL T+ +LGI + EQ+
Sbjct: 61  MWQEMTEPKWPNVSYPKIDYQAIKYYSAPKQKKTVNSLDEIDPELLDTFNRLGISLVEQK 120

Query: 124 ILAGV-----------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDL 172
            LAGV              +VAVDAV DSVSV TTFK++L + G+IF  ISEA+ EHP+L
Sbjct: 121 RLAGVVDSSPLDTAPGDRPRVAVDAVMDSVSVATTFKKDLAERGIIFCSISEAVHEHPEL 180

Query: 173 VKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTL 232
           VKKY+ +VVP  DN++AALN+AVFTDGSF YIPKGVRCPMELSTYFRIN  GTGQFERTL
Sbjct: 181 VKKYMGSVVPAKDNYFAALNAAVFTDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTL 240

Query: 233 IIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIY 292
           I+ADEGSYVSYLEGCTAP RDENQLHAAVVELVA+ NAEIKYSTVQNWYPGD  GKGGIY
Sbjct: 241 IVADEGSYVSYLEGCTAPMRDENQLHAAVVELVAMGNAEIKYSTVQNWYPGDKDGKGGIY 300

Query: 293 NFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSG 352
           NFVTKRG C G  +KISWTQ+ETGS+ITWKYPS +L+G+ S GEFYS+A++N  QQ D+G
Sbjct: 301 NFVTKRGICDGPNAKISWTQVETGSSITWKYPSVILKGDNSIGEFYSVAVTNNMQQADTG 360

Query: 353 TKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHT 412
           TKM+H+ KNT SRIVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT
Sbjct: 361 TKMIHIGKNTKSRIVSKGISAGKSQNSYRGLVQVMKRAENARNYSQCDSLLLGDKCGAHT 420

Query: 413 IPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEF 472
            PY+E  N S  +EHEATTSKI ++ LFYC QRGIP E A+ALI+NG+ +EVL +LPMEF
Sbjct: 421 FPYLEVSNPSATVEHEATTSKIGEDQLFYCNQRGIPTEQAVALIINGYAKEVLNQLPMEF 480

Query: 473 AVEAQKLIDISLEGSVG 489
           AVEAQKL+ ISLEGSVG
Sbjct: 481 AVEAQKLLAISLEGSVG 497


>gi|83942221|ref|ZP_00954682.1| FeS assembly protein SufB [Sulfitobacter sp. EE-36]
 gi|83846314|gb|EAP84190.1| FeS assembly protein SufB [Sulfitobacter sp. EE-36]
          Length = 512

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 349/494 (70%), Positives = 410/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ T+I++D AP GLN DI++ IS K  EP+WMLEWRL AY R
Sbjct: 20  QETVDAVREVG-GAYKYGWSTDIEMDYAPLGLNADIVKLISEKNEEPEWMLEWRLAAYER 78

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT K+P+WA + YP IDF   YYYA PKS+   P+SLDDVDP+LL TY+KLGIP++EQ 
Sbjct: 79  WLTKKEPNWAMVDYPEIDFQQQYYYARPKSMAEKPKSLDDVDPKLLETYKKLGIPLKEQA 138

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF++ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 139 ILAGVEGAEKIGDEPRKVAVDAVFDSVSVGTTFQDELKKAGVIFCSISEAIREHPELVKK 198

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 199 YLGSVVPVNDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 258

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRDE+QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 259 DKGSYVSYLEGCTAPQRDESQLHAAVVEIIIEEDAEVKYSTVQNWYPGDEDGKGGIYNFV 318

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 319 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 378

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG V++H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 379 IHLGKRTKSRIVSKGISAGKAQNTYRGLVTMHPKAKESRNYTQCDSLLIGDKCGAHTVPY 438

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 439 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 498

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 499 AQALVAISLEGSVG 512


>gi|149202629|ref|ZP_01879601.1| component of SufBCD complex [Roseovarius sp. TM1035]
 gi|149143911|gb|EDM31945.1| component of SufBCD complex [Roseovarius sp. TM1035]
          Length = 507

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 348/494 (70%), Positives = 414/494 (83%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++  + YKYG+ T+I++D AP GLNEDI+R IS+K  EP+WM EWRL AYRR
Sbjct: 15  QETVDAVRQVG-EAYKYGWNTDIEMDYAPLGLNEDIVRLISSKNEEPEWMTEWRLEAYRR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT  +P WA + YP IDF   YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WLTKTEPEWAMVDYPKIDFQAQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQL 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF++EL+++GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQKELRQAGVIFCSISEAIREHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP+RD +QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPKRDTSQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N +QQ D+GTKM
Sbjct: 314 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNYQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 IHLGKNTRSRIVSKGISAGHAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ +FYC  RG+ EE A+AL+VNGF R+VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQMFYCRARGMDEEEAVALVVNGFCRDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|53804894|ref|YP_113470.1| cysteine desulfurase activator complex subunit SufB [Methylococcus
           capsulatus str. Bath]
 gi|53758655|gb|AAU92946.1| FeS assembly protein SufB [Methylococcus capsulatus str. Bath]
          Length = 481

 Score =  557 bits (1436), Expect = e-156,   Method: Composition-based stats.
 Identities = 336/489 (68%), Positives = 402/489 (82%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  ET+D+   +    YK GF T ++ D  P GLNED+IR IS KKNEP++MLEWRL 
Sbjct: 1   MSATAETLDR---LIKQDYKPGFVTELETDTLPPGLNEDVIRAISKKKNEPEFMLEWRLS 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WLTM +P WA + Y  +D+  + YY+APK+   P+SLD+VDP+LL TY KLGIP+ 
Sbjct: 58  AYRHWLTMMEPHWAFVEYAPVDYQAISYYSAPKTTDHPKSLDEVDPKLLETYNKLGIPLY 117

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE LAG     VAVDAVFDSVSV TTFK++L ++GVIF  +SEAI +HPDLV++YL +V
Sbjct: 118 EQEKLAG-----VAVDAVFDSVSVATTFKDKLAQAGVIFCSMSEAIEKHPDLVRQYLGSV 172

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP GDNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADEGSY
Sbjct: 173 VPAGDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAAKTGQFERTLIVADEGSY 232

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVAL+ A+IKYSTVQNWYPGD +G+GGIYNFVTKRGD
Sbjct: 233 VSYLEGCTAPMRDENQLHAAVVELVALEGAQIKYSTVQNWYPGDEEGRGGIYNFVTKRGD 292

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++N  QQ D+GTKM+H+ K
Sbjct: 293 CRGARSKISWTQVETGSAITWKYPSCILRGDDSVGEFYSVAVTNHRQQADTGTKMIHIGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG + N+YRG V + + A ++RN+TQCDSLLIG+ CGAHT PYIE K 
Sbjct: 353 NTKSTIISKGISAGRAQNSYRGLVKILKSAENARNYTQCDSLLIGDRCGAHTFPYIEVKQ 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEATTSKIS++ LF+C QRG+  E A+++IVNGF ++V ++LPMEFAVEAQ L+
Sbjct: 413 PSAQVEHEATTSKISEDQLFFCQQRGLSAEDAVSMIVNGFCKQVFKELPMEFAVEAQALL 472

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 473 GISLEGSVG 481


>gi|159027406|emb|CAO86890.1| sufB [Microcystis aeruginosa PCC 7806]
          Length = 480

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 311/490 (63%), Positives = 388/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +  P+GLNE+IIR ISAKK EP++ML++RL 
Sbjct: 1   MSAT-----TVKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLR 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY +W  M +PSW  + YPAID+ ++ YY+APK       SL++VDP L+ T+EKLGIP+
Sbjct: 56  AYHQWQKMTEPSWPHVSYPAIDYQNIIYYSAPKQKKAKLNSLEEVDPTLIETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVS+ TTFKE+L + GVIF  ISEA+ EHPDLV+KYL +
Sbjct: 116 SEQKRLS-----NVAVDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPVGDN++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVGDNYFAALNSAVFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD+ GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDSNQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           +NT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 RNTKSTIISKGISAGNSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S  +EHEA+TSKI ++ LFY  QRGI EE A++++V+GF ++VL KLPMEFA EA KL
Sbjct: 411 NNSAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|17229984|ref|NP_486532.1| cysteine desulfurase activator complex subunit SufB [Nostoc sp. PCC
           7120]
 gi|17131584|dbj|BAB74191.1| alr2492 [Nostoc sp. PCC 7120]
          Length = 479

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 310/490 (63%), Positives = 392/490 (80%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P+GL+ED++R IS KKNEP++MLE+RL 
Sbjct: 1   MSAT------VKTLVNQPYKYGFVTDIEADTIPRGLDEDVVRLISTKKNEPEFMLEFRLR 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+R+W  M +P+W  ++YP ID+ ++ YY+APK       SLD+VDP L+ T+EKLGIP+
Sbjct: 55  AFRQWQKMTEPTWPSVKYPPIDYQNIIYYSAPKQKKAKLNSLDEVDPTLIETFEKLGIPL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ LA      VAVDA+FDSVSV TTFKE+L K GVIF  ISEA+ EHP+L+KKYL +
Sbjct: 115 SEQKRLA-----NVAVDAIFDSVSVATTFKEKLAKDGVIFCSISEALQEHPELIKKYLGS 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP+ DN++AALN+AVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+EGS
Sbjct: 170 VVPIADNYFAALNAAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGS 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP  D NQLHAAVVELVALDNAEIKYSTVQNWY GD+ GKGGIYNFVTKRG
Sbjct: 230 YVSYLEGCTAPMYDSNQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ 
Sbjct: 290 LCQGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S+N+YRG V ++  A  +RN++QCDS+LIG+N  A+T PYI+ +
Sbjct: 350 KNTRSTIISKGISAGQSSNSYRGLVKINPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQ 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LF+  QRGI  E AI+++++GF ++V  +LPMEFAVEA KL
Sbjct: 410 NNTGKVEHEASTSKIGEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEADKL 469

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 470 LSLKLEGSVG 479


>gi|110679916|ref|YP_682923.1| cysteine desulfurase activator complex subunit SufB [Roseobacter
           denitrificans OCh 114]
 gi|109456032|gb|ABG32237.1| FeS assembly protein SufB [Roseobacter denitrificans OCh 114]
          Length = 512

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 341/494 (69%), Positives = 409/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD VR++   +YK+G+ T+I+++ APKGL+ +I+R IS K  EP+WMLEWRL AY R
Sbjct: 20  QDTVDAVREVG-GKYKHGWSTDIEMEYAPKGLSPEIVRLISEKNEEPEWMLEWRLAAYER 78

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL   +P WA + YP IDF D YYYA PKS+   P+SLDDVDP+LL TY+KLGIP++EQ 
Sbjct: 79  WLQKSEPKWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDDVDPKLLETYQKLGIPLKEQM 138

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVS+ TTF++EL K+GVIF  ISEAI +HP+LVKK
Sbjct: 139 ILAGVEGAEELTDEPRKVAVDAVFDSVSLGTTFRDELMKAGVIFCSISEAIKDHPELVKK 198

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DN+YA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 199 YLGSVVPVSDNYYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 258

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNWYPGD +GKGGIYNFV
Sbjct: 259 DKGSYVSYLEGCTAPQRDIAQLHAAVVEIIVEEDAEVKYSTVQNWYPGDEEGKGGIYNFV 318

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 319 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 378

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 379 IHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 438

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 439 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 498

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 499 AQQLVAISLEGSVG 512


>gi|260428090|ref|ZP_05782069.1| FeS assembly protein SufB [Citreicella sp. SE45]
 gi|260422582|gb|EEX15833.1| FeS assembly protein SufB [Citreicella sp. SE45]
          Length = 517

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 347/506 (68%), Positives = 409/506 (80%), Gaps = 22/506 (4%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
            +ETVD V  I    YKYG+ET+I+++ APKG+N DI+R IS K  EP+WM EWRL A+ 
Sbjct: 14  EQETVDAVEAI--STYKYGWETDIEMEYAPKGVNPDIVRLISEKNEEPEWMTEWRLKAFE 71

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQ 122
           RW  MK+P+WA + YP IDF + YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ
Sbjct: 72  RWTQMKEPTWAMVDYPEIDFQEQYYYARPKSMATKPKSLDEVDPKLLATYEKLGIPLKEQ 131

Query: 123 EILAGVQT-------------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPIS 163
            ILAGV+                     +VAVDAVFDSVSV TTFK+EL+K+GVIF  IS
Sbjct: 132 MILAGVEGADDAPADAAGALSATAGSDRRVAVDAVFDSVSVGTTFKKELEKAGVIFCSIS 191

Query: 164 EAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEK 223
           EAI EHP+LVKKYL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN +
Sbjct: 192 EAIREHPELVKKYLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAE 251

Query: 224 GTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPG 283
            TGQFERTLIIAD+GSYVSYLEGCTAP+RD  QLHAAVVE++  ++AE+KYSTVQNW+PG
Sbjct: 252 NTGQFERTLIIADKGSYVSYLEGCTAPKRDTAQLHAAVVEIIVEEDAEVKYSTVQNWFPG 311

Query: 284 DSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAIS 343
           D  GKGGIYNFVTKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+
Sbjct: 312 DENGKGGIYNFVTKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIA 371

Query: 344 NGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLL 403
           N  QQ D+GTKM+HL K+T SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLL
Sbjct: 372 NNHQQADTGTKMIHLGKDTRSRIVSKGISAGVAQNTYRGLVSMHPKAKNSRNYTQCDSLL 431

Query: 404 IGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVRE 463
           IG+ CGAHT+PYIE KN+S   EHEATTSK+ DE LFYC QRG+ EE A+AL+VNGF +E
Sbjct: 432 IGDKCGAHTVPYIEVKNNSSRCEHEATTSKVDDEQLFYCRQRGMDEEEAVALVVNGFCKE 491

Query: 464 VLQKLPMEFAVEAQKLIDISLEGSVG 489
           VLQ LPMEFA+EAQ L+ ISLEGSVG
Sbjct: 492 VLQALPMEFAMEAQALVAISLEGSVG 517


>gi|262277360|ref|ZP_06055153.1| FeS assembly protein SufB [alpha proteobacterium HIMB114]
 gi|262224463|gb|EEY74922.1| FeS assembly protein SufB [alpha proteobacterium HIMB114]
          Length = 483

 Score =  557 bits (1435), Expect = e-156,   Method: Composition-based stats.
 Identities = 346/490 (70%), Positives = 409/490 (83%), Gaps = 8/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  E + + +  D  +Y +GF T+I   + PKGL+E+ IRFIS +K EP WML+WRL 
Sbjct: 1   MSASDEIIQQYQ--DRSEYDHGFVTDIDTIEVPKGLSEETIRFISKQKKEPQWMLDWRLN 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPI 119
           AY R   M++P W + +YP I++ DLYYY+APKS   GP+SLD++DPE+ +TY+KLGIP+
Sbjct: 59  AYNRLQKMEEPDWQKPKYPKINYQDLYYYSAPKSFKDGPKSLDEIDPEIKKTYDKLGIPL 118

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+G     VAVDAVFDSVSV TTFK++LK+ GVIF  ISEA  EHP+LVKKYL +
Sbjct: 119 EEQKRLSG-----VAVDAVFDSVSVATTFKDKLKEIGVIFCSISEATREHPELVKKYLGS 173

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           V+PV D+F+A LNSAVFTDGSFVYIP GVRCPMELSTYFRIN + TGQFERTLIIAD+ S
Sbjct: 174 VIPVTDHFFATLNSAVFTDGSFVYIPPGVRCPMELSTYFRINAQNTGQFERTLIIADKDS 233

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA VELVALD AEIKYSTVQNWYPGD +GKGGIYNFVTKRG
Sbjct: 234 YVSYLEGCTAPMRDENQLHAANVELVALDGAEIKYSTVQNWYPGDKEGKGGIYNFVTKRG 293

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+AI+N FQ+ D+GTKM+HL 
Sbjct: 294 DCRGKNSKISWTQVETGSAITWKYPSCILRGDNSQGEFYSVAITNNFQKADTGTKMIHLG 353

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S+I+SKGISAG ++NTYRG VSVH  A  S+NFTQCDSLL+GN CGAHT+PYIE+K
Sbjct: 354 KNTKSKIISKGISAGQADNTYRGLVSVHPKATGSKNFTQCDSLLVGNKCGAHTVPYIENK 413

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NSS  +EHEATTSKISD+ LFYC QRG+ +E A++LIVNGF +EVLQ+LPMEFAVEAQKL
Sbjct: 414 NSSSEVEHEATTSKISDDQLFYCRQRGLNQEEAVSLIVNGFCKEVLQQLPMEFAVEAQKL 473

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 474 VGISLEGSVG 483


>gi|52840838|ref|YP_094637.1| cysteine desulfurase activator complex subunit SufB [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
 gi|52627949|gb|AAU26690.1| ABC transporter, permease [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 482

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 326/487 (66%), Positives = 401/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ +++  +   +Y++GF T+I+V+  P GL+ED+IR +SA K EP+++LEWRL A+R
Sbjct: 1   MAKSSEQLNSLLDREYQHGFITDIEVETFPPGLDEDVIRRLSAIKGEPEFLLEWRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM  P W+ + Y  ID+  + YY+APKS    P+SLD+VDPELL+TYEKLGIP+REQ
Sbjct: 61  HWLTMPHPEWSSVHYLPIDYQSISYYSAPKSKKDAPKSLDEVDPELLKTYEKLGIPLREQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E+LAG     VAVDAVFDSVSV TTFK +L + GVIF P+SEA+ ++PDLVKKYL +VVP
Sbjct: 121 EMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPLSEAVHQYPDLVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVY+P GVRCPMELSTYFRIN   TGQFERTLI+AD  SYVS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYVPNGVRCPMELSTYFRINAASTGQFERTLIVADVDSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+ALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELIALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G +SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+HL KNT
Sbjct: 296 GKKSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNFQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN +
Sbjct: 356 RSTIISKGISAGHAHNAYRGLVRIAPTATNARNYTQCDSMLMGSQCSAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+ I
Sbjct: 416 AQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGI 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|83955456|ref|ZP_00964087.1| FeS assembly protein SufB [Sulfitobacter sp. NAS-14.1]
 gi|83840100|gb|EAP79275.1| FeS assembly protein SufB [Sulfitobacter sp. NAS-14.1]
          Length = 515

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 348/494 (70%), Positives = 410/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YKYG+ T+I++D AP GLN DI++ IS K  EP+WMLEWRL AY R
Sbjct: 23  QETVDAVREVG-GAYKYGWSTDIEMDYAPLGLNADIVKLISEKNEEPEWMLEWRLAAYER 81

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT K+P+WA + YP IDF   YYYA PKS+   P+SLDDVDP+LL TY+KLGIP++EQ 
Sbjct: 82  WLTKKEPNWAMVDYPEIDFQQQYYYARPKSMAEKPKSLDDVDPKLLETYKKLGIPLKEQA 141

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF++ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 142 ILAGVEGAEKMGDEPRKVAVDAVFDSVSVGTTFQDELKKAGVIFCSISEAIREHPELVKK 201

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 202 YLGSVVPVNDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 261

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRDE+QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 262 DKGSYVSYLEGCTAPQRDESQLHAAVVEIIIEEDAEVKYSTVQNWYPGDEDGKGGIYNFV 321

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ ++GTKM
Sbjct: 322 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQAETGTKM 381

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG V++H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 382 IHLGKRTKSRIVSKGISAGKAQNTYRGLVTMHPKAKESRNYTQCDSLLIGDKCGAHTVPY 441

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 442 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 501

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 502 AQALVAISLEGSVG 515


>gi|166365050|ref|YP_001657323.1| cysteine desulfurase activator complex subunit SufB [Microcystis
           aeruginosa NIES-843]
 gi|166087423|dbj|BAG02131.1| Fe-S cluster assembly protein [Microcystis aeruginosa NIES-843]
          Length = 480

 Score =  556 bits (1434), Expect = e-156,   Method: Composition-based stats.
 Identities = 311/490 (63%), Positives = 388/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +  P+GLNE+IIR ISAKK EP++ML++RL 
Sbjct: 1   MSAT-----TVKNLVNQPYKYGFITDIESETIPRGLNEEIIRLISAKKKEPEFMLDFRLR 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           AY +W  M +PSW  + YPAID+ ++ YY+APK       SL++VDP L+ T+EKLGIP+
Sbjct: 56  AYHQWQKMTEPSWPHVSYPAIDYQNIIYYSAPKQKKEKLNSLEEVDPTLIETFEKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDA+FDSVS+ TTFKE+L + GVIF  ISEA+ EHPDLV+KYL +
Sbjct: 116 SEQKRLS-----NVAVDAIFDSVSIATTFKEKLAEQGVIFCSISEALQEHPDLVQKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPVGDN++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+
Sbjct: 171 VVPVGDNYFAALNSAVFSDGSFVFIPKGVVCPMELSTYFRINNGETGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD+ GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMYDSNQLHAAVVELVALDNADIKYSTVQNWYAGDANGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           +NT S I+SKGISAG S N+YRG V +   A  +RN++QCDS+LIG+N  A+T PYI+  
Sbjct: 351 RNTKSTIISKGISAGNSQNSYRGLVKMGPKAKGARNYSQCDSMLIGDNAEANTFPYIQVD 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S  +EHEA+TSKI ++ LFY  QRGI EE A++++V+GF ++VL KLPMEFA EA KL
Sbjct: 411 NNSAKVEHEASTSKIGEDQLFYFAQRGISEEDAVSMLVSGFCKDVLSKLPMEFAAEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 471 LSLKLEGTVG 480


>gi|89068823|ref|ZP_01156206.1| FeS assembly protein SufB [Oceanicola granulosus HTCC2516]
 gi|89045593|gb|EAR51656.1| FeS assembly protein SufB [Oceanicola granulosus HTCC2516]
          Length = 514

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 352/498 (70%), Positives = 413/498 (82%), Gaps = 14/498 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            ETV+ VRK+   +YKYG+ET+I++D APKGL+EDI+R IS K +EP+WM EWRL AY R
Sbjct: 18  EETVEAVRKL-SGKYKYGWETDIEMDYAPKGLSEDIVRLISGKNDEPEWMTEWRLGAYAR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL M +P WA + YP IDF D YYYA PKS    P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 77  WLKMDEPDWAMVEYPEIDFQDQYYYARPKSFETKPKSLDEVDPKLLETYQKLGIPLKEQM 136

Query: 124 ILAGVQT------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           ILAGV+              KVAVDAVFDSVSV TTF++EL+K+GVIF  ISEAI EHP+
Sbjct: 137 ILAGVEGADEVATPEDNSERKVAVDAVFDSVSVGTTFQKELQKAGVIFCSISEAIREHPE 196

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LVKKYL +VVP GDNFYAALNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERT
Sbjct: 197 LVKKYLGSVVPQGDNFYAALNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERT 256

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNWYPGD +G+GGI
Sbjct: 257 LIIADKGSYVSYLEGCTAPQRDTAQLHAAVVEIIVEEDAEVKYSTVQNWYPGDEEGRGGI 316

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+
Sbjct: 317 YNFVTKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAITNNHQQADT 376

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAH
Sbjct: 377 GTKMVHLGKRTKSRIVSKGISAGQAQNTYRGLVSMHPKALESRNYTQCDSLLIGDQCGAH 436

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE KN+S  +EHEATTSK+ DE +FYC QRG+ EE A+ALIVNGF +EVLQ LPME
Sbjct: 437 TVPYIEVKNNSSRVEHEATTSKVDDEQMFYCRQRGMDEEEAVALIVNGFAKEVLQALPME 496

Query: 472 FAVEAQKLIDISLEGSVG 489
           FA+EAQ+L+ ISLEGSVG
Sbjct: 497 FAMEAQQLVAISLEGSVG 514


>gi|108762986|ref|YP_629413.1| cysteine desulfurase activator complex subunit SufB [Myxococcus
           xanthus DK 1622]
 gi|108466866|gb|ABF92051.1| FeS assembly protein SufB [Myxococcus xanthus DK 1622]
          Length = 478

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 319/481 (66%), Positives = 391/481 (81%), Gaps = 6/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + ++++    Y  GF T ++ D  P GL+ED+IR ISAKK EP+++L+WRL A+R W TM
Sbjct: 4   ETLQELTRRPYAAGFVTQLESDTFPPGLDEDVIRQISAKKGEPEFLLDWRLKAFRHWKTM 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K+P+W  + Y  ID+  + YY+APK      SLD+VDPE+LRTYEKLGIP+ EQ++L   
Sbjct: 64  KEPTWQAVTYAPIDYQAIRYYSAPKQKPVKASLDEVDPEILRTYEKLGIPLHEQKLLQ-- 121

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVSV TTFK++L K+GVIF   SEA+ EHP+LVKKYL TVVP  DN++
Sbjct: 122 ---NVAVDAVFDSVSVATTFKDKLAKAGVIFCSFSEAVREHPELVKKYLGTVVPYSDNYF 178

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+A+EGS+VSYLEGCT
Sbjct: 179 AALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAADTGQFERTLIVAEEGSHVSYLEGCT 238

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RD NQLHAAVVELVALDNA IKYSTVQNWYPGD++G+GGIYNFVTKRG      +KI
Sbjct: 239 APMRDTNQLHAAVVELVALDNATIKYSTVQNWYPGDAEGRGGIYNFVTKRGIAH-RAAKI 297

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N  QQ D+GTKM+H+ KN+ S IVS
Sbjct: 298 SWTQVETGSAITWKYPSVILKGDDSVGEFYSVALTNHMQQADTGTKMVHIGKNSRSTIVS 357

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG   NTYRG V V + A ++RN+TQCDSLL+G+ CGAHT+PYIE KN+S  +EHE
Sbjct: 358 KGISAGRGQNTYRGLVKVLKSAENARNYTQCDSLLLGDKCGAHTVPYIEVKNASAQVEHE 417

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LFYC QRGI +E A+++IVNGF R+V ++LPMEFAVEAQKL+ +SLEGSV
Sbjct: 418 ASTSKIGEDQLFYCRQRGISQEDAVSMIVNGFCRQVFKELPMEFAVEAQKLLGVSLEGSV 477

Query: 489 G 489
           G
Sbjct: 478 G 478


>gi|254697310|ref|ZP_05159138.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|256159653|ref|ZP_05457410.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M490/95/1]
 gi|260761720|ref|ZP_05874063.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|265998074|ref|ZP_06110631.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M490/95/1]
 gi|260672152|gb|EEX58973.1| cysteine desulfurase activator complex subunit SufB [Brucella
           abortus bv. 2 str. 86/8/59]
 gi|262552542|gb|EEZ08532.1| cysteine desulfurase activator complex subunit SufB [Brucella ceti
           M490/95/1]
          Length = 487

 Score =  556 bits (1433), Expect = e-156,   Method: Composition-based stats.
 Identities = 381/487 (78%), Positives = 430/487 (88%), Gaps = 18/487 (3%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV+ET+D+VR +DVDQYKYGFET I+ DKAPKGLNEDIIRFISAKKNEP+WMLEWRL 
Sbjct: 1   MPAVQETIDQVRGLDVDQYKYGFETTIEADKAPKGLNEDIIRFISAKKNEPEWMLEWRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY RWLTM++P+WAR+ YP IDF D YYY+APK+  GP+SLD+VDPELL+TYEKLGIP+R
Sbjct: 61  AYERWLTMEEPTWARVDYPKIDFQDAYYYSAPKNQSGPKSLDEVDPELLKTYEKLGIPLR 120

Query: 121 EQEILAGV------------------QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPI 162
           EQEILAGV                   + +VAVDAVFDSVSVVTTFKEEL K+GVIF  I
Sbjct: 121 EQEILAGVRKQGEPSEIDGNPADNVYASGRVAVDAVFDSVSVVTTFKEELSKAGVIFCSI 180

Query: 163 SEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE 222
           SEAI EHP+LV+KYL++VVPV DN+YA LNSAVFTDGSFVY+PKGVRCPMELSTYFRINE
Sbjct: 181 SEAIREHPELVQKYLASVVPVSDNYYATLNSAVFTDGSFVYVPKGVRCPMELSTYFRINE 240

Query: 223 KGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYP 282
           K TGQFERTLIIADEG+YVSYLEGCTAPQRDENQLHAAVVELVA++NAEIKYSTVQNW+P
Sbjct: 241 KNTGQFERTLIIADEGAYVSYLEGCTAPQRDENQLHAAVVELVAMENAEIKYSTVQNWFP 300

Query: 283 GDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAI 342
           GD  GKGGIYNFVTKRGDCRG  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYSIA+
Sbjct: 301 GDKDGKGGIYNFVTKRGDCRGDNSKISWTQVETGSAITWKYPSCILRGDNSRGEFYSIAV 360

Query: 343 SNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSL 402
           SNG QQIDSGTKMLHL KNT+SRI+SKGISAG SNNTYRG+VS HR A ++RNFTQCDSL
Sbjct: 361 SNGHQQIDSGTKMLHLGKNTSSRIISKGISAGKSNNTYRGQVSAHRKAENARNFTQCDSL 420

Query: 403 LIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVR 462
           LIGN+CGAHT+PYIE+KN++   EHEATTSKIS++ LFY +QRGIPEE AIALIVNGFV+
Sbjct: 421 LIGNDCGAHTVPYIEAKNATAQFEHEATTSKISEDQLFYVMQRGIPEEEAIALIVNGFVK 480

Query: 463 EVLQKLP 469
           EV+Q+LP
Sbjct: 481 EVIQELP 487


>gi|218264754|ref|ZP_03478466.1| hypothetical protein PRABACTJOHN_04175 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221803|gb|EEC94453.1| hypothetical protein PRABACTJOHN_04175 [Parabacteroides johnsonii
           DSM 18315]
          Length = 481

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 316/486 (65%), Positives = 388/486 (79%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ D + ++    YKYGF T+I  +   +GL+E+ +R ISAKKNEP+W+LE+RL A+R
Sbjct: 1   MEDSNDILNEVTTGDYKYGFVTDIDTEVIHRGLDEETVRIISAKKNEPEWLLEFRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W T++ P+W  +  P ID+ D+ YYAAPK   GP+SLD+VDPEL++T++KLGIP+ E+ 
Sbjct: 61  HWQTLEMPAWPHLNIPPIDYQDIIYYAAPKKKEGPKSLDEVDPELMKTFDKLGIPLHERA 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+  HPDLV+KYL +VV  
Sbjct: 121 QLSG-----MAVDAVMDSVSVKTTFKETLAEKGIIFSSFSEAVQHHPDLVQKYLGSVVSY 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ +YVSY
Sbjct: 176 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDEAYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+VA + AE+KYSTVQNWYPGD +GKGGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPMRDENQLHAAIVEIVAHERAEVKYSTVQNWYPGDKEGKGGIYNFVTKRGLCKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+HL +NT 
Sbjct: 296 EGSKISWTQVETGSAITWKYPSCILAGDNSVGEFYSVAVTNNYQQADTGTKMIHLGRNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A  +RN +QCDSLL+ + CGAHT PY + +N + 
Sbjct: 356 STIVSKGISAGHSQNSYRGLVKVSPRAEGARNHSQCDSLLLSSTCGAHTFPYTDIQNETA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS+E LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ IS
Sbjct: 416 VVEHEATTSKISEEQLFYCRQRGISVEEAVGLIVNGYAREVMNKLPMEFAVEAQKLLTIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|150010116|ref|YP_001304859.1| cysteine desulfurase activator complex subunit SufB
           [Parabacteroides distasonis ATCC 8503]
 gi|255012624|ref|ZP_05284750.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 2_1_7]
 gi|256838939|ref|ZP_05544449.1| FeS assembly protein SufB [Parabacteroides sp. D13]
 gi|262382597|ref|ZP_06075734.1| FeS assembly protein SufB [Bacteroides sp. 2_1_33B]
 gi|298374486|ref|ZP_06984444.1| FeS assembly protein SufB [Bacteroides sp. 3_1_19]
 gi|301308166|ref|ZP_07214120.1| FeS assembly protein SufB [Bacteroides sp. 20_3]
 gi|149938540|gb|ABR45237.1| ABC transporter, permease [Parabacteroides distasonis ATCC 8503]
 gi|256739858|gb|EEU53182.1| FeS assembly protein SufB [Parabacteroides sp. D13]
 gi|262295475|gb|EEY83406.1| FeS assembly protein SufB [Bacteroides sp. 2_1_33B]
 gi|298268854|gb|EFI10509.1| FeS assembly protein SufB [Bacteroides sp. 3_1_19]
 gi|300833636|gb|EFK64252.1| FeS assembly protein SufB [Bacteroides sp. 20_3]
          Length = 481

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 318/486 (65%), Positives = 389/486 (80%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           ++++   + ++    YKYGF T+I  +   +GL+E+ +R ISAKKNEP+W+LE+RL A+R
Sbjct: 1   MQDSNHIINEVTSGDYKYGFVTDIDTEVIHRGLDEETVRIISAKKNEPEWLLEFRLKAFR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W T++ P+W  +  P ID+ D+ YYAAPK   GP+SLD+VDPELL+T++KLGIP+ EQ+
Sbjct: 61  HWQTLEMPTWPHLNIPPIDYQDIIYYAAPKKKEGPKSLDEVDPELLKTFDKLGIPLEEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+  HPDLV+KYL +VV  
Sbjct: 121 HLSG-----MAVDAVMDSVSVKTTFKENLAEKGIIFCSFSEAVQHHPDLVQKYLGSVVGY 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ +YVSY
Sbjct: 176 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDEAYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+VA + AE+KYSTVQNWYPGD +GKGGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPMRDENQLHAAIVEIVANERAEVKYSTVQNWYPGDKEGKGGIYNFVTKRGLCKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 296 EGSKISWTQVETGSAITWKYPSCILAGDNSVGEFYSVAVTNNYQQADTGTKMIHLGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A  +RN +QCDSLL+ + CGAHT PY + +N + 
Sbjct: 356 STIVSKGISAGHSQNSYRGLVKVSARAEGARNHSQCDSLLLSSTCGAHTFPYADIQNETA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS+E LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ IS
Sbjct: 416 IVEHEATTSKISEEQLFYCQQRGISVEEAVGLIVNGYAREVMNKLPMEFAVEAQKLLTIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|160887873|ref|ZP_02068876.1| hypothetical protein BACUNI_00276 [Bacteroides uniformis ATCC 8492]
 gi|270294864|ref|ZP_06201065.1| FeS assembly protein SufB [Bacteroides sp. D20]
 gi|156862559|gb|EDO55990.1| hypothetical protein BACUNI_00276 [Bacteroides uniformis ATCC 8492]
 gi|270274111|gb|EFA19972.1| FeS assembly protein SufB [Bacteroides sp. D20]
          Length = 484

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 318/486 (65%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  D   +GLNED++R IS KK EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTDIIERGLNEDVVRLISEKKGEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VVP 
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVQKYLGSVVPY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++G+GG+YNFVTKRG C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGRGGVYNFVTKRGHCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N  QQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNHQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGKSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 IVEHEATTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|114776742|ref|ZP_01451785.1| FeS assembly protein SufB [Mariprofundus ferrooxydans PV-1]
 gi|114552828|gb|EAU55259.1| FeS assembly protein SufB [Mariprofundus ferrooxydans PV-1]
          Length = 484

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 332/490 (67%), Positives = 394/490 (80%), Gaps = 7/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M  V++   K  +     Y+ GF T+I  D  P GLNED+IR ISAKK+EP+W+L WRL 
Sbjct: 1   MSEVKQER-KPEEFTNRDYQAGFITDIDTDTLPPGLNEDVIRHISAKKDEPEWLLNWRLE 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPI 119
           A+R W TM +P W  + Y   D+  + YY+APKS   GP+SLD+VDP+LL TY KLGIP+
Sbjct: 60  AFRHWQTMTEPHWPNVTYTPTDYQSISYYSAPKSQADGPKSLDEVDPKLLETYAKLGIPL 119

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           REQE LAG     VAVDAVFDSVSV TTFK +LK  GVIF PISEA+ ++P+LV++YL T
Sbjct: 120 REQEFLAG-----VAVDAVFDSVSVATTFKGKLKDVGVIFCPISEAVRDYPELVQQYLGT 174

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP GDNF+AALNSAVFTDGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLIIA+EGS
Sbjct: 175 VVPTGDNFFAALNSAVFTDGSFVFIPKGVRCPMELSTYFRINALNTGQFERTLIIAEEGS 234

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVELVALD+A+IKYSTVQNWYPGD  G GGIYNFVTKR 
Sbjct: 235 YVSYLEGCTAPQRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDENGLGGIYNFVTKRA 294

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG RSK+SWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++   QQ D+GTKM+H+ 
Sbjct: 295 DCRGARSKVSWTQVETGSAITWKYPSCVLRGDDSVGEFYSVALTKMRQQADTGTKMIHIG 354

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGI+AGF N +YRG V + + A  +RN+TQCDSLLIG+ CGAHT PY+E K
Sbjct: 355 KNTRSTIVSKGIAAGFGNQSYRGLVRIAKSAEGARNYTQCDSLLIGDKCGAHTFPYVEVK 414

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  +EHEATTSKI ++ LFYC  RGI EE A+ +IVNGF ++V  +LPMEFAVEA +L
Sbjct: 415 NPSATMEHEATTSKIGEDQLFYCQSRGISEEDAVNMIVNGFCKDVFNELPMEFAVEANRL 474

Query: 480 IDISLEGSVG 489
           +++SLEG+VG
Sbjct: 475 MEVSLEGAVG 484


>gi|262196470|ref|YP_003267679.1| FeS assembly protein SufB [Haliangium ochraceum DSM 14365]
 gi|262079817|gb|ACY15786.1| FeS assembly protein SufB [Haliangium ochraceum DSM 14365]
          Length = 479

 Score =  556 bits (1432), Expect = e-156,   Method: Composition-based stats.
 Identities = 325/486 (66%), Positives = 389/486 (80%), Gaps = 7/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  T D + ++   +Y  GF T+I+ D AP GL+E II FISAKK EP W+LE RL A++
Sbjct: 1   MSTTTDHIDQLLQQKYAAGFVTDIEQDYAPPGLDESIIAFISAKKEEPAWLLERRLEAFQ 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W +M  P WA + YP ID+  + YYAAPK     +SLD+VDPE+L TY+KLGIP+ E+ 
Sbjct: 61  YWKSMPTPEWANVEYPPIDYQAISYYAAPK--KKLESLDEVDPEILATYDKLGIPLHERA 118

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            LAG     VAVDAVFDSVSV TTFK++L   GVIF  ISEA+ EHP+L+KKY+ +VVP 
Sbjct: 119 ALAG-----VAVDAVFDSVSVATTFKDKLAAEGVIFCSISEAVREHPELIKKYMGSVVPY 173

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN+YAALN+AVFTDGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIA+EGSYVSY
Sbjct: 174 TDNYYAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIAEEGSYVSY 233

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVELVA D+A IKYSTVQNWYPGD+ GKGGIYNFVTKRG C G
Sbjct: 234 LEGCTAPMRDENQLHAAVVELVAHDDASIKYSTVQNWYPGDADGKGGIYNFVTKRGLCAG 293

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
            RSKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N  QQ D+GTKM+HL + T 
Sbjct: 294 KRSKISWTQVETGSAITWKYPSCVLKGDHSVGEFYSVALTNNRQQADTGTKMIHLGEGTR 353

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S I+SKGISAG    TYRG V + + A  +RN+TQCDSLLIG+ CGAHT+PY+E +N+S 
Sbjct: 354 STIISKGISAGRGQQTYRGLVRIGKKAKSARNYTQCDSLLIGDRCGAHTVPYVEVRNASA 413

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            LEHEATT++I ++ LFYC QRGI EE A+ LIVNGF +EV ++LPMEFAVEAQKL+ +S
Sbjct: 414 KLEHEATTTRIGEDQLFYCRQRGIAEEDAVNLIVNGFCKEVFKELPMEFAVEAQKLLAVS 473

Query: 484 LEGSVG 489
           LEG+VG
Sbjct: 474 LEGAVG 479


>gi|189502516|ref|YP_001958233.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Amoebophilus asiaticus 5a2]
 gi|189497957|gb|ACE06504.1| hypothetical protein Aasi_1170 [Candidatus Amoebophilus asiaticus
           5a2]
          Length = 481

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 324/486 (66%), Positives = 387/486 (79%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +      ++++    Y YGFE+NI V++APKGLNED I FISAKKNEP W+LEWRL AY 
Sbjct: 1   MSTEKQLLQQLTTADYPYGFESNIAVEQAPKGLNEDTIHFISAKKNEPQWLLEWRLKAYH 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WLT+K+P+W  + YP I++ D+ YYAAPK+     SLD+VDPEL  T ++LGI I EQ+
Sbjct: 61  HWLTLKEPTWPNVTYPPINYQDISYYAAPKNSKKLNSLDEVDPELKNTLDRLGISIEEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L G     VA+D VFDSVSV TTF+ +L + G+IF   +EA+  HP+LV+KYL TVVP 
Sbjct: 121 RLTG-----VAMDIVFDSVSVATTFQAKLHELGIIFCSFTEAVQNHPELVQKYLGTVVPP 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN++AALNSAVF+DGSF YIPKGV CPMELSTYFRIN   TGQFERTLIIA+EGSYVSY
Sbjct: 176 QDNYFAALNSAVFSDGSFCYIPKGVHCPMELSTYFRINAANTGQFERTLIIAEEGSYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVE+ A   AE+KYSTVQNWYPGD +GKGGI+NFVTKRG C G
Sbjct: 236 LEGCTAPMRDENQLHAAVVEIYAASRAEVKYSTVQNWYPGDKEGKGGIFNFVTKRGICAG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++   QQ D+GTKM+H+ KNT 
Sbjct: 296 ESSKISWTQVETGSAITWKYPSCILMGDNSIGEFYSVAVTKNKQQADTGTKMIHIGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N+YRG V + R A  +RNF+QCDSLL+GN CGAHT PYI+ KNS+ 
Sbjct: 356 SRIVSKGISAGQSQNSYRGLVKITRNATKARNFSQCDSLLLGNQCGAHTFPYIDVKNSTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI +E LFYC QRGI  E A+ALIVNG+ +EVL KLPMEFAVEAQKL++++
Sbjct: 416 QVEHEATTSKIGEEQLFYCNQRGIDNEQAVALIVNGYCKEVLNKLPMEFAVEAQKLLELT 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|332826941|gb|EGJ99738.1| hypothetical protein HMPREF9455_03870 [Dysgonomonas gadei ATCC
           BAA-286]
          Length = 485

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 326/487 (66%), Positives = 391/487 (80%), Gaps = 3/487 (0%)

Query: 4   VRETVDKV-RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           ++ET DK+   +    YKYGF T+I+ +  P GLNED++R ISAKKNEP+W+LE+RL AY
Sbjct: 1   MQETQDKILEDVTSGDYKYGFVTDIETEVIPVGLNEDVVRLISAKKNEPEWLLEFRLKAY 60

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WLTM  P WA ++ P ID+  + Y+AAPK   GP+SLD+VDPELL+T++KLG+P+ E+
Sbjct: 61  RHWLTMDMPDWAMLKIPPIDYQSISYFAAPKKKDGPKSLDEVDPELLKTFDKLGVPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           EILAGV    V       SVSV TTFKE L + G+IF   SEA+ EHP+LVKKYL +VVP
Sbjct: 121 EILAGVTGMAVDAVVD--SVSVKTTFKEVLAEKGIIFSSFSEAVQEHPELVKKYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+A LNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYVS
Sbjct: 179 YRDNFFATLNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDNSYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAA+VE+VALD+AE+KYSTVQNWYPGD +GKGGIYNFVTKRG C+
Sbjct: 239 YLEGCTAPMRDENQLHAAIVEIVALDHAEVKYSTVQNWYPGDKEGKGGIYNFVTKRGVCK 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSA+TWKYPSC+L G+ S GEFYS+A++N FQQ D+GTKM+H+ KNT
Sbjct: 299 GCGSKISWTQVETGSAVTWKYPSCILAGDDSIGEFYSVAVTNNFQQADTGTKMIHIGKNT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            SRIVSKGISAG S N+YRG V V   A  +RN +QCDSLL+G+ CGAHT PY +  N S
Sbjct: 359 RSRIVSKGISAGQSQNSYRGLVKVSPKAEGARNHSQCDSLLLGDKCGAHTFPYSDIANPS 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS++ + YC QRGI  E A+ LIVNG+ +EV+Q LPMEFAVEAQKL+ I
Sbjct: 419 AIIEHEATTSKISEDQILYCNQRGIGTEEAVGLIVNGYAKEVMQNLPMEFAVEAQKLLQI 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|317477852|ref|ZP_07937038.1| FeS assembly protein SufB [Bacteroides sp. 4_1_36]
 gi|316905988|gb|EFV27756.1| FeS assembly protein SufB [Bacteroides sp. 4_1_36]
          Length = 484

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 318/486 (65%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  D   +GLNED++R IS KK EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTDIIERGLNEDVVRLISEKKGEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VVP 
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVHEHPDLVQKYLGSVVPY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++G+GG+YNFVTKRG C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGRGGVYNFVTKRGHCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N  QQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNHQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGKSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 IVEHEATTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|163746293|ref|ZP_02153651.1| component of SufBCD complex [Oceanibulbus indolifex HEL-45]
 gi|161380178|gb|EDQ04589.1| component of SufBCD complex [Oceanibulbus indolifex HEL-45]
          Length = 510

 Score =  555 bits (1431), Expect = e-156,   Method: Composition-based stats.
 Identities = 348/494 (70%), Positives = 409/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++   +YKYG+ T+I++D AP GLN DI+R IS K  EP+WM EWRL AY R
Sbjct: 18  QETVDAVREVG-GKYKYGWSTDIEMDYAPMGLNPDIVRLISEKNEEPEWMTEWRLAAYDR 76

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT K+P WA + YP IDF   YYYA PKS+   P+SLDDVDP+LL TY+KLGIP++EQ 
Sbjct: 77  WLTKKEPDWAMVDYPEIDFQKQYYYARPKSMATKPKSLDDVDPKLLDTYKKLGIPLKEQM 136

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+EELKK+GVIF  ISEAI EHP+LV++
Sbjct: 137 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQEELKKAGVIFCSISEAIREHPELVRR 196

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 197 YLGSVVPVNDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 256

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRDE+QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 257 DKGSYVSYLEGCTAPQRDESQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 316

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 317 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 376

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 377 IHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKESRNYTQCDSLLIGSECGAHTVPY 436

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ +FYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 437 IEVKNNSSRVEHEATTSKVDDDQMFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 496

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 497 AQALVAISLEGSVG 510


>gi|149914907|ref|ZP_01903436.1| FeS assembly protein SufB [Roseobacter sp. AzwK-3b]
 gi|149811095|gb|EDM70932.1| FeS assembly protein SufB [Roseobacter sp. AzwK-3b]
          Length = 507

 Score =  555 bits (1430), Expect = e-156,   Method: Composition-based stats.
 Identities = 346/494 (70%), Positives = 414/494 (83%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YK+G+ T+I++D APKGL EDI++ IS K  EP+WM EWRL AY R
Sbjct: 15  KETVDAVREM-AGTYKHGWNTDIEMDYAPKGLTEDIVKLISEKNGEPEWMTEWRLQAYER 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL MK+P WA + YP +DF + YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WLQMKEPEWAMLDYPEVDFQNQYYYARPKSMAVKPKSLDEVDPKLLETYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAG++          KVAVDAVFDSVSV TTF++EL+K+GVIF  ISEAI +HP+L+KK
Sbjct: 134 ILAGIEGAEDAPAEGRKVAVDAVFDSVSVGTTFQKELEKAGVIFCSISEAIEKHPELIKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRDE+QLHAAVVE+V  ++AE+KYSTVQNW+PG+  G GGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPQRDESQLHAAVVEIVVEEDAEVKYSTVQNWFPGNEDGTGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N FQQ D+GTKM
Sbjct: 314 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAITNNFQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 IHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKATNSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF R+VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCRDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|126728566|ref|ZP_01744381.1| FeS assembly protein SufB [Sagittula stellata E-37]
 gi|126710496|gb|EBA09547.1| FeS assembly protein SufB [Sagittula stellata E-37]
          Length = 510

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 344/498 (69%), Positives = 408/498 (81%), Gaps = 15/498 (3%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD VR  DV  YK+G+ T+I+++ APKGL+ DI+R IS K  EP+WM +WRL AY R
Sbjct: 15  QQTVDAVR--DVSTYKHGWNTDIEMEYAPKGLSPDIVRLISEKNEEPEWMTDWRLQAYER 72

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL   +P+WA + YP IDF + YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 73  WLQKTEPTWAMVDYPEIDFQEQYYYARPKSMTEKPKSLDEVDPKLLETYEKLGIPLKEQM 132

Query: 124 ILAGVQT------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           ILAGV+              +VAVDAVFDSVSV TTF++ELK +GVIF  ISEAI EHP+
Sbjct: 133 ILAGVEGAGDAPAEAKEGERRVAVDAVFDSVSVGTTFQKELKAAGVIFCSISEAIREHPE 192

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           LVKKYL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERT
Sbjct: 193 LVKKYLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERT 252

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LIIAD+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNW+PGD  GKGGI
Sbjct: 253 LIIADKGSYVSYLEGCTAPQRDTAQLHAAVVEIIVEEDAEVKYSTVQNWFPGDENGKGGI 312

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+
Sbjct: 313 YNFVTKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNHQQADT 372

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL ++T SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG  CGAH
Sbjct: 373 GTKMIHLGRDTKSRIVSKGISAGVAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGGKCGAH 432

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T+PYIE KN+S   EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF REVLQ LPME
Sbjct: 433 TVPYIEVKNNSSRCEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCREVLQALPME 492

Query: 472 FAVEAQKLIDISLEGSVG 489
           FA+EAQ+L+ ISLEGSVG
Sbjct: 493 FAMEAQQLVAISLEGSVG 510


>gi|115372525|ref|ZP_01459833.1| FeS assembly protein SufB [Stigmatella aurantiaca DW4/3-1]
 gi|310819042|ref|YP_003951400.1| FeS assembly protein SufB [Stigmatella aurantiaca DW4/3-1]
 gi|115370487|gb|EAU69414.1| FeS assembly protein SufB [Stigmatella aurantiaca DW4/3-1]
 gi|309392114|gb|ADO69573.1| FeS assembly protein SufB [Stigmatella aurantiaca DW4/3-1]
          Length = 478

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 318/481 (66%), Positives = 388/481 (80%), Gaps = 6/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + ++++    Y+ GF T ++ D  P GLNE++IR ISAKK EP+++LEWRL AYR WLT+
Sbjct: 4   ETLQELTRRPYEAGFVTAVEADTLPPGLNEEVIRLISAKKGEPEFLLEWRLKAYRHWLTL 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K+PSW  +RY  ID+  + YY+AP+      SLD VDPE+LRTY KLGIP+ EQ++L   
Sbjct: 64  KEPSWQSVRYHPIDYQAIRYYSAPRQKPKLDSLDQVDPEILRTYAKLGIPLEEQKMLQ-- 121

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVSV TTFK++L K+GVIF   SEA+ EHP+L+++YL TVVP  DN++
Sbjct: 122 ---NVAVDAVFDSVSVATTFKDKLAKAGVIFCSFSEAVREHPELIRRYLGTVVPYSDNYF 178

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSF Y+PKGVRCPMELSTYFRIN   TGQFERTLI+ADEGS VSYLEGCT
Sbjct: 179 AALNSAVFSDGSFCYVPKGVRCPMELSTYFRINAAETGQFERTLIVADEGSTVSYLEGCT 238

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RD NQLHAAVVELVALD A IKYSTVQNWYPGD++G+GGIYNFVTKRG     RSKI
Sbjct: 239 APMRDTNQLHAAVVELVALDGASIKYSTVQNWYPGDAEGRGGIYNFVTKRGIAH-RRSKI 297

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPS +LRG+ + GEFYS+A++N  QQ D+GTKM+H+ +NT S IVS
Sbjct: 298 SWTQVETGSAITWKYPSVILRGDDAVGEFYSVALTNHRQQADTGTKMVHIGRNTRSTIVS 357

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG   NTYRG V V + A  +RN+TQCDSLL+G+ CGAHT+PYIE KN+S  +EHE
Sbjct: 358 KGISAGHGQNTYRGLVRVLKNAEGARNYTQCDSLLLGSQCGAHTLPYIEVKNASAQVEHE 417

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LFYC QRGI  E A+++IVNGF R+V ++LPMEFAVEAQKL+ +SLEGSV
Sbjct: 418 ASTSKIGEDQLFYCQQRGISREDAVSMIVNGFCRQVFKELPMEFAVEAQKLLGLSLEGSV 477

Query: 489 G 489
           G
Sbjct: 478 G 478


>gi|163731799|ref|ZP_02139246.1| component of SufBCD complex [Roseobacter litoralis Och 149]
 gi|161395253|gb|EDQ19575.1| component of SufBCD complex [Roseobacter litoralis Och 149]
          Length = 512

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 341/494 (69%), Positives = 407/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD VR++   +YK+G+ T+I+++ APKGL+ DI+R IS K  EP+WMLEWRL AY R
Sbjct: 20  QDTVDAVREVG-GKYKHGWSTDIEMEYAPKGLSPDIVRLISEKNEEPEWMLEWRLAAYDR 78

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL   +P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 79  WLQKTEPKWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLETYKKLGIPLKEQM 138

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVS+ TTF++EL K+GVIF  ISEAI +HP+LVKK
Sbjct: 139 ILAGVEGAEELGDEPRKVAVDAVFDSVSLGTTFRDELMKAGVIFCSISEAIKDHPELVKK 198

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DN+YA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 199 YLGSVVPVSDNYYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 258

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  G GGIYNFV
Sbjct: 259 DKGSYVSYLEGCTAPQRDIAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGVGGIYNFV 318

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 319 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 378

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG NCGAHT+PY
Sbjct: 379 IHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKESRNYTQCDSLLIGGNCGAHTVPY 438

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 439 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 498

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 499 AQQLVAISLEGSVG 512


>gi|82701829|ref|YP_411395.1| cysteine desulfurase activator complex subunit SufB [Nitrosospira
           multiformis ATCC 25196]
 gi|82409894|gb|ABB74003.1| Iron-regulated ABC transporter membrane component SufB
           [Nitrosospira multiformis ATCC 25196]
          Length = 478

 Score =  555 bits (1429), Expect = e-156,   Method: Composition-based stats.
 Identities = 313/489 (64%), Positives = 392/489 (80%), Gaps = 11/489 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV      ++ +    YK+GF T I+ D APKGLNEDIIR IS KKNEP W+L++RL 
Sbjct: 1   MSAV------LQNLVNQPYKHGFVTEIESDVAPKGLNEDIIRLISTKKNEPAWLLDFRLK 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY++WL M++P W  ++YP IDF  + YYAAPK      S+D+VDPELLRT+EKLG+P+ 
Sbjct: 55  AYQQWLKMEEPKWPNVKYPRIDFQAISYYAAPKPKKKLSSMDEVDPELLRTFEKLGVPMH 114

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG     VAVD +FDSVSV TT+K++L + G+IF  ISEA+  +P+LVK+YL TV
Sbjct: 115 ERAALAG-----VAVDVIFDSVSVATTYKQKLAEVGIIFCSISEAVHAYPELVKQYLGTV 169

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPVGDN+YAALNSAVFTDG+F +IPKGV+CPM+LSTYFRIN + +GQFERTLI+A+EGS 
Sbjct: 170 VPVGDNYYAALNSAVFTDGTFCFIPKGVKCPMDLSTYFRINTEESGQFERTLIVAEEGSS 229

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+ D NQLHAAVVEL+ALDNA+IKYSTVQNWY GD +G GGIYNFVTKRG 
Sbjct: 230 VSYLEGCTAPRFDTNQLHAAVVELIALDNADIKYSTVQNWYAGDEKGVGGIYNFVTKRGL 289

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
            +G  S+ISWTQ+ETGSAITWKYPSC+L+GE S GEFYS+A++N +QQ D+GTKM+H+ K
Sbjct: 290 AKGANSRISWTQVETGSAITWKYPSCILQGENSVGEFYSVAVTNNYQQADTGTKMIHIGK 349

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S IVSKGISAG SNN+YRG V +   A+ +RN++QCDS+LIG+ CGAHT PYI+ +N
Sbjct: 350 NTRSTIVSKGISAGHSNNSYRGLVRIAPTASGARNYSQCDSMLIGDQCGAHTFPYIQVRN 409

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEA+TSKI ++ LFY  QRGI  E A+++I+NGF ++V Q+LPMEFAVEA KL+
Sbjct: 410 QNAKVEHEASTSKIGEDQLFYFAQRGIGNEEAVSMIINGFCKDVFQQLPMEFAVEATKLL 469

Query: 481 DISLEGSVG 489
              LEGSVG
Sbjct: 470 GFKLEGSVG 478


>gi|126737792|ref|ZP_01753522.1| FeS assembly protein SufB [Roseobacter sp. SK209-2-6]
 gi|126721185|gb|EBA17889.1| FeS assembly protein SufB [Roseobacter sp. SK209-2-6]
          Length = 506

 Score =  554 bits (1428), Expect = e-156,   Method: Composition-based stats.
 Identities = 348/494 (70%), Positives = 408/494 (82%), Gaps = 11/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD V ++    YKYG+ET+I+++ APKGL  DI++ IS K  EP+WML WRL AY R
Sbjct: 15  QETVDAVAEV--GTYKYGWETDIEMEYAPKGLTTDIVKLISEKNEEPEWMLNWRLEAYER 72

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL  ++P+WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 73  WLQKEEPTWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLETYKKLGIPLKEQM 132

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 133 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIKEHPELVKK 192

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TVVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 193 YLGTVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 252

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 253 DKGSYVSYLEGCTAPARDIAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDEDGKGGIYNFV 312

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+KI WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM
Sbjct: 313 TKRADCRGDRAKIMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKM 372

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 373 VHLGKNTKSRIVSKGISAGKAQNTYRGLVSMHPKAKESRNYTQCDSLLIGDKCGAHTVPY 432

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 433 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKDVLQALPMEFAME 492

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 493 AQQLVAISLEGSVG 506


>gi|89054855|ref|YP_510306.1| cysteine desulfurase activator complex subunit SufB [Jannaschia sp.
           CCS1]
 gi|88864404|gb|ABD55281.1| Iron-regulated ABC transporter membrane component SufB [Jannaschia
           sp. CCS1]
          Length = 508

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 350/494 (70%), Positives = 406/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD V+ +    YKYG+ T I++D AP G+NEDI+R IS K  EP+WML+WRL A++R
Sbjct: 16  QETVDAVKGLG-GAYKYGWNTEIEMDYAPMGVNEDIVRLISEKNEEPEWMLDWRLQAFKR 74

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W  MK+P WA + YPAID+   YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 75  WQKMKEPEWAMVDYPAIDYQSQYYYARPKSMETKPKSLDEVDPKLLETYKKLGIPLKEQM 134

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHPDLVKK
Sbjct: 135 ILAGVEGAEDMPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIKEHPDLVKK 194

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVP+ DNF+A LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 195 YLGSVVPITDNFFATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFERTLIIA 254

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D  SYVSYLEGCTAP RD +QLHAAVVELV LD+AEIKYSTVQNWYPGD  GKGGIYNFV
Sbjct: 255 DRESYVSYLEGCTAPMRDTHQLHAAVVELVLLDDAEIKYSTVQNWYPGDENGKGGIYNFV 314

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 315 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 374

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 375 MHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 434

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ +FYC  RG+ EE A+ALIVNGF +EVLQ LPMEFA+E
Sbjct: 435 IEVKNNSSRVEHEATTSKVDDDQMFYCQSRGMDEEEAVALIVNGFAKEVLQALPMEFAME 494

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 495 AQQLVAISLEGSVG 508


>gi|119386671|ref|YP_917726.1| cysteine desulfurase activator complex subunit SufB [Paracoccus
           denitrificans PD1222]
 gi|119377266|gb|ABL72030.1| Iron-regulated ABC transporter membrane component SufB [Paracoccus
           denitrificans PD1222]
          Length = 508

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 347/494 (70%), Positives = 411/494 (83%), Gaps = 11/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RETV+ V+ +    YKYG++T I+++ AP+G+NEDI+R IS K  EP+WM EWRL A+RR
Sbjct: 17  RETVETVQNM--GSYKYGWDTEIEMEYAPRGINEDIVRLISKKNEEPEWMTEWRLQAFRR 74

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           W TM +P WA + YP ID+ D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 75  WQTMTEPKWAMLNYPEIDYQDQYYYARPKSMQVKPKSLDEVDPKLLATYEKLGIPLKEQM 134

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAG++          KVAVDAVFDSVSV TTFK+EL K+GVIF  ISEAI EHP+LVKK
Sbjct: 135 ILAGIEGAEGAPAEGRKVAVDAVFDSVSVGTTFKDELAKAGVIFCSISEAIREHPELVKK 194

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVP  DNF+A LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 195 YLGSVVPQSDNFFATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 254

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP+RD  QLHAAVVE+V L++AE+KYSTVQNW+PGD +GKGGIYNFV
Sbjct: 255 DKGSYVSYLEGCTAPKRDVAQLHAAVVEIVVLEDAEVKYSTVQNWFPGDEEGKGGIYNFV 314

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCR  R+K+ WTQ+ETGSAITWKYPSC+LRG++S GEFYSIAI+N  QQ D+GTKM
Sbjct: 315 TKRADCREARAKVMWTQVETGSAITWKYPSCILRGDESQGEFYSIAIANNHQQADTGTKM 374

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 375 IHLGKNTRSRIVSKGISAGQAQNTYRGLVSMHPRAKNSRNYTQCDSLLIGDKCGAHTVPY 434

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF REVLQ LPMEFA+E
Sbjct: 435 IEVKNTSSCVEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCREVLQALPMEFAME 494

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 495 AQSLVAISLEGSVG 508


>gi|114331237|ref|YP_747459.1| cysteine desulfurase activator complex subunit SufB [Nitrosomonas
           eutropha C91]
 gi|114308251|gb|ABI59494.1| Iron-regulated ABC transporter membrane component SufB
           [Nitrosomonas eutropha C91]
          Length = 478

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 310/480 (64%), Positives = 389/480 (81%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            ++ +    YK+GF TNI+ D APKGLNEDIIR IS+KKNEP+W+L +RL AYRRWL M 
Sbjct: 4   ALQNLVNQPYKHGFVTNIESDIAPKGLNEDIIRLISSKKNEPEWLLTFRLEAYRRWLNMI 63

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           +P+W  ++YP I+F ++ YY+APK      S+D+VDPELLRT+EKLGIP+ E+  LAG  
Sbjct: 64  EPTWQNVKYPKINFQNISYYSAPKPKKKLASMDEVDPELLRTFEKLGIPMHERAALAG-- 121

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVD +FDSVSV TT+KE+L + G+IF  ISEA+  +P+L+++YL TVVP GDN+YA
Sbjct: 122 ---VAVDVIFDSVSVATTYKEKLAEVGIIFCSISEAVQRYPELIRQYLGTVVPPGDNYYA 178

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVFTDGSF +IPKGV+CPM+LSTYFRIN + +GQFERTLIIA+EG+ VSYLEGCTA
Sbjct: 179 ALNSAVFTDGSFCFIPKGVKCPMDLSTYFRINTEESGQFERTLIIAEEGASVSYLEGCTA 238

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P+ D NQLHAAVVEL+ALD+A+IKYSTVQNWY GD  G GGIYNFVTKRG  +G  S+IS
Sbjct: 239 PRFDTNQLHAAVVELIALDDADIKYSTVQNWYAGDENGVGGIYNFVTKRGLAKGRNSRIS 298

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+LRGE S GEFYS+A++N  QQ D+GTKM+H+  NT S IVSK
Sbjct: 299 WTQVETGSAITWKYPSCILRGENSVGEFYSVAVTNHHQQADTGTKMIHIGPNTRSTIVSK 358

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG SN++YRG V +   A ++RN++QCDS+LIG+ CGAHT PYI+ +N+S  +EHEA
Sbjct: 359 GISAGQSNSSYRGLVRITPTARNARNYSQCDSMLIGSQCGAHTFPYIQVQNNSAQVEHEA 418

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ LFY  QRGI  E A+++I+NGF +EV Q+LP+EFAVEA KL+   LEGSVG
Sbjct: 419 STSKIGEDQLFYFAQRGIDAEEAVSMIINGFCKEVFQQLPLEFAVEATKLLSFKLEGSVG 478


>gi|56551319|ref|YP_162158.1| cysteine desulfurase activator complex subunit SufB [Zymomonas
           mobilis subsp. mobilis ZM4]
 gi|260753061|ref|YP_003225954.1| cysteine desulfurase activator complex subunit SufB [Zymomonas
           mobilis subsp. mobilis NCIMB 11163]
 gi|56542893|gb|AAV89047.1| FeS assembly protein SufB [Zymomonas mobilis subsp. mobilis ZM4]
 gi|258552424|gb|ACV75370.1| FeS assembly protein SufB [Zymomonas mobilis subsp. mobilis NCIMB
           11163]
          Length = 490

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 331/490 (67%), Positives = 405/490 (82%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +           D+Y++GF + +  + APKGLNEDI+RFISAKK EP+WMLEWRL 
Sbjct: 1   MSETKNEAALEALARNDRYEWGFSSAVDQEFAPKGLNEDIVRFISAKKGEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWL M+ P WA+++ P ID+ D YYYAAPK+    +SLD++DPE+ +TYEKLGIPI 
Sbjct: 61  AYKRWLEMEMPHWAKLKLPEIDYQDAYYYAAPKAKPKIESLDEIDPEIRKTYEKLGIPIE 120

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ++LAGV    +VAVDAVFDSVSV TTF+E+L++ GVIF+ ISEAI  +P+LVK+YL  
Sbjct: 121 EQKVLAGVSGAREVAVDAVFDSVSVATTFREKLQEVGVIFLSISEAIKTYPELVKRYLGR 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+++ALNSAVF+DG+FVYIP+GVRCPMELSTYFRIN   TGQFERTLI+AD+G+
Sbjct: 181 VVPVRDNYFSALNSAVFSDGTFVYIPEGVRCPMELSTYFRINAANTGQFERTLIVADKGA 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVE+   + AE++YSTVQNWYPGD  GKGGIYNFVTKR 
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVEIFVHEEAEVRYSTVQNWYPGDENGKGGIYNFVTKRA 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C G RSK+SWTQ+ETGSAITWKYPSC+L+GE+S GEFYS+A++N +QQ D+GTKM+H+ 
Sbjct: 301 LCDGARSKVSWTQVETGSAITWKYPSCILKGEESVGEFYSVALTNNYQQADTGTKMIHIG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KN+ S I+SKGISAG S+NTYRG V V   A + RNFT+CDSLLIG+ CGAHT+PYIE +
Sbjct: 361 KNSRSTIISKGISAGHSDNTYRGLVKVGGAAENVRNFTRCDSLLIGDKCGAHTVPYIEVR 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  +EHEATTSKISD+ LFY  QRG+ E+ A+ALIVNGF R+VLQKLPMEFA+EAQKL
Sbjct: 421 NPSAKVEHEATTSKISDDELFYARQRGLNEDEAVALIVNGFARDVLQKLPMEFAIEAQKL 480

Query: 480 IDISLEGSVG 489
           + ISLEG+VG
Sbjct: 481 LGISLEGAVG 490


>gi|255010116|ref|ZP_05282242.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           fragilis 3_1_12]
          Length = 485

 Score =  554 bits (1428), Expect = e-155,   Method: Composition-based stats.
 Identities = 324/490 (66%), Positives = 395/490 (80%), Gaps = 6/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M+   E    V+++  ++YKYGF T +  D   KGLNED++R IS+KKNEPDW+LE+RL 
Sbjct: 1   MMQQEEPNKYVKELTQEKYKYGFTTEVHTDIIEKGLNEDVVRLISSKKNEPDWLLEFRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPI 119
           AYR WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+
Sbjct: 61  AYRHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPL 120

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKYL +
Sbjct: 121 EEQMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYLGS 175

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VV   DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ S
Sbjct: 176 VVGYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDS 235

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG
Sbjct: 236 YVSYLEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRG 295

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           +C+G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL 
Sbjct: 296 NCKGVDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLG 355

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  
Sbjct: 356 KNTRSTIVSKGISAGKSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIH 415

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEATTSKIS++ +FYC QRGI  E AI LIVNG+ +EVL KLPMEFAVEAQKL
Sbjct: 416 NETAVVEHEATTSKISEDQIFYCNQRGISTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKL 475

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 476 LTISLEGSVG 485


>gi|119509158|ref|ZP_01628309.1| hypothetical protein N9414_05135 [Nodularia spumigena CCY9414]
 gi|119466324|gb|EAW47210.1| hypothetical protein N9414_05135 [Nodularia spumigena CCY9414]
          Length = 479

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 312/490 (63%), Positives = 389/490 (79%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    +T      +    YKYGF T+I+ D  P+GLNED++R ISAKKNEP +ML++RL 
Sbjct: 1   MSVTAKT------LVNQPYKYGFITDIEADTIPRGLNEDVVRLISAKKNEPQFMLDFRLR 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
            YR+WL M +P+W  ++YPAID+ ++ YY+APK       SLD+VDP LL T+EKLGI +
Sbjct: 55  CYRQWLKMTEPTWPSVKYPAIDYQNIIYYSAPKKKKAKLNSLDEVDPTLLETFEKLGISL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ LA      VAVDA+FDSVSV TTFK++L + GVIF  ISEA+ EHP+LV+KYL +
Sbjct: 115 SEQKRLA-----NVAVDAIFDSVSVATTFKDKLAEDGVIFCSISEALQEHPELVRKYLGS 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++AALN AVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+EGS
Sbjct: 170 VVPAADNYFAALNGAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEEGS 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP  D NQLHAAVVELVALDNAEIKYSTVQNWY GD +GKGGIYNFVTKRG
Sbjct: 230 YVSYLEGCTAPMYDTNQLHAAVVELVALDNAEIKYSTVQNWYAGDEKGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ 
Sbjct: 290 LCQGVNSKISWTQVETGSAITWKYPSCVLLGDNSVGEFYSVALTNNMQQADTGTKMIHVG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S+N+YRG V V+  A  +RN++QCDS+LIG+N  A+T PYI+ +
Sbjct: 350 KNTRSTIISKGISAGNSSNSYRGLVKVNPTAKGARNYSQCDSMLIGDNAHANTFPYIQVQ 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGI  E AI+++++GF ++V  +LPMEFAVEA KL
Sbjct: 410 NNASKVEHEASTSKIGEDQLFYFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKL 469

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 470 LSMKLEGSVG 479


>gi|291514464|emb|CBK63674.1| Iron-regulated ABC transporter membrane component SufB [Alistipes
           shahii WAL 8301]
          Length = 481

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 321/489 (65%), Positives = 390/489 (79%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M       + +  I   +YKYGF T+I+ +   KGL+E+++R ISAKK EP+WM E R+ 
Sbjct: 1   MA--ENEKNILENIGEQEYKYGFTTDIETETIGKGLSEEVVRLISAKKGEPEWMTERRVA 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WLT++ P+WA +  P IDF D+ YYAAPK      S+D+VDPEL RT++KLGIP+ 
Sbjct: 59  AYRHWLTLEPPTWAHLTIPPIDFQDIIYYAAPKPKKQLGSMDEVDPELKRTFDKLGIPLE 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ  LAG     VAVDAV DSVSV TTF+E L + G++F  ISEA+ + P+LVKKYL +V
Sbjct: 119 EQMALAG-----VAVDAVMDSVSVKTTFREVLAEKGILFCSISEALRDFPELVKKYLGSV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALN+AVF+DGSF YIPKGVRCPMELSTYFRIN  GTGQFERTLI+ADEG+Y
Sbjct: 174 VPYTDNFYAALNAAVFSDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTLIVADEGAY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVE+V   +AE+KYSTVQNWYPGD QG+GGIYNFVTKRG 
Sbjct: 234 VSYLEGCTAPQRDENQLHAAVVEIVVERDAEVKYSTVQNWYPGDKQGRGGIYNFVTKRGI 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CR   +++SWTQ+ETGSAITWKYPSC+L G+ + GEFYS+A++N FQQ D+GTKM+H+ +
Sbjct: 294 CR-ENARLSWTQVETGSAITWKYPSCILAGDNAVGEFYSVAMTNNFQQADTGTKMIHIGR 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRIVSKGISAG S N+YRG V V +GA ++RN++QCDSLLIG+ CGAHT P I+ +N
Sbjct: 353 NTRSRIVSKGISAGRSENSYRGMVRVAKGAENARNYSQCDSLLIGDKCGAHTFPVIDVRN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKISD+ LFYC QRG+  E A+ LIVNG+ REVL KLPMEFAVEAQKL+
Sbjct: 413 PTGVVEHEATTSKISDDQLFYCNQRGLSTEDAVGLIVNGYAREVLAKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
            + LEGSVG
Sbjct: 473 ALQLEGSVG 481


>gi|241760973|ref|ZP_04759062.1| FeS assembly protein SufB [Zymomonas mobilis subsp. mobilis ATCC
           10988]
 gi|241374592|gb|EER64053.1| FeS assembly protein SufB [Zymomonas mobilis subsp. mobilis ATCC
           10988]
          Length = 490

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 332/490 (67%), Positives = 405/490 (82%), Gaps = 1/490 (0%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +           D+Y++GF + +  + APKGLNEDI+RFISAKK EP+WMLEWRL 
Sbjct: 1   MSETKNEAALEALARNDRYEWGFSSAVDQEFAPKGLNEDIVRFISAKKGEPEWMLEWRLE 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+RWL M+ P WA+++ P ID+ D YYYAAPK+    +SLD++DPE+ +TYEKLGIPI 
Sbjct: 61  AYKRWLEMEMPHWAKLKLPEIDYQDAYYYAAPKAKPKIESLDEIDPEIRKTYEKLGIPIE 120

Query: 121 EQEILAGVQT-SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           EQ++LAGV    +VAVDAVFDSVSV TTF+E+L++ GVIF+ ISEAI  +P+LVK+YL  
Sbjct: 121 EQKVLAGVSGAREVAVDAVFDSVSVATTFREKLQEVGVIFLSISEAIKTYPELVKRYLGR 180

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DN+++ALNSAVF+DG+FVYIP+GVRCPMELSTYFRIN   TGQFERTLI+AD+G+
Sbjct: 181 VVPVRDNYFSALNSAVFSDGTFVYIPEGVRCPMELSTYFRINAANTGQFERTLIVADKGA 240

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAPQRDENQLHAAVVE+   + AE++YSTVQNWYPGD  GKGGIYNFVTKR 
Sbjct: 241 YVSYLEGCTAPQRDENQLHAAVVEIFVHEEAEVRYSTVQNWYPGDENGKGGIYNFVTKRA 300

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C G RSK+SWTQ+ETGSAITWKYPSC+L+GE+S GEFYSIA++N +QQ D+GTKM+H+ 
Sbjct: 301 LCDGARSKVSWTQVETGSAITWKYPSCILKGEESVGEFYSIALTNNYQQADTGTKMIHIG 360

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KN+ S I+SKGISAG S+NTYRG V V   A + RNFT+CDSLLIG+ CGAHT+PYIE +
Sbjct: 361 KNSRSTIISKGISAGHSDNTYRGLVKVGGAAENVRNFTRCDSLLIGDKCGAHTVPYIEVR 420

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  +EHEATTSKISD+ LFY  QRG+ E+ A+ALIVNGF R+VLQKLPMEFA+EAQKL
Sbjct: 421 NPSAKVEHEATTSKISDDELFYARQRGLNEDEAVALIVNGFARDVLQKLPMEFAIEAQKL 480

Query: 480 IDISLEGSVG 489
           + ISLEG+VG
Sbjct: 481 LGISLEGAVG 490


>gi|53711556|ref|YP_097548.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           fragilis YCH46]
 gi|60679815|ref|YP_209959.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           fragilis NCTC 9343]
 gi|253564383|ref|ZP_04841840.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 3_2_5]
 gi|265764948|ref|ZP_06093223.1| FeS assembly protein SufB [Bacteroides sp. 2_1_16]
 gi|52214421|dbj|BAD47014.1| ABC transporter permease [Bacteroides fragilis YCH46]
 gi|60491249|emb|CAH05997.1| putative ABC transporter membrane protein [Bacteroides fragilis
           NCTC 9343]
 gi|251948159|gb|EES88441.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 3_2_5]
 gi|263254332|gb|EEZ25766.1| FeS assembly protein SufB [Bacteroides sp. 2_1_16]
 gi|301161338|emb|CBW20878.1| putative ABC transporter SufB protein [Bacteroides fragilis 638R]
          Length = 485

 Score =  554 bits (1427), Expect = e-155,   Method: Composition-based stats.
 Identities = 322/490 (65%), Positives = 395/490 (80%), Gaps = 6/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M+   E    V+++  ++YKYGF T +  D   KGLNED++R IS+KKNEP+W+LE+RL 
Sbjct: 1   MMQQEEPNKYVKELTQEKYKYGFTTEVHTDIIEKGLNEDVVRLISSKKNEPEWLLEFRLK 60

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPI 119
           AYR WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+
Sbjct: 61  AYRHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPL 120

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKYL +
Sbjct: 121 EEQMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYLGS 175

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VV   DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ S
Sbjct: 176 VVGYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDS 235

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG
Sbjct: 236 YVSYLEGCTAPMRDENQLHAAIVEIMVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRG 295

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           +C+G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL 
Sbjct: 296 NCKGVDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLG 355

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  
Sbjct: 356 KNTRSTIVSKGISAGKSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIH 415

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEATTSKIS++ +FYC QRGI  E AI LIVNG+ +EVL KLPMEFAVEAQKL
Sbjct: 416 NETAVVEHEATTSKISEDQIFYCNQRGISTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKL 475

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 476 LTISLEGSVG 485


>gi|224025204|ref|ZP_03643570.1| hypothetical protein BACCOPRO_01938 [Bacteroides coprophilus DSM
           18228]
 gi|224018440|gb|EEF76438.1| hypothetical protein BACCOPRO_01938 [Bacteroides coprophilus DSM
           18228]
          Length = 483

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 324/486 (66%), Positives = 394/486 (81%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +E    V+++  ++YKYGF T++  D   KGLNED++R ISAKK EP+W+LE+RL AYR 
Sbjct: 3   QEPNKYVKELTQEKYKYGFTTDVHTDIIEKGLNEDVVRLISAKKGEPEWLLEFRLKAYRH 62

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLTM+ P+WA +  P ID+  + YYA P     GP+SLD+VDPELL+T+ KLGIP+ EQ 
Sbjct: 63  WLTMEMPTWAHLNIPEIDYQAISYYADPTQKKEGPKSLDEVDPELLKTFNKLGIPLEEQM 122

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF  +SEA+ EHPDLV+KYL +VV  
Sbjct: 123 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSMSEAVREHPDLVRKYLGSVVGY 177

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYVSY
Sbjct: 178 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDSYVSY 237

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V LD AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+G
Sbjct: 238 LEGCTAPMRDENQLHAAIVEIVVLDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCKG 297

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N FQQ D+GTKM+HL KNT 
Sbjct: 298 VDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNFQQADTGTKMIHLGKNTR 357

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 358 STIVSKGISAGKSQNSYRGLVRVSERADNARNYSQCDSLLLGSQCGAHTFPYMDIHNETA 417

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ LFYC QRGI  E AI LIVNG+ +EVL KLPMEFAVEAQKL+ +S
Sbjct: 418 IVEHEATTSKISEDQLFYCNQRGINTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLSVS 477

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 478 LEGSVG 483


>gi|254436785|ref|ZP_05050279.1| FeS assembly protein SufB [Octadecabacter antarcticus 307]
 gi|198252231|gb|EDY76545.1| FeS assembly protein SufB [Octadecabacter antarcticus 307]
          Length = 520

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 341/494 (69%), Positives = 404/494 (81%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD V+ +    YK+G+ T+I+++ AP GL+EDI+R IS K  EP WML+WRL AY R
Sbjct: 28  QDTVDAVQAL-SGTYKHGWNTDIEMEYAPLGLSEDIVRLISEKNEEPQWMLDWRLAAYAR 86

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLTM++P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 87  WLTMQEPDWAMVDYPKIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 146

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVS+ TTFK+EL K+GVIF  ISEAI +HP+LV+K
Sbjct: 147 ILAGVEGAEDLTDAPRKVAVDAVFDSVSLGTTFKDELAKAGVIFCSISEAIKDHPELVRK 206

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TV+P  DN+YA LN+AVF+DGSFVYIPKG +CPMELSTYFRIN + TGQFERTLIIA
Sbjct: 207 YLGTVIPATDNYYACLNAAVFSDGSFVYIPKGTKCPMELSTYFRINAENTGQFERTLIIA 266

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DEGS VSYLEGCTAP+RD  QLHAA VEL+ +D+AEIKYSTVQNW+PGD  G GGIYNFV
Sbjct: 267 DEGSSVSYLEGCTAPKRDIAQLHAACVELILMDDAEIKYSTVQNWFPGDENGVGGIYNFV 326

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 327 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 386

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 387 VHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKESRNYTQCDSLLIGDKCGAHTVPY 446

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF +EVLQ LPMEFA+E
Sbjct: 447 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKEVLQALPMEFAME 506

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 507 AQALVAISLEGSVG 520


>gi|209527510|ref|ZP_03276013.1| FeS assembly protein SufB [Arthrospira maxima CS-328]
 gi|209492059|gb|EDZ92411.1| FeS assembly protein SufB [Arthrospira maxima CS-328]
          Length = 478

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 302/479 (63%), Positives = 382/479 (79%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +    YKYGF T+I+ D  PKGL+ED++R ISAKKNEP++ML +RL AY++W  M +
Sbjct: 5   VKTLVNQPYKYGFVTDIESDTIPKGLSEDVVRLISAKKNEPEFMLNFRLRAYQQWQKMAE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P+W  + YP ID+ D+ YY+APK      SL++VDP L+ T+EKLGIP+ EQ+ LA    
Sbjct: 65  PTWPHVHYPPIDYQDIIYYSAPKVEKKKGSLEEVDPTLIETFEKLGIPLSEQKRLA---- 120

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVS+ TTFKE+L + GVIF  ISEA+  HP+L++KYL +VVPVGDN++AA
Sbjct: 121 -NVAVDAVFDSVSIATTFKEKLAEEGVIFCSISEAVESHPELIEKYLGSVVPVGDNYFAA 179

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV+CPM+LSTYFRIN   +GQFERTLI+A+ GS V+YLEGCTAP
Sbjct: 180 LNSAVFSDGSFVYIPKGVKCPMDLSTYFRINNGESGQFERTLIVAESGSSVTYLEGCTAP 239

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D NQLHAAVVELVALDNA I+YSTVQNW+ GD  GKGGIYNFVTKRG C+G+ SKISW
Sbjct: 240 MFDTNQLHAAVVELVALDNATIEYSTVQNWFAGDENGKGGIYNFVTKRGLCKGVNSKISW 299

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SKG
Sbjct: 300 TQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNCQQADTGTKMVHIGKNTRSTIISKG 359

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI+ +NS+  +EHEA+
Sbjct: 360 ISAGRSANSYRGLVKMGPKAVGARNYSQCDSMLIGDCGQANTFPYIQVENSTAKVEHEAS 419

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFY  QRGI EE A+++I++GF ++V  KLPMEFA EA KL+ + LEG+VG
Sbjct: 420 TSKIGEDQLFYFTQRGISEEDAVSMIISGFCKDVFNKLPMEFAAEADKLLSLKLEGAVG 478


>gi|332284500|ref|YP_004416411.1| hypothetical protein PT7_1247 [Pusillimonas sp. T7-7]
 gi|330428453|gb|AEC19787.1| hypothetical protein PT7_1247 [Pusillimonas sp. T7-7]
          Length = 495

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 327/489 (66%), Positives = 395/489 (80%), Gaps = 6/489 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
             V+   D +      +Y  GF T I+    PKGL+ED IR +SAKK EP++MLEWRL A
Sbjct: 12  TVVKPAADPIESFLDREYSAGFVTEIESVTIPKGLSEDTIRLLSAKKGEPEFMLEWRLAA 71

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIR 120
           YR WLTM  P WA++ +PAIDF D+ YY+APKS   GP+SLD+VDPELLRTYEKLG+P+ 
Sbjct: 72  YRHWLTMDLPEWAKVSFPAIDFQDISYYSAPKSKKDGPKSLDEVDPELLRTYEKLGVPLH 131

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG     VAVDAVFDSVSV TTF+++L + GVIF   SEA+ E+P+LV+KYL +V
Sbjct: 132 ERARLAG-----VAVDAVFDSVSVATTFRKQLAEVGVIFCSFSEAVKEYPELVRKYLGSV 186

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP GDNFYAALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN + TGQFERTLIIA+EG+ 
Sbjct: 187 VPPGDNFYAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAQDTGQFERTLIIAEEGAS 246

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD+A+IKYSTVQNWYPGD  GKGGIYNFVTKRGD
Sbjct: 247 VSYLEGCTAPMRDENQLHAAVVELVALDDAKIKYSTVQNWYPGDKDGKGGIYNFVTKRGD 306

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RS+ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A+SN  QQ D+GTKM+H+ +
Sbjct: 307 CRGARSRISWTQVETGSAITWKYPSVILRGDDSIGEFYSVALSNHRQQADTGTKMIHIGR 366

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG  +N YRG V +   A ++RN+TQCDSLLIG+ C AHT P +E +N
Sbjct: 367 NTRSTIISKGISAGHGSNAYRGLVRITPKAENARNYTQCDSLLIGSKCAAHTFPTMEVQN 426

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S ++EHEAT S+I ++ LFY +QRG+  E A+++IVNGF +EV ++LPMEFAVEAQ L+
Sbjct: 427 PSASVEHEATASRIGEDQLFYAMQRGLSAEDAVSMIVNGFCKEVFKELPMEFAVEAQNLL 486

Query: 481 DISLEGSVG 489
            +SLEGSVG
Sbjct: 487 GVSLEGSVG 495


>gi|124005860|ref|ZP_01690698.1| FeS assembly protein SufB [Microscilla marina ATCC 23134]
 gi|123988543|gb|EAY28184.1| FeS assembly protein SufB [Microscilla marina ATCC 23134]
          Length = 481

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 325/486 (66%), Positives = 393/486 (80%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +  D + +     YKYGFET I+ + APKGL+E+ IRFISAKKNEP+WMLEWRL A+ 
Sbjct: 1   MSKETDILEEHINSDYKYGFETKIETESAPKGLDENTIRFISAKKNEPEWMLEWRLAAFA 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           +W TM +P+W  + +P ID+ D+ YYAAPK      +LD+VDPELL+T+EKLGI + EQ+
Sbjct: 61  QWKTMTEPNWQNVDFPKIDYQDIIYYAAPKKKAKLNNLDEVDPELLKTFEKLGISLEEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L GV    V          + TTFKE+L + G+IF  +SEA+ EHP+LV+KYL  VVP 
Sbjct: 121 RLTGVAVDAVVDSVS-----ITTTFKEKLGELGIIFCSMSEALQEHPELVRKYLGKVVPT 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN++AALNSAVF+DGSF YIPKGVRCPMELSTYFRIN  GTGQFERTLI+ADEGSYVSY
Sbjct: 176 NDNYFAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINTAGTGQFERTLIVADEGSYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAAVVEL+A+DNAEIKYSTVQNWYPGD  GKGGIYNFVTKRG C G
Sbjct: 236 LEGCTAPMRDENQLHAAVVELIAMDNAEIKYSTVQNWYPGDKNGKGGIYNFVTKRGICDG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT 
Sbjct: 296 VNSKISWTQVETGSAITWKYPSCILKGDNSIGEFYSVAVTNNYQQADTGTKMIHIGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N YRG+V V + A ++RN++QCDSLL+G+ CGAHT PYIE+ N + 
Sbjct: 356 SRIVSKGISAGHSQNAYRGQVKVMKRAHNARNYSQCDSLLMGDLCGAHTFPYIEADNPTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ LFYC QRGI  EAA+ALIVNG+ +EVL++LPMEFAVEAQKL+ IS
Sbjct: 416 VIEHEATTSKIGEDQLFYCTQRGIDPEAAVALIVNGYAKEVLKQLPMEFAVEAQKLLAIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|86138296|ref|ZP_01056870.1| FeS assembly protein SufB [Roseobacter sp. MED193]
 gi|85824821|gb|EAQ45022.1| FeS assembly protein SufB [Roseobacter sp. MED193]
          Length = 511

 Score =  553 bits (1426), Expect = e-155,   Method: Composition-based stats.
 Identities = 348/494 (70%), Positives = 408/494 (82%), Gaps = 11/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD V ++    YKYG+ET+I+++ APKGL  DI+R IS K  EP+WML WRL AY R
Sbjct: 20  QETVDAVAEV--STYKYGWETDIEMEYAPKGLTTDIVRLISEKNEEPEWMLNWRLEAYDR 77

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WL  ++PSWA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY+KLGIP++EQ 
Sbjct: 78  WLQKEEPSWAMVDYPEIDFQDQYYYARPKSMEVKPKSLDEVDPKLLETYKKLGIPLKEQM 137

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ ELKK+GVIF  ISEAI EHP+LVKK
Sbjct: 138 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQAELKKAGVIFCSISEAIREHPELVKK 197

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVYIP GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 198 YLGSVVPVSDNFYATLNSAVFSDGSFVYIPPGVRCPMELSTYFRINAENTGQFERTLIIA 257

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 258 DKGSYVSYLEGCTAPARDIAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 317

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D+GTKM
Sbjct: 318 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNMQQADTGTKM 377

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL ++T SRIVSKGISAG + NTYRG VS+H  A + RNFTQCDSLLIG+ CGAHT+PY
Sbjct: 378 VHLGRDTKSRIVSKGISAGKAQNTYRGLVSMHPKAKNGRNFTQCDSLLIGDKCGAHTVPY 437

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC QRGI EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 438 IEVKNNSSRVEHEATTSKVDDDQLFYCRQRGIGEEDAVALVVNGFCKDVLQALPMEFAME 497

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 498 AQQLVAISLEGSVG 511


>gi|149376032|ref|ZP_01893798.1| component of SufBCD complex [Marinobacter algicola DG893]
 gi|149359669|gb|EDM48127.1| component of SufBCD complex [Marinobacter algicola DG893]
          Length = 482

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 335/487 (68%), Positives = 398/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  T  +V ++   +Y++GF T+I+ D    GLNED+I  +SA K EP+WMLEWRL AYR
Sbjct: 1   MATTDKEVNELIKREYEHGFVTDIEADTFEPGLNEDVIARLSAIKKEPEWMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL M +P WA + YP ID++ + YY+APK     PQSLD+VDPELL+TYEKLGIP+ E+
Sbjct: 61  RWLEMDEPDWAHVGYPKIDYNSISYYSAPKRKEDMPQSLDEVDPELLKTYEKLGIPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E LAG     VAVDAVFDSVSV TTFKE L K+GVIF  ISEAI ++P+LVKKYL +VVP
Sbjct: 121 EKLAG-----VAVDAVFDSVSVATTFKEPLAKAGVIFCSISEAIQDYPELVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNF+A LNSAVF+DG+FVY+PKGVRCPMELSTYFRIN   TGQFERTLIIA++ SYVS
Sbjct: 176 AGDNFFAGLNSAVFSDGTFVYVPKGVRCPMELSTYFRINAANTGQFERTLIIAEDSSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVALD+A+IKYSTVQNWYPGD  GKGGI+NFVTKRG   
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDENGKGGIFNFVTKRGAAI 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSA+TWKYPSC+LRG+ S GEFYS+A++N FQQ D+GTKM+HL KNT
Sbjct: 296 GKNSKISWTQVETGSAVTWKYPSCVLRGDNSVGEFYSVALTNNFQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           +S I+SKGISAG S+N YRG V    GA  +RN+TQCDSLLIG+ CGAHT PYIESKN S
Sbjct: 356 SSTIISKGISAGKSSNAYRGLVKFGPGAEGARNYTQCDSLLIGDRCGAHTFPYIESKNKS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSK+SDE +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++
Sbjct: 416 AIVEHEATTSKVSDEQMFLCRQRGIDPEQAVSMIVNGFCKEVFKELPMEFAVEAGKLLEV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|189465084|ref|ZP_03013869.1| hypothetical protein BACINT_01428 [Bacteroides intestinalis DSM
           17393]
 gi|224536661|ref|ZP_03677200.1| hypothetical protein BACCELL_01537 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|189437358|gb|EDV06343.1| hypothetical protein BACINT_01428 [Bacteroides intestinalis DSM
           17393]
 gi|224521752|gb|EEF90857.1| hypothetical protein BACCELL_01537 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 485

 Score =  553 bits (1425), Expect = e-155,   Method: Composition-based stats.
 Identities = 318/487 (65%), Positives = 396/487 (81%), Gaps = 7/487 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  +   +GLNED++R ISAKKNEP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTEVIERGLNEDVVRLISAKKNEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP--KSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           WLTM+ P+WA +R P ID+  + YYA P  K    P+S+D+VDPEL++T+ KLGIP+ EQ
Sbjct: 64  WLTMEMPTWAHLRIPEIDYQAISYYADPLAKKKDAPKSMDEVDPELIKTFNKLGIPLEEQ 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             L+G     +AVDAV DSVSV TTFKE L + G+IF  ISEA+ EHPDLV+KYL +VV 
Sbjct: 124 MALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSISEAVREHPDLVQKYLGSVVG 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVS
Sbjct: 179 YRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAA+VE+V  + AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+
Sbjct: 239 YLEGCTAPMRDENQLHAAIVEIVVHERAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCK 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 299 GANSKLSWTQVETGSAITWKYPSCILTGDNSSAEFYSVAVTNNYQQADTGTKMIHLGKNT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           +S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N +
Sbjct: 359 SSTIVSKGISAGHSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNET 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKI+++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ I
Sbjct: 419 AVVEHEATTSKINEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAI 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|120556061|ref|YP_960412.1| cysteine desulfurase activator complex subunit SufB [Marinobacter
           aquaeolei VT8]
 gi|120325910|gb|ABM20225.1| Iron-regulated ABC transporter membrane component SufB
           [Marinobacter aquaeolei VT8]
          Length = 482

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 338/487 (69%), Positives = 402/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  T ++V+++   +Y++GF T I+ D    GLNED+I  +SA K EP+WMLEWRL AYR
Sbjct: 1   MATTDNEVKELIKREYEHGFVTEIEADTFEPGLNEDVIARLSAIKKEPEWMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL M++P+WA + YP +D++ + YY+APK     PQSLD+VDPELL+TYEKLGIP+ E+
Sbjct: 61  RWLEMEEPNWAHVGYPKVDYNSISYYSAPKRKEDMPQSLDEVDPELLKTYEKLGIPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E LAG     VAVDAVFDSVSV TTFKE L K+GVIF  ISEA+ ++P+LV+KYL TVVP
Sbjct: 121 EKLAG-----VAVDAVFDSVSVATTFKEPLAKAGVIFCSISEAVRDYPELVQKYLGTVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNF+A LNSAVF+DG+FVY+PKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVS
Sbjct: 176 HGDNFFAGLNSAVFSDGTFVYVPKGVRCPMELSTYFRINAANTGQFERTLIIADEGSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVALD+A+IKYSTVQNWYPGD  GKGGIYNFVTKRG C 
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDENGKGGIYNFVTKRGACI 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSA+TWKYPSC+LRGE S GEFYS+A+++ +QQ D+GTKM+HL KNT
Sbjct: 296 GKNSKISWTQVETGSAVTWKYPSCVLRGENSVGEFYSVALTHNYQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG S+N YRG V    GA  +RNFTQCDSLLIG+ CGAHT PYIESKN S
Sbjct: 356 RSTIISKGISAGKSSNAYRGLVKFGPGAEGARNFTQCDSLLIGDRCGAHTFPYIESKNKS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSK+SDE +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++
Sbjct: 416 AIVEHEATTSKVSDEQMFLCRQRGIDPEQAVSMIVNGFCKEVFKELPMEFAVEAGKLLEV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|298490170|ref|YP_003720347.1| FeS assembly protein SufB ['Nostoc azollae' 0708]
 gi|298232088|gb|ADI63224.1| FeS assembly protein SufB ['Nostoc azollae' 0708]
          Length = 479

 Score =  553 bits (1424), Expect = e-155,   Method: Composition-based stats.
 Identities = 314/480 (65%), Positives = 389/480 (81%), Gaps = 6/480 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +    YKYGF T+I+ D  P+GLNED+IR ISAKKNEP++MLE+RL AY +WL M +
Sbjct: 5   VKTLVNQPYKYGFVTDIEADTIPRGLNEDVIRLISAKKNEPEFMLEYRLRAYHQWLKMIE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           PSW  + YP I++ D+ YY+APK       SLD+VDP LL T+EKLGIP+ EQ+ L+   
Sbjct: 65  PSWPHVTYPPINYQDIIYYSAPKQKKAKLNSLDEVDPTLLETFEKLGIPLNEQKRLS--- 121

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDA+FDSVSV TTFKE L K GVIF  ISEA+ EHP+L+KKYL +VVP+ DN++A
Sbjct: 122 --NVAVDAIFDSVSVATTFKENLAKDGVIFCSISEALQEHPELIKKYLGSVVPIADNYFA 179

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALN+AVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLIIA+EGSYVSYLEGCTA
Sbjct: 180 ALNAAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIIAEEGSYVSYLEGCTA 239

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELVALDNAEIKYSTVQNWY GD+ GKGGIYNFVTKRG C+G+ SKIS
Sbjct: 240 PMYDSNQLHAAVVELVALDNAEIKYSTVQNWYAGDANGKGGIYNFVTKRGLCQGVNSKIS 299

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SK
Sbjct: 300 WTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNMQQADTGTKMIHIGKNTRSTIISK 359

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S+N+YRG V ++  A  +RN++QCDS+LIG+N  A+T PYI+ +N++  +EHEA
Sbjct: 360 GISAGKSSNSYRGLVKINPTAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNNGKVEHEA 419

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ LF+  QRGI  E AI+++++GF ++V  +LPMEFAVEA KL+ + LEGSVG
Sbjct: 420 STSKIGEDQLFFFAQRGISSEDAISMMISGFCKDVFNQLPMEFAVEANKLLSLKLEGSVG 479


>gi|307544374|ref|YP_003896853.1| Fe-S cluster assembly protein SufB [Halomonas elongata DSM 2581]
 gi|307216398|emb|CBV41668.1| K09014 Fe-S cluster assembly protein SufB [Halomonas elongata DSM
           2581]
          Length = 480

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 321/482 (66%), Positives = 391/482 (81%), Gaps = 6/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
            ++ ++   +YK GF T+I+ +  P GL+ED I FIS KK EP+WMLEWRL AY +WL M
Sbjct: 4   QEMEELVRREYKEGFVTDIESETVPPGLDEDTIAFISKKKGEPEWMLEWRLKAYHQWLKM 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPK-SIVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
             PSWA + YP ID+  + YY+APK     PQSLD+VDP+LL TYEKLGIP+ E+  LAG
Sbjct: 64  TPPSWAHLNYPPIDYQAISYYSAPKRPEDRPQSLDEVDPKLLETYEKLGIPLHERAALAG 123

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSV TTFKE+L+++GVIF  ISEAI ++P+LV++YL +VVP GDN+
Sbjct: 124 -----VAVDAVFDSVSVTTTFKEKLQEAGVIFCSISEAIRDYPELVQQYLGSVVPQGDNY 178

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFV++P+GV CPMELSTYFRIN   TGQFERTLI+ +  + VSYLEGC
Sbjct: 179 FAALNSAVFTDGSFVFVPEGVTCPMELSTYFRINAANTGQFERTLIVCESRAEVSYLEGC 238

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVAL++A+IKYSTVQNWYPGD  GKGGIYNFVTKRGDCRG RS 
Sbjct: 239 TAPQRDENQLHAAVVELVALEDAKIKYSTVQNWYPGDEDGKGGIYNFVTKRGDCRGDRSH 298

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++NG QQ D+GTKM+H+ + T S IV
Sbjct: 299 ISWTQVETGSAITWKYPSCVLRGKDSVGEFYSVAVTNGRQQADTGTKMIHIGEGTRSTIV 358

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGI+AG S+ +YRG V V   A ++RNFTQCDSLLIG+ CGAHT PY E  NSS  +EH
Sbjct: 359 SKGIAAGRSDQSYRGLVKVGPRAKNARNFTQCDSLLIGDTCGAHTFPYQEIGNSSAKVEH 418

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKI ++ LFYC  RGI EE A+ +IVNGF ++V Q+LPMEFAVEA+ L++++LEG+
Sbjct: 419 EATTSKIGEDQLFYCQSRGIGEEDAVNMIVNGFCKDVFQELPMEFAVEAEALLNVTLEGA 478

Query: 488 VG 489
           VG
Sbjct: 479 VG 480


>gi|254430711|ref|ZP_05044414.1| FeS assembly protein SufB [Cyanobium sp. PCC 7001]
 gi|197625164|gb|EDY37723.1| FeS assembly protein SufB [Cyanobium sp. PCC 7001]
          Length = 479

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 304/480 (63%), Positives = 375/480 (78%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V  +    YKYGF T+I+ DK  KGL+ED++R ISAKKNEP+++L++RL A+R WLTM 
Sbjct: 5   TVGDLVSQPYKYGFVTDIETDKIAKGLSEDVVRLISAKKNEPEFLLDFRLRAFRHWLTMV 64

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           +P WA + YP ID+ D+ YYAAP+      SLD+VDP+LL T++KLGIP+ EQ+ L+   
Sbjct: 65  EPDWAALGYPRIDYQDIIYYAAPRQQDKKSSLDEVDPKLLETFDKLGIPLSEQKRLS--- 121

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVS+ TTFKE+L + GVIF  ISEA+ +HPDL++ YL TVVP  DNF+A
Sbjct: 122 --NVAVDAVFDSVSIATTFKEQLAEHGVIFCSISEAVKDHPDLIEAYLGTVVPTNDNFFA 179

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEGCTA
Sbjct: 180 ALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEGCTA 239

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RSKIS
Sbjct: 240 PMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGDRSKIS 299

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S IVSK
Sbjct: 300 WTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNHQQADTGTKMIHVGPRTRSTIVSK 359

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +EHEA
Sbjct: 360 GISAGHSSNSYRGLVQIGPKAVGARNYSQCDSMLIGDQAAANTYPYIRSQQPDAAVEHEA 419

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 420 STCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEGSVG 479


>gi|254485515|ref|ZP_05098720.1| FeS assembly protein SufB [Roseobacter sp. GAI101]
 gi|214042384|gb|EEB83022.1| FeS assembly protein SufB [Roseobacter sp. GAI101]
          Length = 504

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 345/494 (69%), Positives = 409/494 (82%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           +ETVD VR++    YK+G+ T+I++D AP GLNEDI++ IS K  EP+WMLEWRL AY+R
Sbjct: 12  QETVDAVREVG-GAYKHGWSTDIEMDYAPLGLNEDIVKLISGKNEEPEWMLEWRLAAYQR 70

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT  +P WA + YP IDF + YYYA PKS+   P+SLD+VDP+LL TY KLGIP++EQ 
Sbjct: 71  WLTKNEPDWAMVDYPKIDFQEQYYYARPKSMAVKPKSLDEVDPKLLATYAKLGIPLKEQM 130

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           +LAGV+          KVAVDAVFDSVSV TTF++ELK +GVIF  ISEAI +HP+LVKK
Sbjct: 131 LLAGVEGAEELTDAPRKVAVDAVFDSVSVGTTFQKELKAAGVIFCSISEAIRDHPELVKK 190

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 191 YLGSVVPVNDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 250

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAPQRDE+QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 251 DKGSYVSYLEGCTAPQRDESQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 310

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 311 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 370

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 371 IHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKESRNYTQCDSLLIGSECGAHTVPY 430

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ LFYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 431 IEVKNNSSRVEHEATTSKVDDDQLFYCRSRGMDEEEAVALVVNGFCKDVLQALPMEFAME 490

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 491 AQALVAISLEGSVG 504


>gi|325919609|ref|ZP_08181621.1| Iron-regulated ABC transporter membrane component SufB [Xanthomonas
           gardneri ATCC 19865]
 gi|325549945|gb|EGD20787.1| Iron-regulated ABC transporter membrane component SufB [Xanthomonas
           gardneri ATCC 19865]
          Length = 485

 Score =  552 bits (1423), Expect = e-155,   Method: Composition-based stats.
 Identities = 317/487 (65%), Positives = 386/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T+I+ D  P GL+ED+IR +SAKK EP WM +WRL AY
Sbjct: 6   APPQNAEIIERLGR-RYDAGFITDIESDSLPPGLDEDVIRALSAKKEEPQWMTDWRLEAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA+++   IDF  L YY+APK      SLDDV  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLKMPMPEWAKLQISPIDFQALSYYSAPKG-PKYASLDDVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK+YL +VVP
Sbjct: 124 ARLAG-----VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVS
Sbjct: 179 VGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV L++AEIKYSTVQNWYPGD  G GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDENGVGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T
Sbjct: 299 GDRSKVTWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 359 KSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|85703166|ref|ZP_01034270.1| FeS assembly protein SufB [Roseovarius sp. 217]
 gi|85672094|gb|EAQ26951.1| FeS assembly protein SufB [Roseovarius sp. 217]
          Length = 507

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 346/494 (70%), Positives = 412/494 (83%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           RETVD VR++  + YK+G+ T+I+++ AP GLNEDI+R IS+K  EP+WM EWRL AYRR
Sbjct: 15  RETVDAVRQVG-EAYKHGWNTDIEMEYAPLGLNEDIVRLISSKNEEPEWMTEWRLEAYRR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT  +P WA + YP IDF   YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ 
Sbjct: 74  WLTKTEPEWAMVDYPKIDFQAQYYYARPKSMEVKPKSLDEVDPKLLATYEKLGIPLKEQM 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVSV TTF+ EL+++GVIF  ISEAI EHP+LVKK
Sbjct: 134 ILAGVEGAEDAPAEGRKVAVDAVFDSVSVGTTFQAELRRAGVIFCSISEAIREHPELVKK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           D+GSYVSYLEGCTAP+RD  QLHAAVVE++  ++AE+KYSTVQNWYPGD  GKGGIYNFV
Sbjct: 254 DKGSYVSYLEGCTAPKRDVAQLHAAVVEIIIEEDAEVKYSTVQNWYPGDENGKGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG R+K+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N +QQ D+GTKM
Sbjct: 314 TKRADCRGDRAKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNYQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL KNT SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 IHLGKNTRSRIVSKGISAGHAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDQCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSK+ D+ +FYC  RG+ EE A+AL+VNGF ++VLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKVDDDQMFYCRARGMDEEEAVALVVNGFCKDVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ+L+ ISLEGSVG
Sbjct: 494 AQQLVAISLEGSVG 507


>gi|325982999|ref|YP_004295401.1| FeS assembly protein SufB [Nitrosomonas sp. AL212]
 gi|325532518|gb|ADZ27239.1| FeS assembly protein SufB [Nitrosomonas sp. AL212]
          Length = 478

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 316/489 (64%), Positives = 391/489 (79%), Gaps = 11/489 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV      ++ +    YK+GF T I+ D APKGLNEDIIR ISAKKNEP+W+L +RL 
Sbjct: 1   MSAV------LQSLVNQPYKHGFVTKIESDVAPKGLNEDIIRLISAKKNEPEWLLSFRLE 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY++WLTMK+P W  + YP IDF  + YY+APK      S+D+VDPELLRT+EKLG+P+ 
Sbjct: 55  AYQKWLTMKEPEWQNVHYPKIDFQAISYYSAPKPKKKLASMDEVDPELLRTFEKLGVPMH 114

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG     VAVD +FDSVSV TT+K++L + G+IF  ISEA+  HP+L+++YL TV
Sbjct: 115 ERAALAG-----VAVDVIFDSVSVATTYKQKLAEVGIIFCSISEAVHNHPELIQRYLGTV 169

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPVGDN++AALNSAVFTDGSF +IPKGV+CPM+LSTYFRIN +G+GQFERTLIIA+E + 
Sbjct: 170 VPVGDNYFAALNSAVFTDGSFCFIPKGVKCPMDLSTYFRINTEGSGQFERTLIIAEEDAT 229

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+ D NQLHAAVVELVALDNA+IKYSTVQNWY GD  G GGIYNFVTKRG 
Sbjct: 230 VSYLEGCTAPRFDTNQLHAAVVELVALDNADIKYSTVQNWYAGDENGIGGIYNFVTKRGL 289

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
            +G  S+ISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++N +QQ D+GTKM+HL K
Sbjct: 290 AKGKNSRISWTQVETGSAITWKYPSCILRGDNSVGEFYSVAVTNNYQQADTGTKMIHLGK 349

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S IVSKGISAG SN++YRG V +   A  +RN++QCDS+LIG+ CGAHT PYI+  N
Sbjct: 350 NTRSTIVSKGISAGHSNSSYRGLVRISPTAEGARNYSQCDSMLIGDQCGAHTFPYIQVHN 409

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           +S  +EHEA+TSKI ++ LFY  QRGI  E A+++I+NGF ++V Q+LPMEFAVEA KL+
Sbjct: 410 NSAIVEHEASTSKIGEDQLFYFSQRGIDAEEAVSMIINGFCKDVFQQLPMEFAVEATKLL 469

Query: 481 DISLEGSVG 489
              LEGSVG
Sbjct: 470 SFKLEGSVG 478


>gi|311695875|gb|ADP98748.1| cysteine desulfurase activator complex subunit SufB [marine
           bacterium HP15]
          Length = 490

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 336/487 (68%), Positives = 398/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  T  +V ++   +Y+YGF T+I+ D    GLNED+I  +S  K EP+WMLEWRL AYR
Sbjct: 9   MATTDTEVNELIKREYEYGFVTDIESDTFEPGLNEDVIARLSGLKKEPEWMLEWRLKAYR 68

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL M +P WA + YP ID++ + YY+APK     PQSLD+VDPELL+TYEKLGIP+ E+
Sbjct: 69  RWLEMDEPDWAHVGYPKIDYNSISYYSAPKRPEDMPQSLDEVDPELLKTYEKLGIPLHER 128

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E LAG     VAVDAVFDSVSV TTFKE L K+GVIF  ISEAI ++P+LVKKYL +VVP
Sbjct: 129 EKLAG-----VAVDAVFDSVSVATTFKEPLAKAGVIFCSISEAIQDYPELVKKYLGSVVP 183

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNF+A LNSAVF+DG+FVY+PKGVRCPMELSTYFRIN   TGQFERTLIIA++ SYVS
Sbjct: 184 AGDNFFAGLNSAVFSDGTFVYVPKGVRCPMELSTYFRINAANTGQFERTLIIAEDSSYVS 243

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVALD+A+IKYSTVQNWYPGD +GKGGI+NFVTKRG   
Sbjct: 244 YLEGCTAPMRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDEEGKGGIFNFVTKRGAAI 303

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSA+TWKYPSC+LRGE S GEFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 304 GKNSKISWTQVETGSAVTWKYPSCVLRGENSVGEFYSVALTNNYQQADTGTKMIHLGKNT 363

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           +S I+SKGISAG S+N YRG V    GA  +RNFTQCDSLLIG+ CGAHT PYIESKN S
Sbjct: 364 SSTIISKGISAGKSSNAYRGLVKFGPGAEGARNFTQCDSLLIGDRCGAHTFPYIESKNKS 423

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSK+SDE +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++
Sbjct: 424 AIVEHEATTSKVSDEQMFLCRQRGIDPEQAVSMIVNGFCKEVFKELPMEFAVEAGKLLEV 483

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 484 SLEGSVG 490


>gi|209516299|ref|ZP_03265156.1| FeS assembly protein SufB [Burkholderia sp. H160]
 gi|209503235|gb|EEA03234.1| FeS assembly protein SufB [Burkholderia sp. H160]
          Length = 482

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 319/487 (65%), Positives = 398/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  +V ++ ++   +Y++GF TN++ D  P+G++ED+IR ISAKKNEPD+MLEWRL AYR
Sbjct: 1   MSSSVSRIDELIQREYQHGFVTNVKSDTLPRGVSEDVIRLISAKKNEPDFMLEWRLAAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM +P WA + +P ID+ D+ YY+AP      P+SL++VDPELLRTYEKLG+P++E+
Sbjct: 61  HWLTMNEPHWATVEHPPIDYQDIAYYSAPMAQKNRPRSLEEVDPELLRTYEKLGVPLKER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           EILAG     VAVDAVFDSVSV TTF E+L   G++F   SEA+  HPDLV++YL +VVP
Sbjct: 121 EILAG-----VAVDAVFDSVSVATTFGEKLGALGIVFCSFSEAVQTHPDLVRRYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+AALNSAVF+DGSF YIP GVRCP+ELSTYFRIN + TGQFERTLIIAD+G+YVS
Sbjct: 176 HTDNFFAALNSAVFSDGSFCYIPPGVRCPVELSTYFRINAQNTGQFERTLIIADKGAYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVAL+ A+I+YSTVQNWYPGD+ G+GGIYNFVTKRGDCR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALEGAQIRYSTVQNWYPGDAHGRGGIYNFVTKRGDCR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
              SKISWTQ+ETGSAITWKYPS +L+G+ + GEFYS+A++N +QQ D+GTKM HL +NT
Sbjct: 296 EANSKISWTQVETGSAITWKYPSVILQGDNAVGEFYSVALTNNYQQADTGTKMTHLGRNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG  +N YRG V + R A  +RN+TQCDSLL+G+ C A T PYIE KN +
Sbjct: 356 RSTILSKGISAGHGSNAYRGLVKIARAAEDARNYTQCDSLLLGDRCSALTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TS+I ++ LFYC QRG+ EE A+++IVNGF REVL++LPMEFAVEAQKL+ +
Sbjct: 416 AKVEHEASTSRIGEDQLFYCRQRGVSEEDAVSMIVNGFCREVLKELPMEFAVEAQKLLGV 475

Query: 483 SLEGSVG 489
           SLEGS G
Sbjct: 476 SLEGSTG 482


>gi|325299863|ref|YP_004259780.1| FeS assembly protein SufB [Bacteroides salanitronis DSM 18170]
 gi|324319416|gb|ADY37307.1| FeS assembly protein SufB [Bacteroides salanitronis DSM 18170]
          Length = 483

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 322/485 (66%), Positives = 395/485 (81%), Gaps = 6/485 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
           E    V+++  ++YKYGF T++Q D   KGLNED++R ISAKK EPDW+L++RL A+R W
Sbjct: 4   EPNKYVKELTQEKYKYGFTTDVQTDIIEKGLNEDVVRLISAKKQEPDWLLDFRLKAFRYW 63

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
            T++ P+WA +  P ID+  + YYA P K   GP+SL+DVDPELL+T+ KLGIP+ EQ  
Sbjct: 64  QTLEMPTWAHLTIPEIDYQAISYYADPTKKKDGPKSLEDVDPELLKTFNKLGIPLEEQLA 123

Query: 125 LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVG 184
           L+G     +AVDAV DSVSV TTFKE L + G+IF  +SEA+ EHPDLVKKYL +VV   
Sbjct: 124 LSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSMSEAVREHPDLVKKYLGSVVGYR 178

Query: 185 DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYL 244
           DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYVSYL
Sbjct: 179 DNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDSYVSYL 238

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           EGCTAP RDENQLHAA+VE+V ++ AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+G 
Sbjct: 239 EGCTAPMRDENQLHAAIVEIVVMNRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCKGR 298

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N FQQ D+GTKM+HL KNT S
Sbjct: 299 DSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNFQQADTGTKMIHLGKNTRS 358

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
            IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G++CGAHT PY++  N +  
Sbjct: 359 TIVSKGISAGRSQNSYRGLVRVSEKADNARNYSQCDSLLLGSHCGAHTFPYMDIHNETAV 418

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISL 484
           +EHEATTSKIS++ LFYC QRGIP E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ +SL
Sbjct: 419 VEHEATTSKISEDQLFYCNQRGIPTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLSVSL 478

Query: 485 EGSVG 489
           EGSVG
Sbjct: 479 EGSVG 483


>gi|217970312|ref|YP_002355546.1| FeS assembly protein SufB [Thauera sp. MZ1T]
 gi|217507639|gb|ACK54650.1| FeS assembly protein SufB [Thauera sp. MZ1T]
          Length = 502

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 326/482 (67%), Positives = 395/482 (81%), Gaps = 6/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           D +       Y  GFET +  D  PKGL+ED+IR ISA+K EP+W+L+WRL AYR WLTM
Sbjct: 26  DAIGAFLEQDYAAGFETTLDTDTVPKGLSEDVIRMISARKGEPEWLLDWRLEAYRHWLTM 85

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
             P+WA +++PA+DF D+ YY+APKS   GP+SLD+VDPELLRT+EKLG+P+ E+  LAG
Sbjct: 86  SPPTWAAVQFPAVDFQDIVYYSAPKSKKDGPKSLDEVDPELLRTFEKLGVPLHERARLAG 145

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSV TTFK+EL   GVIF   SEA+ EHP+LV+KYL TVVP GDNF
Sbjct: 146 -----VAVDAVFDSVSVATTFKKELGAHGVIFCSFSEAVKEHPELVRKYLGTVVPPGDNF 200

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN + TGQFERTLIIA+EG+ VSYLEGC
Sbjct: 201 YAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINARDTGQFERTLIIAEEGASVSYLEGC 260

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVEL+ALD+A+IKYSTVQNWYPGD  GKGGIYNFVTKRGDCRG RS 
Sbjct: 261 TAPMRDENQLHAAVVELIALDDAKIKYSTVQNWYPGDKDGKGGIYNFVTKRGDCRGARSH 320

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S G+F+S+A++N  QQ D+GTKM+H+ +NT S I+
Sbjct: 321 ISWTQVETGSAITWKYPSVILRGDDSVGDFHSVALTNNLQQADTGTKMIHMGRNTRSTIL 380

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG  +NT+RG V +   A  +RN+TQCDSLLIG+ C AHT P IE ++ + ++EH
Sbjct: 381 SKGISAGRGSNTFRGLVKITPKAEGARNYTQCDSLLIGDRCAAHTFPTIEVRHPTAHVEH 440

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTS+I ++ LFY +QRGI  E A+++IVNGF REV ++LPMEFAVEAQKL+ +SLEGS
Sbjct: 441 EATTSRIGEDQLFYAMQRGISAEDAVSMIVNGFCREVFKELPMEFAVEAQKLLGVSLEGS 500

Query: 488 VG 489
           VG
Sbjct: 501 VG 502


>gi|304321530|ref|YP_003855173.1| hypothetical protein PB2503_09894 [Parvularcula bermudensis
           HTCC2503]
 gi|303300432|gb|ADM10031.1| hypothetical protein PB2503_09894 [Parvularcula bermudensis
           HTCC2503]
          Length = 507

 Score =  552 bits (1422), Expect = e-155,   Method: Composition-based stats.
 Identities = 344/496 (69%), Positives = 410/496 (82%), Gaps = 15/496 (3%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           TVD VR ++   YKYGF T+I+  +APKGL+E+ +R+ISAKK EP+WML+WRL A+RRW 
Sbjct: 14  TVDAVRSLET--YKYGFTTDIESVRAPKGLSEETVRYISAKKEEPEWMLDWRLQAFRRWQ 71

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
            M +P+W ++ YP ID+ D YYYA PK+    +S+DDV  E+L  +EKLGIP++E E+L 
Sbjct: 72  KMTEPNWQKVTYPPIDYQDQYYYAEPKAGAKYESIDDVPAEILADFEKLGIPLKEAEVLL 131

Query: 127 GVQT-------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           GV+                VAVDAVFDSVSV TTFK+EL+K+GV+FM ISEAI EHPDLV
Sbjct: 132 GVKGAAETAAGARGDARPGVAVDAVFDSVSVATTFKKELEKAGVLFMSISEAIREHPDLV 191

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           K+Y+ TVVP  DN++A LNSAVF+DG+FVY+P GVRCPMELSTYFRINE  TGQFERTLI
Sbjct: 192 KRYIGTVVPPTDNYFATLNSAVFSDGTFVYVPAGVRCPMELSTYFRINEANTGQFERTLI 251

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           +AD+G+YVSYLEGCTAP RDENQLHAAVVELVAL++AEIKYSTVQNWYPGD  GKGGIYN
Sbjct: 252 VADKGAYVSYLEGCTAPMRDENQLHAAVVELVALEDAEIKYSTVQNWYPGDKDGKGGIYN 311

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKR DCRG RSK+SWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GT
Sbjct: 312 FVTKRADCRGDRSKVSWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAITNNHQQADTGT 371

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KMLHL + T SRI+SKGISAG S+ TYRG VS+ R A  +RNFTQCDSLLIG+ CGAHTI
Sbjct: 372 KMLHLGQRTKSRIISKGISAGQSDQTYRGLVSIGRKARGARNFTQCDSLLIGDRCGAHTI 431

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYIE K++S  LEHEATTSK+S++ LFY  QRG+ EEAA+AL+VNGF REVLQ+LPMEFA
Sbjct: 432 PYIEDKSASALLEHEATTSKLSEDQLFYTQQRGLDEEAAVALLVNGFCREVLQELPMEFA 491

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL+ +SLEGSVG
Sbjct: 492 VEAQKLVAVSLEGSVG 507


>gi|253996499|ref|YP_003048563.1| cysteine desulfurase activator complex subunit SufB [Methylotenera
           mobilis JLW8]
 gi|253983178|gb|ACT48036.1| FeS assembly protein SufB [Methylotenera mobilis JLW8]
          Length = 481

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 316/484 (65%), Positives = 391/484 (80%), Gaps = 6/484 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T  ++  +   +Y++GF T ++ D  P GLNE+ +R ISAKKNEP +MLEWRL AY+ WL
Sbjct: 3   TTKQLDALINREYQHGFYTQLEADTIPLGLNENTVRLISAKKNEPAFMLEWRLKAYQHWL 62

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           T+ +P+W  + YP ID+   YYY+APKS   GP+ L ++DPELLRTYEKLGIP+REQ++L
Sbjct: 63  TLSEPTWPNLHYPPIDYQHAYYYSAPKSEKAGPRDLSEIDPELLRTYEKLGIPLREQQVL 122

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           AG     VAVDAVFDSVSV TTFK++L   G+IF P SEA+ +HP+LV++YL +VVP  D
Sbjct: 123 AG-----VAVDAVFDSVSVATTFKQKLSTLGIIFCPFSEAVQQHPELVQQYLGSVVPYTD 177

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           NF+A+LN+AVF+DG+F YIP GV+CPMELSTYFRIN K TGQFERTLIIAD+ +YVSYLE
Sbjct: 178 NFFASLNAAVFSDGTFCYIPPGVKCPMELSTYFRINAKNTGQFERTLIIADKDAYVSYLE 237

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP RDENQLHAAVVEL+AL+ A IKY+TVQNWYPGD  GKGGIYNFVTKRGDCRG R
Sbjct: 238 GCTAPMRDENQLHAAVVELIALEGARIKYATVQNWYPGDKDGKGGIYNFVTKRGDCRGDR 297

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           S ISWTQ+ETGSAITWKYPS +LRG  + GEFYS+A++N  QQ D+GTKM+H+ ++T S 
Sbjct: 298 SHISWTQVETGSAITWKYPSVILRGNGAIGEFYSVALTNHHQQADTGTKMIHIGRDTKST 357

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           ++SKGISAG   NTYRG + V  GA ++RN+TQCDSLL+GN CGAHT PYIE KN S  +
Sbjct: 358 VLSKGISAGHGQNTYRGLIKVLAGAENARNYTQCDSLLLGNQCGAHTFPYIEVKNPSAKV 417

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEA+TS+I ++ LFYC QRGI  E A+++IV+GF + V Q+LPMEFAVEAQKL+ +SLE
Sbjct: 418 EHEASTSRIGEDQLFYCTQRGISPEDAVSMIVSGFCKVVFQELPMEFAVEAQKLLGVSLE 477

Query: 486 GSVG 489
           GS G
Sbjct: 478 GSTG 481


>gi|319786705|ref|YP_004146180.1| FeS assembly protein SufB [Pseudoxanthomonas suwonensis 11-1]
 gi|317465217|gb|ADV26949.1| FeS assembly protein SufB [Pseudoxanthomonas suwonensis 11-1]
          Length = 491

 Score =  551 bits (1421), Expect = e-155,   Method: Composition-based stats.
 Identities = 320/487 (65%), Positives = 392/487 (80%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T+I+ D  P GL+ED+IR +SAKK EP+WM +WRL AY
Sbjct: 12  ATPQNAEILERLGR-RYDAGFVTDIESDSLPPGLDEDVIRALSAKKEEPEWMTQWRLDAY 70

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           RRWL M  P WA+++   IDF  + YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 71  RRWLGMPVPHWAKLQIAPIDFQSISYYSAPKG-PKYNSLDEVPKELLDTYDKLGVPLHER 129

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF++EL + G+IF  +SEAI EHP+LV+KYL +VVP
Sbjct: 130 AKLAG-----VAVDAVFDSVSVGTTFRKELAEKGIIFCSMSEAIREHPELVQKYLGSVVP 184

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+A+EG+YVS
Sbjct: 185 HGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVAEEGAYVS 244

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CR
Sbjct: 245 YLEGCTAPMRDENQLHAAVVELVVLDDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECR 304

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T
Sbjct: 305 GARSKVTWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQADTGTKMIHVGKRT 364

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V RGA  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 365 KSKIVSKGISAGRGQNTYRGLVKVDRGAEGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 424

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS++ LFYC  RGI EE A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 425 ATVEHEATTSKISEDQLFYCRSRGISEEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 484

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 485 SLEGSVG 491


>gi|170078420|ref|YP_001735058.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. PCC 7002]
 gi|34765743|gb|AAQ82447.1| SufB [Synechococcus sp. PCC 7002]
 gi|169886089|gb|ACA99802.1| FeS assembly protein SufB [Synechococcus sp. PCC 7002]
          Length = 479

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 315/490 (64%), Positives = 391/490 (79%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ +K P+GL+ED++R ISAKKNEPD+MLE+RL 
Sbjct: 1   MSAT------VKTLVNQPYKYGFVTDIETEKIPRGLSEDVVRLISAKKNEPDFMLEFRLK 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGP-QSLDDVDPELLRTYEKLGIPI 119
           AY +WL M +P WA ++YP ID+ D+ YYAAPK      +SLD++DP LL T+EKLGIP+
Sbjct: 55  AYHQWLKMAEPEWAHVKYPPIDYQDIVYYAAPKKETKKIESLDEIDPALLETFEKLGIPL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDAVFDSVS+ TTFK++L K GVIF  ISEA+ E+PDLVKKYL T
Sbjct: 115 SEQKRLS-----NVAVDAVFDSVSIATTFKKDLAKHGVIFCSISEALQEYPDLVKKYLGT 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++AALNSAVF+DGSFV+IPKGV+CPMELSTYFRIN+  TGQFERTLIIA+EG+
Sbjct: 170 VVPTSDNYFAALNSAVFSDGSFVFIPKGVKCPMELSTYFRINDGETGQFERTLIIAEEGA 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNW+ GD +GKGGIYNFVTKRG
Sbjct: 230 SVSYLEGCTAPMFDTNQLHAAVVELVALDNADIKYSTVQNWFAGDEEGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 290 LCKGINSKISWTQVETGSAITWKYPSCVLLGDNSVGEFYSIALTNNHQQADTGTKMIHIG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KN+ S I+SKGISAG S N+YRG V +H  A  +RN++QCDS+LIG+   A+T PYI+  
Sbjct: 350 KNSRSTIISKGISAGKSKNSYRGLVKMHPKADGARNYSQCDSMLIGDTAEANTFPYIQVD 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEA+T+KI +E LFY  QRGI EE AI+++V+GF ++VL +LPMEFA EA KL
Sbjct: 410 NQNAKVEHEASTAKIGEEQLFYFAQRGIAEEDAISMLVSGFCKDVLSELPMEFAAEADKL 469

Query: 480 IDISLEGSVG 489
           + + LEG+VG
Sbjct: 470 LSLKLEGTVG 479


>gi|282900435|ref|ZP_06308385.1| FeS assembly protein SufB [Cylindrospermopsis raciborskii CS-505]
 gi|281194748|gb|EFA69695.1| FeS assembly protein SufB [Cylindrospermopsis raciborskii CS-505]
          Length = 479

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 311/480 (64%), Positives = 387/480 (80%), Gaps = 6/480 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ I    YKYGF T+I+ D  P+GLNE++IR ISAKK EP++MLE+RL AYR+WL M +
Sbjct: 5   VKTIVNQPYKYGFVTDIETDTIPRGLNEEVIRLISAKKQEPEFMLEFRLRAYRQWLKMTE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGP-QSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           P WA + YP I++ D+ YY+APK       SL++VDP LL T+EKLGI + EQ+ LA   
Sbjct: 65  PIWAHVNYPPINYQDIVYYSAPKQKKAKLNSLEEVDPTLLETFEKLGISLSEQKRLA--- 121

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDA+FDSVSV TTFKE+L + GVIF  ISEA+ EHP+LVKKYL +VVP+ DN++A
Sbjct: 122 --NVAVDAIFDSVSVATTFKEKLAEDGVIFCSISEALREHPELVKKYLGSVVPIADNYFA 179

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+E SYVSYLEGCTA
Sbjct: 180 ALNSAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEESSYVSYLEGCTA 239

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG C+G+ SKIS
Sbjct: 240 PMYDSNQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKIS 299

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SK
Sbjct: 300 WTQVETGSAITWKYPSCVLVGDNSIGEFYSVALTNNRQQADTGTKMIHIGKNTRSTIISK 359

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S+N+YRG V ++  A  +RN++QCDS+LIG+N  A+T PYI+ +N++  +EHEA
Sbjct: 360 GISAGKSSNSYRGLVKINPSAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEA 419

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ LF+  QRGI  E A++++++GF ++V  +LPMEFAVEA KL+ + LEGSVG
Sbjct: 420 STSKIGEDQLFFFAQRGISAEDAVSMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG 479


>gi|188990791|ref|YP_001902801.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           campestris pv. campestris str. B100]
 gi|167732551|emb|CAP50745.1| ABC transporter-associated protein involved in Fe-S cluster
           assembly [Xanthomonas campestris pv. campestris]
          Length = 485

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 316/480 (65%), Positives = 384/480 (80%), Gaps = 6/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           ++ +    +Y  GF T I+ D  P GL+EDIIR +SAKK EP WM +WRL AYR WL M 
Sbjct: 12  QILERLGRRYDAGFITEIESDSLPPGLDEDIIRALSAKKEEPQWMTDWRLEAYRHWLKMP 71

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA+++   IDF  L YY+APK      SLDDV  ELL TY+KLG+P+ E+  LAG  
Sbjct: 72  MPEWAKLKIAPIDFQALSYYSAPKG-PKYASLDDVPKELLDTYDKLGVPLHERARLAG-- 128

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK++L +VVPVGDN++A
Sbjct: 129 ---VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQHLGSVVPVGDNYFA 185

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVSYLEGCTA
Sbjct: 186 ALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVSYLEGCTA 245

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CRG RSK++
Sbjct: 246 PMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECRGDRSKVT 305

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T S+IVSK
Sbjct: 306 WTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRTKSKIVSK 365

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN    +EHEA
Sbjct: 366 GISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPGATVEHEA 425

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++SLEGSVG
Sbjct: 426 TTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEVSLEGSVG 485


>gi|317474557|ref|ZP_07933831.1| FeS assembly protein SufB [Bacteroides eggerthii 1_2_48FAA]
 gi|316909238|gb|EFV30918.1| FeS assembly protein SufB [Bacteroides eggerthii 1_2_48FAA]
          Length = 484

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 319/486 (65%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  D   +GLNED++R IS KK EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTDIIERGLNEDVVRLISRKKEEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKDGPKSMDEVDPELVKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVQKYLGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGHCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 INSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGRSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 IVEHEATTSKISEDQIFYCNQRGISTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|329964515|ref|ZP_08301569.1| FeS assembly protein SufB [Bacteroides fluxus YIT 12057]
 gi|328524915|gb|EGF51967.1| FeS assembly protein SufB [Bacteroides fluxus YIT 12057]
          Length = 503

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 320/480 (66%), Positives = 393/480 (81%), Gaps = 6/480 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           VRKI  ++YKYGF T++  D   +GLNE+++R IS KK EP+W+LE+RL AYR WLT++ 
Sbjct: 29  VRKIAEEKYKYGFTTDVHTDIIERGLNEEVVRLISEKKGEPEWLLEFRLKAYRHWLTLEM 88

Query: 71  PSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ  L+G  
Sbjct: 89  PTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELVKTFNKLGIPLEEQMALSG-- 146

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VVP  DNF+A
Sbjct: 147 ---MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVQKYLGSVVPYRDNFFA 203

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSYLEGCTA
Sbjct: 204 ALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSYLEGCTA 263

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG C+G+ SK+S
Sbjct: 264 PMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGHCKGVGSKLS 323

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT S IVSK
Sbjct: 324 WTQVETGSAITWKYPSCILSGDDSTAEFYSVAVTNNYQQADTGTKMIHLGKNTRSTIVSK 383

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N +  +EHEA
Sbjct: 384 GISAGRSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETAIVEHEA 443

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ ISLEGSVG
Sbjct: 444 TTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAISLEGSVG 503


>gi|313147914|ref|ZP_07810107.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           fragilis 3_1_12]
 gi|313136681|gb|EFR54041.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           fragilis 3_1_12]
          Length = 484

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 323/486 (66%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T +  D   KGLNED++R IS+KKNEPDW+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTEVHTDIIEKGLNEDVVRLISSKKNEPDWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKYL +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYLGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGKSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 VVEHEATTSKISEDQIFYCNQRGISTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLTIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|85710906|ref|ZP_01041967.1| Cysteine desulfurase activator SufB [Idiomarina baltica OS145]
 gi|85695310|gb|EAQ33247.1| Cysteine desulfurase activator SufB [Idiomarina baltica OS145]
          Length = 478

 Score =  551 bits (1420), Expect = e-155,   Method: Composition-based stats.
 Identities = 340/482 (70%), Positives = 404/482 (83%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y  GF + I+ +  PKGL+ED+IR +SA K EP+WMLEWRL AYR WL  
Sbjct: 3   EQIDQALARKYDAGFVSEIESETFPKGLDEDVIRRLSAIKGEPEWMLEWRLKAYRTWLKQ 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
            +P WA + YP ID+ D+ YY+APKS    P+SLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 63  TEPEWAHVDYPKIDYQDISYYSAPKSMKDKPKSLDEVDPELLRTYEKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+E+L+++GVIF PISEA+ ++PDLVKKYL TVVP GDN+
Sbjct: 123 -----VAVDAVFDSVSVVTTFREKLEEAGVIFCPISEALHKYPDLVKKYLGTVVPRGDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLI+A+EGSYVSYLEGC
Sbjct: 178 FAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTLIVAEEGSYVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFVTKRGLC-EKNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+HL KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCILKGDNSVGEFYSVALTRGKQQADTGTKMIHLGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG+SNN YRG V +  GA  +RNFT+CDSLLIG+ CGAHT PYIES N S  +EH
Sbjct: 357 SKGISAGYSNNAYRGLVRMGPGAEGARNFTECDSLLIGDKCGAHTFPYIESSNPSAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SD+ LF C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDDQLFLCQQRGLDPEKAVSMIVNGFCKEVFRELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|325915079|ref|ZP_08177407.1| Iron-regulated ABC transporter membrane component SufB [Xanthomonas
           vesicatoria ATCC 35937]
 gi|325538691|gb|EGD10359.1| Iron-regulated ABC transporter membrane component SufB [Xanthomonas
           vesicatoria ATCC 35937]
          Length = 485

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 316/487 (64%), Positives = 387/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T I+ D  P GL+ED IR +SAKK+EP WM +WRL AY
Sbjct: 6   APPQNAEIIERLGR-RYDAGFITEIESDSLPPGLDEDTIRALSAKKDEPQWMTDWRLEAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA+++   IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLKMPMPEWAKLKIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK+YL +VVP
Sbjct: 124 ARLAG-----VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVS
Sbjct: 179 VGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T
Sbjct: 299 GDRSKVTWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 359 KSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|21232197|ref|NP_638114.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66767674|ref|YP_242436.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|21113953|gb|AAM42038.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. ATCC 33913]
 gi|66573006|gb|AAY48416.1| ABC transporter permease [Xanthomonas campestris pv. campestris
           str. 8004]
          Length = 485

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 317/480 (66%), Positives = 384/480 (80%), Gaps = 6/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           ++ +    +Y  GF T I+ D  P GL+EDIIR +SAKK EP WM +WRL AYR WL M 
Sbjct: 12  QILERLGRRYDAGFITEIESDSLPPGLDEDIIRALSAKKEEPQWMTDWRLEAYRHWLKMP 71

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA+++   IDF  L YY+APK      SLDDV  ELL TY+KLG+P+ E+  LAG  
Sbjct: 72  MPEWAKLKIAPIDFQALSYYSAPKG-PKYASLDDVPKELLDTYDKLGVPLHERARLAG-- 128

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK+YL +VVPVGDN++A
Sbjct: 129 ---VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVPVGDNYFA 185

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVSYLEGCTA
Sbjct: 186 ALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVSYLEGCTA 245

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CRG RSK++
Sbjct: 246 PMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECRGDRSKVT 305

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T S+IVSK
Sbjct: 306 WTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRTKSKIVSK 365

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN    +EHEA
Sbjct: 366 GISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPGATVEHEA 425

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++SLEGSVG
Sbjct: 426 TTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEVSLEGSVG 485


>gi|114764571|ref|ZP_01443775.1| FeS assembly protein SufB [Pelagibaca bermudensis HTCC2601]
 gi|114542947|gb|EAU45967.1| FeS assembly protein SufB [Roseovarius sp. HTCC2601]
          Length = 510

 Score =  551 bits (1420), Expect = e-154,   Method: Composition-based stats.
 Identities = 347/499 (69%), Positives = 410/499 (82%), Gaps = 15/499 (3%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
            +ETVD V  +    YKYG+ET I+++ AP GL+EDI+R IS+K  EP+WM EWRL AYR
Sbjct: 14  EKETVDAVEAV--STYKYGWETEIEMEYAPMGLDEDIVRLISSKNGEPEWMTEWRLEAYR 71

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
           RWLT K+P WA + YP IDF   YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ
Sbjct: 72  RWLTKKEPDWAMVEYPEIDFQKQYYYARPKSMETKPKSLDEVDPKLLATYEKLGIPLKEQ 131

Query: 123 EILAGVQT------------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
            +LAGV+              KVAVDAVFDSVSV TTF++EL+K+GVIF  ISEAI +HP
Sbjct: 132 MVLAGVEGAEDAPADANAPERKVAVDAVFDSVSVGTTFQKELEKAGVIFCSISEAIEKHP 191

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LVKKYL +VVPV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFER
Sbjct: 192 ELVKKYLGSVVPVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFER 251

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLIIAD+GSYVSYLEGCTAP+RD  QLHAAVVE++  ++AE+KYSTVQNW+PGD +GKGG
Sbjct: 252 TLIIADKGSYVSYLEGCTAPKRDTAQLHAAVVEIIVEEDAEVKYSTVQNWFPGDEEGKGG 311

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKR DCRG R+KI WTQ+ETGSA+TWKYPSC+LRG +S GEFYSIAI+N  QQ D
Sbjct: 312 IYNFVTKRADCRGDRAKIMWTQVETGSAVTWKYPSCILRGNESQGEFYSIAIANNHQQAD 371

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           +GTKM+HL K+T SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGA
Sbjct: 372 TGTKMIHLGKDTKSRIVSKGISAGVAQNTYRGLVSMHPKAKNSRNYTQCDSLLIGDKCGA 431

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT+PYIE KN+S   EHEATTSK+ D+ LFYC QRG+ EE A+AL+VNGF +EVLQ LPM
Sbjct: 432 HTVPYIEVKNNSSRCEHEATTSKVDDDQLFYCRQRGMDEEEAVALVVNGFCKEVLQALPM 491

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFA+EAQ L+ ISLEGSVG
Sbjct: 492 EFAMEAQALVAISLEGSVG 510


>gi|310815932|ref|YP_003963896.1| FeS assembly protein SufB [Ketogulonicigenium vulgare Y25]
 gi|308754667|gb|ADO42596.1| FeS assembly protein SufB [Ketogulonicigenium vulgare Y25]
          Length = 501

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 342/488 (70%), Positives = 406/488 (83%), Gaps = 6/488 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           TV  V+++    YK+G+ET+I+ D APKGLNEDI+R IS    EP WML+WRL A+ RW 
Sbjct: 15  TVAAVQQL-SGTYKHGWETDIETDYAPKGLNEDIVRLISDNNGEPQWMLDWRLQAFARWQ 73

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQEIL 125
            ++ P+W  +  P IDF D YYYA PKS+   P+SLD+VDP+LL TYEKLGIP++EQ +L
Sbjct: 74  KLESPTWPMLTLPVIDFQDQYYYARPKSMAVKPKSLDEVDPKLLATYEKLGIPLKEQMLL 133

Query: 126 AGVQT----SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           AGV+      KVA+DAVFDSVSV TTFK+EL K+GVIF  ISEAI EHP+LVKKYL TVV
Sbjct: 134 AGVEGAAEERKVAMDAVFDSVSVGTTFKDELAKAGVIFCSISEAIREHPELVKKYLGTVV 193

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
           PV DNFYA LNSAVF+DGSFVY+P GVRCPMELSTYFRIN + TGQFERTLIIAD+GSYV
Sbjct: 194 PVSDNFYATLNSAVFSDGSFVYVPPGVRCPMELSTYFRINAENTGQFERTLIIADKGSYV 253

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAPQRD  QLHAAVVE++  ++AE+KYSTVQNWYPGD++GKGGIYNFVTKR DC
Sbjct: 254 SYLEGCTAPQRDIAQLHAAVVEIIVEEDAEVKYSTVQNWYPGDAEGKGGIYNFVTKRADC 313

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           RG R+K+ WTQ+ETGSAITWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM+HL KN
Sbjct: 314 RGDRAKVMWTQVETGSAITWKYPSCILRGDDSQGEFYSIAIANNAQQADTGTKMIHLGKN 373

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T SRIVSKGISAG + NTYRG VS+H  A +SRN+TQCDSLLIG+ CGAHT+PYIE +N+
Sbjct: 374 TKSRIVSKGISAGRAQNTYRGLVSMHPKAQNSRNYTQCDSLLIGDQCGAHTVPYIEVRNN 433

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           S  +EHEATTSK+ D+ +FYC  RG+ EE A+A+IVNGFV++VLQ LPMEFA+EAQ L+ 
Sbjct: 434 SSRVEHEATTSKVDDDQMFYCRSRGMDEEQAVAVIVNGFVKDVLQALPMEFAMEAQALVA 493

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 494 ISLEGSVG 501


>gi|92113359|ref|YP_573287.1| cysteine desulfurase activator complex subunit SufB
           [Chromohalobacter salexigens DSM 3043]
 gi|91796449|gb|ABE58588.1| Iron-regulated ABC transporter membrane component SufB
           [Chromohalobacter salexigens DSM 3043]
          Length = 480

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 325/482 (67%), Positives = 390/482 (80%), Gaps = 6/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
            ++ ++   +Y  GF T+I+ D  P GL+ED I FIS KK EP+WMLEWRL AY +WL M
Sbjct: 4   QEMEQLVRREYTQGFVTDIESDTVPPGLDEDTIAFISNKKGEPEWMLEWRLDAYHQWLKM 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K+PSWA + YP ID+  + YY+APK     PQSLD+VDP+LL TYEKLGIP+ E+  LAG
Sbjct: 64  KEPSWAHLDYPPIDYQAISYYSAPKKPEDRPQSLDEVDPKLLETYEKLGIPLHERAALAG 123

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSV TTFKE+L ++GVIF  ISEAI ++P+LV++YL +VVP GDN+
Sbjct: 124 -----VAVDAVFDSVSVTTTFKEKLAEAGVIFCSISEAIRDYPELVRQYLGSVVPKGDNY 178

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFVY+P+GV CPMELSTYFRIN   TGQFERTLI+ D+ + VSYLEGC
Sbjct: 179 FAALNSAVFTDGSFVYVPEGVECPMELSTYFRINAANTGQFERTLIVCDKQAQVSYLEGC 238

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVAL++A IKYSTVQNWYPGD  GKGGIYNFVTKRGDCRG RSK
Sbjct: 239 TAPQRDENQLHAAVVELVALEDAYIKYSTVQNWYPGDEDGKGGIYNFVTKRGDCRGDRSK 298

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++NG QQ D+GTKM+H+ + T S IV
Sbjct: 299 ISWTQVETGSAITWKYPSCVLRGKDSVGEFYSVAVTNGRQQADTGTKMIHVGEGTRSTIV 358

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGI+AG S+  YRG V V   A  +RNFTQCDSLLIG+ CGAHT PY E  NSS  +EH
Sbjct: 359 SKGIAAGNSDQAYRGLVKVGPRAKGARNFTQCDSLLIGDRCGAHTFPYQEIGNSSATVEH 418

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKI ++ LFYC  RGI EE A+ +IVNGF ++V Q+LPMEFAVEA+ L++++LEG+
Sbjct: 419 EATTSKIGEDQLFYCQARGISEEDAVNMIVNGFCKDVFQELPMEFAVEAEALLNVTLEGA 478

Query: 488 VG 489
           VG
Sbjct: 479 VG 480


>gi|329954146|ref|ZP_08295241.1| FeS assembly protein SufB [Bacteroides clarus YIT 12056]
 gi|328528123|gb|EGF55103.1| FeS assembly protein SufB [Bacteroides clarus YIT 12056]
          Length = 484

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 318/486 (65%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  D   +GLNED++R IS KK EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTDIIERGLNEDVVRLISEKKEEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKDGPKSMDEVDPELVKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVQKYLGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGHCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 INSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGRSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 IVEHEATTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|313158041|gb|EFR57447.1| FeS assembly protein SufB [Alistipes sp. HGB5]
          Length = 488

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 326/489 (66%), Positives = 392/489 (80%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    +  D +  I   +YKYGF ++I+ +   KGL+ED++R ISAKK EP WM E R+ 
Sbjct: 8   MA--EKDKDILENIGEQEYKYGFTSDIETETIGKGLSEDVVRLISAKKGEPAWMTERRVA 65

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WLTM  P+WA +  P IDF D+ YYAAPK      S+D+VDPEL RT++KLGIP+ 
Sbjct: 66  AYRHWLTMGPPTWAHLTIPEIDFQDIIYYAAPKQQKKLDSMDEVDPELKRTFDKLGIPLE 125

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ  LAG     VAVDAV DSVSV TTFKE L + G+IF  ISEA+ ++PDLVKKYL +V
Sbjct: 126 EQMALAG-----VAVDAVMDSVSVKTTFKEVLAEKGIIFCSISEALRDYPDLVKKYLGSV 180

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALN+AVF+DGSF YIPKGVRCPMELSTYFRIN  GTGQFERTLI+ADEG+Y
Sbjct: 181 VPYTDNFYAALNAAVFSDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTLIVADEGAY 240

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+RDENQLHAAVVE++   +AE+KYSTVQNWYPGD +G+GGIYNFVTKRG 
Sbjct: 241 VSYLEGCTAPRRDENQLHAAVVEIIVEKDAEVKYSTVQNWYPGDREGRGGIYNFVTKRGI 300

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CR   +++SWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N FQQ D+GTKM+H+ +
Sbjct: 301 CR-ENARLSWTQVETGSAITWKYPSCILAGDNSVGEFYSVAMTNNFQQADTGTKMIHIGR 359

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRIVSKGISAG S N+YRG V + +GA ++RN++QCDSLLIG+ CGAHT P I+S+N
Sbjct: 360 NTRSRIVSKGISAGRSENSYRGLVRMAKGAENARNYSQCDSLLIGDKCGAHTFPVIDSRN 419

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKISD+ LFYC QRG+  E A+ LIVNG+ REVL KLPMEFAVEAQKL+
Sbjct: 420 RTAVVEHEATTSKISDDQLFYCNQRGLSTEDAVGLIVNGYAREVLAKLPMEFAVEAQKLL 479

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 480 SISLEGSVG 488


>gi|261855792|ref|YP_003263075.1| FeS assembly protein SufB [Halothiobacillus neapolitanus c2]
 gi|261836261|gb|ACX96028.1| FeS assembly protein SufB [Halothiobacillus neapolitanus c2]
          Length = 499

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 346/498 (69%), Positives = 401/498 (80%), Gaps = 13/498 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +E    +  +   +YKYGF T+I+ D  P GLNED+IR ISAKKNEP+++LEWRL 
Sbjct: 6   MTEQQE----IESLMQREYKYGFTTDIEQDIIPPGLNEDVIRLISAKKNEPEFLLEWRLK 61

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV--------GPQSLDDVDPELLRTY 112
           AYR WLTM  P+WA + YP ID+  L YYAAPKS           PQSLDDVDP+LL TY
Sbjct: 62  AYRHWLTMTPPTWAHVHYPPIDYQALSYYAAPKSAAELAEIEASKPQSLDDVDPKLLETY 121

Query: 113 EKLGIPIREQEILAGV-QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPD 171
           EKLGIP+ E+ ILAGV Q S VAVDAVFDSVSV TTFK +L ++GVIF   SEA+  HPD
Sbjct: 122 EKLGIPLHERAILAGVAQPSNVAVDAVFDSVSVTTTFKAKLAEAGVIFCSFSEAVHNHPD 181

Query: 172 LVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERT 231
           L+KKYL TVVP GDN+YAALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN K TGQFERT
Sbjct: 182 LIKKYLGTVVPAGDNYYAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAKNTGQFERT 241

Query: 232 LIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGI 291
           LI+A+EG++VSYLEGCTAPQRDENQLHAAVVELVALD+A IKYSTVQNWYPGD QGKGGI
Sbjct: 242 LIVAEEGAHVSYLEGCTAPQRDENQLHAAVVELVALDDATIKYSTVQNWYPGDEQGKGGI 301

Query: 292 YNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDS 351
           YNFVTKRGD RG RSKI+WTQ+E GSAITWKYPSC+LRG+ S GEFYS+A+SN +QQ+DS
Sbjct: 302 YNFVTKRGDARGNRSKITWTQVEAGSAITWKYPSCILRGDDSVGEFYSVAVSNNYQQVDS 361

Query: 352 GTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAH 411
           GTKM+HL K T S IVSK ISAG S N YRG V + + A  +RN+TQCD+LLIG+  GAH
Sbjct: 362 GTKMIHLGKRTRSTIVSKSISAGRSQNAYRGLVHIAKSADDARNYTQCDALLIGDRNGAH 421

Query: 412 TIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPME 471
           T PYIE+KN++  +EHEATTSKISD+ +FY   RGI EE A  +IVNGF +EV  +LPME
Sbjct: 422 TFPYIEAKNATAQIEHEATTSKISDDQIFYLQSRGISEENATNMIVNGFCKEVFNELPME 481

Query: 472 FAVEAQKLIDISLEGSVG 489
           FAVEAQ L+ +SLEGSVG
Sbjct: 482 FAVEAQALLAVSLEGSVG 499


>gi|167764126|ref|ZP_02436253.1| hypothetical protein BACSTE_02509 [Bacteroides stercoris ATCC
           43183]
 gi|167698242|gb|EDS14821.1| hypothetical protein BACSTE_02509 [Bacteroides stercoris ATCC
           43183]
          Length = 484

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 318/486 (65%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  D   +GLNED++R IS KK EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTDIIERGLNEDVVRLISEKKGEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPAWAHLRIPEIDYQAISYYADPTKKKDGPKSMDEVDPELVKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVQKYLGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGHCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 VNSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGRSENSYRGLVRVAQKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 IVEHEATTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|332709643|ref|ZP_08429602.1| Iron-regulated ABC transporter membrane component SufB [Lyngbya
           majuscula 3L]
 gi|332351470|gb|EGJ31051.1| Iron-regulated ABC transporter membrane component SufB [Lyngbya
           majuscula 3L]
          Length = 479

 Score =  551 bits (1419), Expect = e-154,   Method: Composition-based stats.
 Identities = 310/481 (64%), Positives = 384/481 (79%), Gaps = 6/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V+ +    YKYGF T+I+ D  P+GLNEDIIR ISAKKNEP++MLE+RL AYR+W  M 
Sbjct: 4   TVKTLVNQPYKYGFVTDIEADTIPRGLNEDIIRLISAKKNEPEFMLEFRLKAYRQWQKMT 63

Query: 70  DPSWARIRYPAIDFDDLYYYAAPK-SIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           +P+W  + YP ID+  + YY+APK +     SLD+VDP LL T++KLGI + EQ+ LA  
Sbjct: 64  EPTWPHVTYPPIDYQKIIYYSAPKQTKEKLNSLDEVDPALLETFDKLGISLSEQKRLA-- 121

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDA+FDSVS+ TTFKE+L +SGVIF  ISEA+ EHP+LV+KYL +VVPV DN++
Sbjct: 122 ---NVAVDAIFDSVSIATTFKEKLAESGVIFCSISEALQEHPELVRKYLGSVVPVADNYF 178

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+EGS VSYLEGCT
Sbjct: 179 AALNSAVFSDGSFVYIPKGVKCPMELSTYFRINNGDTGQFERTLIVAEEGSNVSYLEGCT 238

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D NQLHAAVVELVALDNAEIKYSTVQNW+ GD  GKGGIYNFVTKRG C+G+ SKI
Sbjct: 239 APMYDSNQLHAAVVELVALDNAEIKYSTVQNWFAGDKNGKGGIYNFVTKRGLCKGVNSKI 298

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+S
Sbjct: 299 SWTQVETGSAITWKYPSCVLVGDNSIGEFYSVALTNNLQQADTGTKMVHIGKNTRSTIIS 358

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI+ +N+   +EHE
Sbjct: 359 KGISAGKSKNSYRGLVKIGPKAKGARNYSQCDSMLIGDTAEANTFPYIQVQNNMGKVEHE 418

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LF+  QRGI EE AI+++V+GF ++V  +LPMEFA EA KL+ + LEG+V
Sbjct: 419 ASTSKIGEDQLFFFAQRGISEEDAISMMVSGFCKDVFNELPMEFAAEADKLLSLKLEGTV 478

Query: 489 G 489
           G
Sbjct: 479 G 479


>gi|218131827|ref|ZP_03460631.1| hypothetical protein BACEGG_03448 [Bacteroides eggerthii DSM 20697]
 gi|217986130|gb|EEC52469.1| hypothetical protein BACEGG_03448 [Bacteroides eggerthii DSM 20697]
          Length = 484

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 318/486 (65%), Positives = 392/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T++  D   +GLNED++R IS KK EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTDVHTDIIERGLNEDVVRLISRKKEEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKDGPKSMDEVDPELVKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EH DLV+KYL +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHSDLVQKYLGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGHCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 INSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGRSENSYRGLVRVAQRADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGI  E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 IVEHEATTSKISEDQIFYCNQRGISTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|284050865|ref|ZP_06381075.1| cysteine desulfurase activator complex subunit SufB [Arthrospira
           platensis str. Paraca]
 gi|291567132|dbj|BAI89404.1| FeS assembly protein SufB [Arthrospira platensis NIES-39]
          Length = 478

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 299/479 (62%), Positives = 382/479 (79%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +    YKYGF T+I+ D  PKGL+ED++R IS+KKNEP++ML +RL AY++W  M +
Sbjct: 5   VKTLVNQPYKYGFVTDIESDTIPKGLSEDVVRLISSKKNEPEFMLNFRLRAYQQWQKMAE 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P+W  + YP ID+ ++ YY+APK      SL++VDP L+ T+EKLGIP+ EQ+ LA    
Sbjct: 65  PTWPHVHYPPIDYQNIIYYSAPKVEKKKGSLEEVDPTLIETFEKLGIPLSEQKRLA---- 120

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVS+ TTFKE+L + GVIF  ISEA+  HP+L++KYL +VVPVGDN++AA
Sbjct: 121 -NVAVDAVFDSVSIATTFKEKLAEEGVIFCSISEAVESHPELIEKYLGSVVPVGDNYFAA 179

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV+CPM+LSTYFRIN   +GQFERTLI+A+ GS V+YLEGCTAP
Sbjct: 180 LNSAVFSDGSFVYIPKGVKCPMDLSTYFRINNGESGQFERTLIVAESGSSVTYLEGCTAP 239

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D NQLHAAVVELVALDNA I+YSTVQNW+ GD  GKGGIYNFVTKRG C+G+ SKISW
Sbjct: 240 MFDTNQLHAAVVELVALDNATIEYSTVQNWFAGDEDGKGGIYNFVTKRGLCKGVNSKISW 299

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SKG
Sbjct: 300 TQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNNCQQADTGTKMVHIGKNTRSTIISKG 359

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI+ +N++  +EHEA+
Sbjct: 360 ISAGRSANSYRGLVKMGPKAIGARNYSQCDSMLIGDCGQANTFPYIQVENNTAKVEHEAS 419

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFY  QRGI EE A+++I++GF ++V  KLPMEFA EA KL+ + LEG+VG
Sbjct: 420 TSKIGEDQLFYFTQRGIAEEDAVSMIISGFCKDVFNKLPMEFAAEADKLLSLKLEGAVG 478


>gi|150003924|ref|YP_001298668.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           vulgatus ATCC 8482]
 gi|212692750|ref|ZP_03300878.1| hypothetical protein BACDOR_02248 [Bacteroides dorei DSM 17855]
 gi|237709446|ref|ZP_04539927.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 9_1_42FAA]
 gi|237724954|ref|ZP_04555435.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. D4]
 gi|254880835|ref|ZP_05253545.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 4_3_47FAA]
 gi|265754645|ref|ZP_06089697.1| FeS assembly protein SufB [Bacteroides sp. 3_1_33FAA]
 gi|294775080|ref|ZP_06740609.1| FeS assembly protein SufB [Bacteroides vulgatus PC510]
 gi|319639845|ref|ZP_07994574.1| ABC transporter permease [Bacteroides sp. 3_1_40A]
 gi|149932348|gb|ABR39046.1| ABC transporter permease [Bacteroides vulgatus ATCC 8482]
 gi|212664686|gb|EEB25258.1| hypothetical protein BACDOR_02248 [Bacteroides dorei DSM 17855]
 gi|229436692|gb|EEO46769.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           dorei 5_1_36/D4]
 gi|229456502|gb|EEO62223.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 9_1_42FAA]
 gi|254833628|gb|EET13937.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 4_3_47FAA]
 gi|263234759|gb|EEZ20327.1| FeS assembly protein SufB [Bacteroides sp. 3_1_33FAA]
 gi|294451124|gb|EFG19595.1| FeS assembly protein SufB [Bacteroides vulgatus PC510]
 gi|317388509|gb|EFV69359.1| ABC transporter permease [Bacteroides sp. 3_1_40A]
          Length = 483

 Score =  550 bits (1418), Expect = e-154,   Method: Composition-based stats.
 Identities = 324/486 (66%), Positives = 393/486 (80%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T +  D   +GLNED+IR ISAKKNEP+W+LE+RL AYR 
Sbjct: 3   EEPNKYVKELTQEKYKYGFTTEVHTDIIERGLNEDVIRLISAKKNEPEWLLEFRLKAYRY 62

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLTM+ P+WA +  P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 63  WLTMEMPAWAHLTIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 122

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKYL +VV  
Sbjct: 123 ALSG-----MAVDAVMDSVSVKTTFKETLLEKGIIFCSFSEAVREHPDLVKKYLGSVVGP 177

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYVSY
Sbjct: 178 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDSYVSY 237

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG C+G
Sbjct: 238 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGHCKG 297

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL +NT 
Sbjct: 298 VDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGRNTR 357

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V + A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 358 STIVSKGISAGKSQNSYRGLVRVAQKADNARNYSQCDSLLLGSQCGAHTFPYMDIHNETA 417

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ LFYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 418 VVEHEATTSKISEDQLFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLAIS 477

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 478 LEGSVG 483


>gi|325281866|ref|YP_004254408.1| FeS assembly protein SufB [Odoribacter splanchnicus DSM 20712]
 gi|324313675|gb|ADY34228.1| FeS assembly protein SufB [Odoribacter splanchnicus DSM 20712]
          Length = 477

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 314/481 (65%), Positives = 387/481 (80%), Gaps = 6/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + ++   +YKYGF TN++ D   KGLNE++IR ISAKK EPDWMLE+RL AYR WLTM
Sbjct: 3   NIIEEVTGSEYKYGFVTNVETDTIGKGLNEEVIRIISAKKEEPDWMLEFRLKAYRHWLTM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K P WA++  P I++ D+ YYAAPK     +S ++VDPEL  T++KLGIP+ EQ  L+G 
Sbjct: 63  KMPRWAQLDIPEINYQDIVYYAAPKQKET-KSWEEVDPELKATFDKLGIPLSEQMALSG- 120

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAV DSVSV TTFK+ L + GVIF   SEA+  HPDLV+KYL TVVP  DN++
Sbjct: 121 ----VAVDAVMDSVSVKTTFKDTLAERGVIFCSFSEAVKNHPDLVRKYLGTVVPYHDNYF 176

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+A++ +YVSYLEGCT
Sbjct: 177 AALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVAEDEAYVSYLEGCT 236

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           APQRDENQLHAA+VE+V   NAE+KYSTVQNWYPGD  GKGGIYNFVTKRG CRG  +++
Sbjct: 237 APQRDENQLHAAIVEIVVEKNAEVKYSTVQNWYPGDKDGKGGIYNFVTKRGICRGENARL 296

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
            W Q+ETGSAITWKYPS +L+G+ S  EFYS+A++N +QQ D+GTKM+H+  NT SRIVS
Sbjct: 297 IWAQVETGSAITWKYPSTILKGDGSVSEFYSVAVTNNYQQADTGTKMIHIGNNTRSRIVS 356

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAGFS+N+YRGKV V +   ++RN++QCDSLL+G+ CGAHT PY+E +NS+  +EHE
Sbjct: 357 KGISAGFSSNSYRGKVKVVKSCQNARNYSQCDSLLLGDKCGAHTFPYLEIENSTAQVEHE 416

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSKI ++ +FYC QRGI  E A+ LI+ G+  +VL K+PMEFAVEAQKL+ ISLEGSV
Sbjct: 417 ATTSKIGEDQIFYCNQRGISTEDAVGLIIKGYAGDVLNKMPMEFAVEAQKLLQISLEGSV 476

Query: 489 G 489
           G
Sbjct: 477 G 477


>gi|121997340|ref|YP_001002127.1| cysteine desulfurase activator complex subunit SufB [Halorhodospira
           halophila SL1]
 gi|121588745|gb|ABM61325.1| Iron-regulated ABC transporter membrane component SufB
           [Halorhodospira halophila SL1]
          Length = 491

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 325/496 (65%), Positives = 396/496 (79%), Gaps = 12/496 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M +  ET+++        Y+ GF T+I+ + AP GLNE+ IRFIS KK EP+WML+WRL 
Sbjct: 1   MASSNETIER---FTSRGYEAGFFTDIEQEFAPPGLNEETIRFISEKKGEPEWMLQWRLE 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WL M  P W  +++P IDF  + YYAAPK   GP+SLD+VDP+LL TYEKLGIP+ 
Sbjct: 58  AYRGWLEMAVPEWQNVQFPPIDFQAISYYAAPKE--GPKSLDEVDPKLLETYEKLGIPLH 115

Query: 121 EQEILAGVQ-------TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLV 173
           EQ++LAGVQ          VAVDAVFDSVSV TTFKEEL K GVIF  ISEA+ E+P+LV
Sbjct: 116 EQKMLAGVQEAEEGTERPNVAVDAVFDSVSVATTFKEELAKHGVIFCSISEALHEYPELV 175

Query: 174 KKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLI 233
           ++Y+ +VVP  DNF+AALNSAVF+DGSFVYIP+GV CPMELSTYFRIN   TGQFERTLI
Sbjct: 176 RQYIGSVVPRKDNFFAALNSAVFSDGSFVYIPEGVECPMELSTYFRINAGHTGQFERTLI 235

Query: 234 IADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYN 293
           IA++GS VSYLEGCTAPQRDENQLHAAVVEL A D+A+IKYSTVQNWYPGD+ G GG+YN
Sbjct: 236 IAEKGSSVSYLEGCTAPQRDENQLHAAVVELYAHDDAQIKYSTVQNWYPGDANGVGGVYN 295

Query: 294 FVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGT 353
           FVTKRG C G RSKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++ G QQ D+GT
Sbjct: 296 FVTKRGLCAGKRSKISWTQVETGSAITWKYPSCVLKGDDSIGEFYSVAVTRGRQQADTGT 355

Query: 354 KMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTI 413
           KM+H+  NT S I+SKGISA +   +YRG V V   A ++RN++QCDS+L+ ++CGAHT 
Sbjct: 356 KMIHIGNNTRSHIISKGISADYGQQSYRGLVKVLPTAGNARNYSQCDSMLMSSHCGAHTF 415

Query: 414 PYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFA 473
           PYI+ +N +  LEHEATTSKI D+ +FYC QRGI EE A+++IVNGF +EV QKLPMEFA
Sbjct: 416 PYIDIQNPTAQLEHEATTSKIGDDQIFYCKQRGISEEDAVSMIVNGFCKEVFQKLPMEFA 475

Query: 474 VEAQKLIDISLEGSVG 489
           VEAQKL++++LE SVG
Sbjct: 476 VEAQKLLEVTLEDSVG 491


>gi|188994221|ref|YP_001928473.1| cysteine desulfurase activator complex subunit SufB [Porphyromonas
           gingivalis ATCC 33277]
 gi|188593901|dbj|BAG32876.1| ABC transporter membrane protein [Porphyromonas gingivalis ATCC
           33277]
          Length = 481

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 327/486 (67%), Positives = 399/486 (82%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           ++E  + + ++   +YKYGF T+I+ +   +GL+ED +R ISAKK EP+W+LE+RL AYR
Sbjct: 1   MQENNNILDEVTGSEYKYGFVTDIETETIGRGLSEDTVRLISAKKEEPEWLLEFRLNAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WL+MK+P WA +  P ID+ D+ YYAAPK   GP+SLD+VDPELL+T++KLGIP+ EQ+
Sbjct: 61  HWLSMKEPDWAHLNIPPIDYQDIIYYAAPKKKKGPKSLDEVDPELLKTFDKLGIPLEEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
           IL+G     +AVDAV DSVSV TTFKE+L + G+IF   SEA+ + PDLVKKYL TVV  
Sbjct: 121 ILSG-----MAVDAVMDSVSVKTTFKEKLAEKGIIFCSFSEAVKDFPDLVKKYLGTVVSS 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADE SYVSY
Sbjct: 176 KDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADEDSYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAPQRDENQLHAA+VE++A  NAE+KYSTVQNWYPGD +GKGGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPQRDENQLHAAIVEIIAETNAEVKYSTVQNWYPGDKEGKGGIYNFVTKRGVCKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N FQQ D+GTKM+HL KNT 
Sbjct: 296 DNSKISWTQVETGSAITWKYPSCVLRGDNSIAEFYSVAVTNNFQQADTGTKMIHLGKNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N+YRG V + + A ++RN +QCDSLL+ ++CGAHT PY + +N + 
Sbjct: 356 SRIVSKGISAGSSQNSYRGLVKISKNAVNARNHSQCDSLLLSDHCGAHTYPYADVQNDTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS+E +FYC QRGI  E A+ LIVNG+ +EV+ KLPMEFAVEAQKL+ IS
Sbjct: 416 IIEHEATTSKISEEQIFYCNQRGIGTEEAVGLIVNGYAKEVMNKLPMEFAVEAQKLLSIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|289664562|ref|ZP_06486143.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|289671187|ref|ZP_06492262.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 485

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 317/487 (65%), Positives = 388/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T I+ D  P GL+EDIIR +SAKK+EP WM +WRL AY
Sbjct: 6   APPQNAEILERLGR-RYDAGFITEIESDSLPPGLDEDIIRALSAKKDEPQWMTDWRLEAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA+++   I+F  L YY+APK      SLDDV  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLKMPMPEWAKLQISPINFQALSYYSAPKG-PKYASLDDVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK+YL +VVP
Sbjct: 124 AKLAG-----VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVS
Sbjct: 179 VGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDQAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T
Sbjct: 299 GARSKVTWTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 359 KSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|294341075|emb|CAZ89472.1| Protein sufB [Thiomonas sp. 3As]
          Length = 481

 Score =  550 bits (1417), Expect = e-154,   Method: Composition-based stats.
 Identities = 331/486 (68%), Positives = 399/486 (82%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++   + +     Y  GF + I  D APKGL EDIIR ISAKKNEP+++L+WRL AYR
Sbjct: 1   MSQSNPSLVEFLERDYAAGFISPIDSDLAPKGLGEDIIRLISAKKNEPEFLLQWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WLT+ +P+WA+I +P ID+  ++YYAAPK    P+SLD+VDPELLR YEKLGIP+ E+ 
Sbjct: 61  HWLTLAEPTWAKIHHPPIDYQAIHYYAAPKRDKAPKSLDEVDPELLRVYEKLGIPLHERA 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            LAG     VAVDAVFDSVSV TTFK++L + G+IF   S+A+  HP+LV++YL TVVP 
Sbjct: 121 ALAG-----VAVDAVFDSVSVATTFKDKLAQHGIIFCSFSDAVQNHPELVQQYLGTVVPP 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
           GDNF+AALN+AVFTDGSFVYIPKGVRCPMELSTYFRIN K +GQFERTLIIADEG+ VSY
Sbjct: 176 GDNFFAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINAKDSGQFERTLIIADEGAQVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP+RDENQLHAAVVE++ALD+A +KYSTVQNWYPGD  GKGGIYNFVTKRG+CRG
Sbjct: 236 LEGCTAPRRDENQLHAAVVEIIALDDARVKYSTVQNWYPGDKDGKGGIYNFVTKRGECRG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
            RS+ISWTQ+ETGSAITWKYPS LLRG+ S GEFYS+A++N FQQ D+GTKM+H+ +NT 
Sbjct: 296 ARSRISWTQVETGSAITWKYPSVLLRGDDSVGEFYSVALTNHFQQADTGTKMIHIGRNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG  +NTYRG V V   A  +RN+TQCDSLLIG+ CGAHT PYIE +N S 
Sbjct: 356 STIVSKGISAGRGSNTYRGLVKVLPKAEGARNYTQCDSLLIGDRCGAHTFPYIEVRNPSA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTS++ ++ LFYC+QRGI  E A+ALIV GF REV+++LPMEFAVEAQKL+ +S
Sbjct: 416 QVEHEATTSRVGEDQLFYCMQRGISAEDAVALIVGGFAREVVKQLPMEFAVEAQKLLGVS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|229496653|ref|ZP_04390367.1| FeS assembly protein SufB [Porphyromonas endodontalis ATCC 35406]
 gi|229316550|gb|EEN82469.1| FeS assembly protein SufB [Porphyromonas endodontalis ATCC 35406]
          Length = 494

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 309/481 (64%), Positives = 383/481 (79%), Gaps = 4/481 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           D ++++    YKYGFET I  +   +GL+E+++R IS KK EP+W+L++RL AY+ WLT+
Sbjct: 18  DILQEVTQGDYKYGFETKISTETIERGLSEEVVRLISKKKEEPEWLLDFRLKAYQHWLTL 77

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K P WA +  P ID+ D+ YYAAPK  V   +  ++DPEL+ T++KLGIP+ E++ILAG 
Sbjct: 78  KQPKWAHLHIPPIDYQDIIYYAAPKQKVSNGTPGEIDPELMETFDKLGIPLHERQILAG- 136

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
                AVDAV DSVSV TTF+++L   G++F   SEA+ EHP+LVKKYL  VV   DN++
Sbjct: 137 ---NTAVDAVMDSVSVKTTFRDKLSALGIVFCSFSEAVKEHPELVKKYLGKVVNYRDNYF 193

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSF YIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ +YVSYLEGCT
Sbjct: 194 AALNSAVFSDGSFAYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDAYVSYLEGCT 253

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RDENQLHAA+VE++A +NAE+KYSTVQNWYPGD  GKGGIYNFVTKRG CRG  SKI
Sbjct: 254 APMRDENQLHAAIVEIIAEENAEVKYSTVQNWYPGDKNGKGGIYNFVTKRGLCRGNNSKI 313

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSCLL G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT S IVS
Sbjct: 314 SWTQVETGSAITWKYPSCLLVGDNSVGEFYSVAVTNNYQQADTGTKMIHIGKNTRSTIVS 373

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S+N+YRG V +   A  SRN +QCDSLL+ ++CGAHT PY E  N +  +EHE
Sbjct: 374 KGISAGSSHNSYRGLVKISASAEGSRNHSQCDSLLLSDHCGAHTFPYAEVLNDTAIIEHE 433

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSKI+++ LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ ++LEGSV
Sbjct: 434 ATTSKINEDQLFYCQQRGITTEEAVGLIVNGYAREVMNKLPMEFAVEAQKLLSVTLEGSV 493

Query: 489 G 489
           G
Sbjct: 494 G 494


>gi|326794499|ref|YP_004312319.1| FeS assembly protein SufB [Marinomonas mediterranea MMB-1]
 gi|326545263|gb|ADZ90483.1| FeS assembly protein SufB [Marinomonas mediterranea MMB-1]
          Length = 478

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 331/482 (68%), Positives = 402/482 (83%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ K    +Y+ GF + I+ D    GLNED+IR +S  K EP+WML+WRL A+R W  M
Sbjct: 3   EQIDKALAREYEAGFVSEIESDTFEPGLNEDVIRRLSQIKGEPEWMLDWRLKAFRVWQEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP IDF  + YY+APKS+   P+SLD+VDPELLRTYEKLGIP+ EQ++LAG
Sbjct: 63  EEPDWAHVDYPKIDFQAIAYYSAPKSMQDKPKSLDEVDPELLRTYEKLGIPLVEQQMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                +AVDAVFDSVSVVTTF+E+L+++GVIF PISEA+ ++P+LV+KYL +VVP  DN+
Sbjct: 123 -----IAVDAVFDSVSVVTTFREKLEEAGVIFCPISEALHKYPELVQKYLGSVVPTKDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALN AVFTDGSFVYIPKG RCPMELSTYFRINE+ TGQFERTLI+ADEGSYVSYLEGC
Sbjct: 178 YAALNCAVFTDGSFVYIPKGTRCPMELSTYFRINEQNTGQFERTLIVADEGSYVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVA+D+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVAMDDAEIKYSTVQNWYPGDEDGKGGIYNFVTKRGICH-TNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+HL KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSVALTRGRQQADTGTKMIHLGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN+YRG V ++ GA  +RNFTQCDSLLIG+ CGAHT PY+ES+N S  +EH
Sbjct: 357 SKGISAGKSNNSYRGLVRMNPGAKGARNFTQCDSLLIGDQCGAHTFPYVESRNPSAIIEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SDE +F C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDEQMFLCQQRGLDPEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|198277420|ref|ZP_03209951.1| hypothetical protein BACPLE_03634 [Bacteroides plebeius DSM 17135]
 gi|198269918|gb|EDY94188.1| hypothetical protein BACPLE_03634 [Bacteroides plebeius DSM 17135]
          Length = 483

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 320/485 (65%), Positives = 394/485 (81%), Gaps = 6/485 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
           E    V+++   +YKYGF T++  D   KGLNED++R IS+KK EPDW+LE+RL A+R W
Sbjct: 4   EPNKYVKELTQAKYKYGFTTDVHTDIIEKGLNEDVVRLISSKKGEPDWLLEFRLKAFRYW 63

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
            T++ P+WA +  P ID+  + YYA P K   GP+SLD+VDPELL+T++KLGIP+ E+  
Sbjct: 64  QTLEMPTWAHLNIPEIDYQAISYYADPTKKKEGPKSLDEVDPELLKTFDKLGIPLEERMA 123

Query: 125 LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVG 184
           L+G     +AVDAV DSVSV TTFKE L + G+IF  ISEA+ EHPDLVKKYL +VV   
Sbjct: 124 LSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSISEAVREHPDLVKKYLGSVVGYR 178

Query: 185 DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYL 244
           DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYVSYL
Sbjct: 179 DNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDSYVSYL 238

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           EGCTAP RDENQLHAA+VE+V LD AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+G+
Sbjct: 239 EGCTAPMRDENQLHAAIVEIVVLDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCKGV 298

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT S
Sbjct: 299 DSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTRS 358

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
            IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G++CGAHT PY++  N +  
Sbjct: 359 TIVSKGISAGKSQNSYRGLVRVAEKADNARNYSQCDSLLLGSHCGAHTFPYMDIHNETAV 418

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISL 484
           +EHEATTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ +SL
Sbjct: 419 VEHEATTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLSVSL 478

Query: 485 EGSVG 489
           EGSVG
Sbjct: 479 EGSVG 483


>gi|333029425|ref|ZP_08457486.1| FeS assembly protein SufB [Bacteroides coprosuis DSM 18011]
 gi|332740022|gb|EGJ70504.1| FeS assembly protein SufB [Bacteroides coprosuis DSM 18011]
          Length = 482

 Score =  550 bits (1416), Expect = e-154,   Method: Composition-based stats.
 Identities = 313/487 (64%), Positives = 392/487 (80%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + E    V+++  ++YKYGF T++  +   KGLNED++R IS KK EPDW+L++RL AYR
Sbjct: 1   MEEANKYVKELTKEKYKYGFTTDVHTEIIEKGLNEDVVRLISEKKGEPDWLLDFRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLT++ P WA +R P ID+  + YYA P K   GP+SLD+VDPE+L+T+ KLGIP+ EQ
Sbjct: 61  HWLTLEMPKWAHLRIPEIDYQAISYYADPTKKKEGPKSLDEVDPEVLKTFNKLGIPLEEQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             L+G+     AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV++Y+ +VV 
Sbjct: 121 MALSGI-----AVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVRQYMGSVVG 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ +YVS
Sbjct: 176 YRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAMNTGQFERTLIVADDDAYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD+QGKGG+YNFVTKRG C+
Sbjct: 236 YLEGCTAPMRDENQLHAAIVEIIVNDRAEVKYSTVQNWYPGDAQGKGGVYNFVTKRGHCK 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 296 GINSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           +S I+SKGISAG S N+YRG V V   A ++RN+++CDSLL+G+ CGAHT PY++  N +
Sbjct: 356 SSTIISKGISAGHSENSYRGLVRVAEKAENARNYSECDSLLLGDKCGAHTFPYMDIHNET 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKI+++ +FYC QRGI  E AI LIVNG+ +EV+ KLPMEFAVEAQKL+ I
Sbjct: 416 AVIEHEATTSKINEDQIFYCNQRGISTEDAIGLIVNGYAKEVINKLPMEFAVEAQKLLSI 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|166711248|ref|ZP_02242455.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           oryzae pv. oryzicola BLS256]
          Length = 485

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 317/487 (65%), Positives = 388/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T I+ D  P GL+ED+IR +SAKK+EP WM +WRL AY
Sbjct: 6   APPQNAEILERLGR-RYDAGFITEIESDSLPPGLDEDVIRALSAKKDEPQWMTDWRLEAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA+++   IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLKMPMPEWAKLQISPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK+YL +VVP
Sbjct: 124 AKLAG-----VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVS
Sbjct: 179 VGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPMRDENQLHAAVVELVTLDDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T
Sbjct: 299 GARSKVTWTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 359 KSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 419 ATVEHEATTSKISDDQLFYCCARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|84622945|ref|YP_450317.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|84366885|dbj|BAE68043.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae MAFF
           311018]
          Length = 485

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 315/487 (64%), Positives = 388/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T I+ D  P GL+ED+IR +SAKK+EP WM +WRL AY
Sbjct: 6   APPQNAEILERLGR-RYDAGFITEIESDSLPPGLDEDVIRALSAKKDEPQWMTDWRLEAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA+++   IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLKMPMPEWAKLQISPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++VK+YL +VVP
Sbjct: 124 AKLAG-----VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVS
Sbjct: 179 VGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD +G+GGI+NFVTKR +CR
Sbjct: 239 YLEGCTAPMRDENQLHAAVVELVTLDDAEIKYSTVQNWYPGDEEGRGGIHNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K +
Sbjct: 299 GARSKVTWTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRS 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 359 KSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|58581028|ref|YP_200044.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|188577996|ref|YP_001914925.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|58425622|gb|AAW74659.1| ABC transporter permease [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|188522448|gb|ACD60393.1| FeS assembly protein SufB [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 485

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 316/487 (64%), Positives = 387/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++   +Y  GF T I+ D  P GL+ED+IR +SAKK+EP WM +WRL AY
Sbjct: 6   APPQNAEILERLGR-RYDAGFITEIESDSLPPGLDEDVIRALSAKKDEPQWMTDWRLEAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA+++   IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLKMPMPEWAKLQISPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTF+ EL + GVIF  +SEAI EHP++VK+YL +VVP
Sbjct: 124 AKLAG-----VAVDAVFDSVSVGTTFRNELAEKGVIFCSMSEAIKEHPEIVKQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           VGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVS
Sbjct: 179 VGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV LD+AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPMRDENQLHAAVVELVTLDDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K +
Sbjct: 299 GARSKVTWTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRS 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN  
Sbjct: 359 KSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEV 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|21243662|ref|NP_643244.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21109240|gb|AAM37780.1| ABC transporter permease [Xanthomonas axonopodis pv. citri str.
           306]
          Length = 485

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 314/480 (65%), Positives = 386/480 (80%), Gaps = 6/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           ++ +    +Y  GF T I+ D  P GL+ED+IR +SAKK+EP WM +WRL AYR WL M 
Sbjct: 12  QILERLGRRYDAGFITEIESDSLPPGLDEDVIRALSAKKDEPQWMTDWRLEAYRHWLKMP 71

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA+++   IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+  LAG  
Sbjct: 72  MPEWAKLQISPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHERAKLAG-- 128

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++V++YL +VVPVGDN++A
Sbjct: 129 ---VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVRQYLGSVVPVGDNYFA 185

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVSYLEGCTA
Sbjct: 186 ALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVSYLEGCTA 245

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CRG RSK++
Sbjct: 246 PMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECRGARSKVT 305

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T S+IVSK
Sbjct: 306 WTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRTKSKIVSK 365

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG   NTYRG+V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN    +EHEA
Sbjct: 366 GISAGRGQNTYRGQVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPGATVEHEA 425

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++SLEGSVG
Sbjct: 426 TTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEVSLEGSVG 485


>gi|145349243|ref|XP_001419047.1| ABC(membrane) family transporter (Fe-S assembly/SufBCD system)
           [Ostreococcus lucimarinus CCE9901]
 gi|144579278|gb|ABO97340.1| ABC(membrane) family transporter (Fe-S assembly/SufBCD system)
           [Ostreococcus lucimarinus CCE9901]
          Length = 471

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 301/474 (63%), Positives = 376/474 (79%), Gaps = 5/474 (1%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWAR 75
              YK+GF T++  +  P GLNE+++R ISAKK EP+WML++RL A+R+WLTM++P W+ 
Sbjct: 3   NKPYKWGFSTDVDTETIPAGLNEEVVRMISAKKEEPEWMLDFRLKAFRKWLTMEEPDWSD 62

Query: 76  IRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAV 135
            RYP ID+    YY+APKS+   +SLD+VDPELL T++KLGIP+ EQ+ L     + VAV
Sbjct: 63  NRYPQIDYQASSYYSAPKSMEKKKSLDEVDPELLATFDKLGIPLNEQKRL-----TNVAV 117

Query: 136 DAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAV 195
           DAVFDSVS+ TTFKE+L K+GVIF  ISEA+ E+P+LVK+YL +VVPV DN++ ALNSAV
Sbjct: 118 DAVFDSVSIGTTFKEDLLKAGVIFCSISEAVHEYPELVKQYLGSVVPVADNYFTALNSAV 177

Query: 196 FTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDEN 255
           F+DGSFVYIPKGV  PMELSTYFRIN + +GQFERTLI+A++ SYVSYLEGCTAP  DEN
Sbjct: 178 FSDGSFVYIPKGVVSPMELSTYFRINAESSGQFERTLIVAEDDSYVSYLEGCTAPAYDEN 237

Query: 256 QLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLET 315
           QLHAAVVE+ A  NAE+KYSTVQNWY GD  GKGGIYNFVTKRG C+G  SKISWTQ+ET
Sbjct: 238 QLHAAVVEISAGKNAEVKYSTVQNWYAGDEDGKGGIYNFVTKRGLCKGDNSKISWTQVET 297

Query: 316 GSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGF 375
           GS+ITWKYPS +L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT SRIVSKGISAG 
Sbjct: 298 GSSITWKYPSVVLAGDNSIGEFYSVALTNNAQQADTGTKMIHIGKNTRSRIVSKGISAGK 357

Query: 376 SNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKIS 435
           S N YRG V V   A+ +RN++QCDS+LIG+  GA+T PYI+ K  S  +EHEA+TSKI 
Sbjct: 358 SKNVYRGLVQVGPNASGARNYSQCDSMLIGDKAGANTYPYIQVKEPSSRVEHEASTSKIG 417

Query: 436 DEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           ++ LFY  QRGI  E A+ +I++GF REV  +LP+EFA E  +L+ + LEGSVG
Sbjct: 418 EDQLFYFQQRGISPEEAVGVIISGFCREVFNELPLEFAAEVNQLMSLKLEGSVG 471


>gi|167753459|ref|ZP_02425586.1| hypothetical protein ALIPUT_01733 [Alistipes putredinis DSM 17216]
 gi|167658084|gb|EDS02214.1| hypothetical protein ALIPUT_01733 [Alistipes putredinis DSM 17216]
          Length = 481

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 324/489 (66%), Positives = 391/489 (79%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    +  + +  I+  +YKYGF ++I+ +  P+GLNE+++R IS KK EP+WM E RL 
Sbjct: 1   MA--EKDKELIENIEKQEYKYGFTSDIETETIPRGLNEEVVRLISTKKGEPEWMTERRLK 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WL M  PSWA +  P IDF D+ YYAAPK      S+D+VDPEL RT++KLGIP+ 
Sbjct: 59  AYRHWLNMVSPSWAHLTIPPIDFQDVIYYAAPKPSKKLASMDEVDPELKRTFDKLGIPLE 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ  LAG     VAVDAV DSVSV TTFKE L + G+IF  +SEAI ++P+L++KYL +V
Sbjct: 119 EQMALAG-----VAVDAVMDSVSVKTTFKETLAEKGIIFCSMSEAIRDYPELIQKYLGSV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALN+AVF+DGSF YIPKGVRCPMELSTYFRIN  GTGQFERTLI+ADEG+Y
Sbjct: 174 VPYTDNFYAALNAAVFSDGSFCYIPKGVRCPMELSTYFRINAAGTGQFERTLIVADEGAY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+RDENQLHAAVVE+V   +AE+KYSTVQNWYPGD +GKGG+YNFVTKRG 
Sbjct: 234 VSYLEGCTAPRRDENQLHAAVVEIVVEKDAEVKYSTVQNWYPGDKEGKGGVYNFVTKRGI 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CR   +++SWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N FQQ D+GTKM+H+ +
Sbjct: 294 CR-ENARLSWTQVETGSAITWKYPSCILAGDNSVGEFYSVAMTNHFQQADTGTKMIHVGR 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT SRIVSKGISAG S N+YRG V V + A ++RN++QCDSLLIG+ CGAHT P IES N
Sbjct: 353 NTRSRIVSKGISAGRSENSYRGLVRVAKAAENARNYSQCDSLLIGDKCGAHTFPVIESGN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKIS+E LFYC QRG+  E A+ LIVNG+ REVL KLPMEFAVEAQKL+
Sbjct: 413 PTAVVEHEATTSKISEEQLFYCNQRGLTTEDAVGLIVNGYAREVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
            ISLEGSVG
Sbjct: 473 AISLEGSVG 481


>gi|298207473|ref|YP_003715652.1| hypothetical protein CA2559_04440 [Croceibacter atlanticus
           HTCC2559]
 gi|83850109|gb|EAP87977.1| hypothetical protein CA2559_04440 [Croceibacter atlanticus
           HTCC2559]
          Length = 481

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 326/489 (66%), Positives = 397/489 (81%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    + +   ++++  +YKYGF T+I+ D  P GLNEDI+R IS KK EP+WM EWRL 
Sbjct: 1   MAYTEDDLQ--KELETKEYKYGFYTDIESDTFPVGLNEDIVRAISLKKEEPEWMTEWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W  M++P WA + YP  DF ++ YY+AP      +SLD+VDPELL T++KLGI I 
Sbjct: 59  AFREWEKMEEPDWANVNYPKPDFQNISYYSAPNKKPKYESLDEVDPELLDTFKKLGISID 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAG     VAVD V DSVSV TTFK+ L + G+IF  ISEAI EHP+LV+K++ +V
Sbjct: 119 EQKKLAG-----VAVDIVMDSVSVATTFKKTLAEKGIIFCSISEAIKEHPELVRKHIGSV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL++ADEGSY
Sbjct: 174 VPQKDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVVADEGSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+ALD+AEIKYSTVQNWYPG+++GKGG++NFVTKRG 
Sbjct: 234 VSYLEGCTAPSRDENQLHAAVVELIALDDAEIKYSTVQNWYPGNAEGKGGVFNFVTKRGI 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N +QQ D+GTKM+HL K
Sbjct: 294 C-EKNAKISWTQVETGSAVTWKYPSCILKGDNSVGEFYSIAVTNNYQQADTGTKMIHLGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++  A ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 353 NTKSTIISKGISAGHSQNSYRGLVQINSRATNARNFSQCDSLLMGNKCGAHTFPYIETKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF ++VL KLPMEFAVEAQKL+
Sbjct: 413 KTAQVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKDVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|89900646|ref|YP_523117.1| cysteine desulfurase activator complex subunit SufB [Rhodoferax
           ferrireducens T118]
 gi|89345383|gb|ABD69586.1| Iron-regulated ABC transporter membrane component SufB [Rhodoferax
           ferrireducens T118]
          Length = 478

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 312/489 (63%), Positives = 387/489 (79%), Gaps = 11/489 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV      ++ +    YK+GF T+I  D A KGL+ED IR IS KKNEP+W+LE+RL 
Sbjct: 1   MSAV------LQNLVNQPYKHGFVTDIASDVAAKGLSEDTIRLISNKKNEPEWLLEFRLK 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R WLTM DP WA +++P IDF  + YYAAPK     +S+D+VDPELLRT+EKLG+P+ 
Sbjct: 55  AFRHWLTMTDPGWANVKHPKIDFQAISYYAAPKPKAKLKSMDEVDPELLRTFEKLGVPMH 114

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG     VAVD +FDSVSV TT+K +L + G+IF  ISEA+  HP+LVK+YL +V
Sbjct: 115 ERAALAG-----VAVDVIFDSVSVTTTYKAKLAEVGIIFGSISEAVQNHPELVKQYLGSV 169

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+YAALNSAVFTDGSF +IPKGV+CPM+LSTYFRIN + TGQFERTLI+A+EG+ 
Sbjct: 170 VPAADNYYAALNSAVFTDGSFCFIPKGVKCPMDLSTYFRINTQDTGQFERTLIVAEEGAS 229

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQ D NQLHAAVVELVALDNA+IKYSTVQNWY GD  G GGIYNFVTKRG 
Sbjct: 230 VSYLEGCTAPQFDTNQLHAAVVELVALDNADIKYSTVQNWYAGDENGVGGIYNFVTKRGL 289

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG+ S+ISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ K
Sbjct: 290 CRGVNSRISWTQVETGSAITWKYPSCILMGDNSVGEFYSVAVTNHHQQADTGTKMIHIGK 349

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S IVSKGISAG S+N+YRG V V  GA  +RN++QCDS+L+G+ C A+T PYI+ +N
Sbjct: 350 NTRSTIVSKGISAGQSSNSYRGLVKVMPGADGARNYSQCDSMLVGDKCSANTFPYIQVRN 409

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEA+TSKI ++ +FY  QRGI  E A+++I+NGF ++V ++LPMEFAVEA KL+
Sbjct: 410 QSAQVEHEASTSKIGEDQMFYFAQRGIGAEEAVSMIINGFCKDVFRQLPMEFAVEATKLL 469

Query: 481 DISLEGSVG 489
              LEGSVG
Sbjct: 470 GFKLEGSVG 478


>gi|78048635|ref|YP_364810.1| cysteine desulfurase activator complex subunit SufB [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325925547|ref|ZP_08186935.1| Iron-regulated ABC transporter membrane component SufB [Xanthomonas
           perforans 91-118]
 gi|78037065|emb|CAJ24810.1| ABC transporter-associated protein involved in Fe-S cluster
           assembly [Xanthomonas campestris pv. vesicatoria str.
           85-10]
 gi|325544051|gb|EGD15446.1| Iron-regulated ABC transporter membrane component SufB [Xanthomonas
           perforans 91-118]
          Length = 485

 Score =  549 bits (1415), Expect = e-154,   Method: Composition-based stats.
 Identities = 313/480 (65%), Positives = 385/480 (80%), Gaps = 6/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           ++ +    +Y  GF T I+ D  P GL+ED+IR +SAKK+EP WM +WRL AYR WL M 
Sbjct: 12  QILERLGRRYDAGFITEIESDSLPPGLDEDVIRALSAKKDEPQWMTDWRLEAYRHWLKMP 71

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA+++   IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+  LAG  
Sbjct: 72  MPEWAKLQISPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHERAKLAG-- 128

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++V++YL +VVPVGDN++A
Sbjct: 129 ---VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVRQYLGSVVPVGDNYFA 185

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IP GVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVSYLEGCTA
Sbjct: 186 ALNSAVFSDGSFVFIPAGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVSYLEGCTA 245

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CRG RSK++
Sbjct: 246 PMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECRGARSKVT 305

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T S+IVSK
Sbjct: 306 WTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRTKSKIVSK 365

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG   NTYRG+V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN    +EHEA
Sbjct: 366 GISAGRGQNTYRGQVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPGATVEHEA 425

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++SLEGSVG
Sbjct: 426 TTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEVSLEGSVG 485


>gi|282897161|ref|ZP_06305163.1| FeS assembly protein SufB [Raphidiopsis brookii D9]
 gi|281197813|gb|EFA72707.1| FeS assembly protein SufB [Raphidiopsis brookii D9]
          Length = 479

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 310/480 (64%), Positives = 387/480 (80%), Gaps = 6/480 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +    YKYGF T+I+ D  P+GLNE++IR ISAKK EP++MLE+RL AYR+WL M +
Sbjct: 5   VKTLVNQPYKYGFVTDIETDTIPRGLNEEVIRLISAKKQEPEFMLEFRLRAYRQWLKMME 64

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGP-QSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           P WA + Y  I++ D+ YY+APK       SL++VDP LL T+EKLGI + EQ+ LA   
Sbjct: 65  PIWAHVNYTPINYQDIVYYSAPKQKKAKLNSLEEVDPTLLETFEKLGISLSEQKRLA--- 121

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDA+FDSVSV TTFKE+L + GVIF  ISEA+ EHP+LVKKYL +VVP+GDN++A
Sbjct: 122 --NVAVDAIFDSVSVATTFKEKLAEDGVIFCSISEALREHPELVKKYLGSVVPIGDNYFA 179

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFVYIPKGV+CPMELSTYFRIN   TGQFERTLI+A+E SYVSYLEGCTA
Sbjct: 180 ALNSAVFSDGSFVYIPKGVKCPMELSTYFRINSGDTGQFERTLIVAEESSYVSYLEGCTA 239

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D NQLHAAVVELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKRG C+G+ SKIS
Sbjct: 240 PMYDSNQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKRGLCQGVNSKIS 299

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT S I+SK
Sbjct: 300 WTQVETGSAITWKYPSCVLVGDNSIGEFYSVALTNNRQQADTGTKMIHIGKNTRSTIISK 359

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S+N+YRG V ++  A  +RN++QCDS+LIG+N  A+T PYI+ +N++  +EHEA
Sbjct: 360 GISAGKSSNSYRGLVKINPSAKGARNYSQCDSMLIGDNAQANTFPYIQVQNNTGKVEHEA 419

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ LF+  QRGI  E A++++++GF ++V  +LPMEFAVEA KL+ + LEGSVG
Sbjct: 420 STSKIGEDQLFFFAQRGISAEDAVSMMISGFCKDVFNQLPMEFAVEADKLLSLKLEGSVG 479


>gi|296136904|ref|YP_003644146.1| FeS assembly protein SufB [Thiomonas intermedia K12]
 gi|295797026|gb|ADG31816.1| FeS assembly protein SufB [Thiomonas intermedia K12]
          Length = 481

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 329/486 (67%), Positives = 399/486 (82%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++   + +     Y  GF + I+ D APKGL EDIIR ISAKKNEP+++L+WRL AYR
Sbjct: 1   MSQSNPSLVEFLERDYAAGFISPIESDLAPKGLGEDIIRLISAKKNEPEFLLQWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WLT+ +P+WA+I +P ID+  ++YYAAPK    P+SLD+VDPELLR YEKLGIP+ E+ 
Sbjct: 61  HWLTLAEPTWAKIHHPPIDYQAIHYYAAPKRDKAPKSLDEVDPELLRVYEKLGIPLHERA 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            LAG     VAVDAVFDSVSV TTFK++L + G+IF   S+A+  HP+LV++YL TVVP 
Sbjct: 121 ALAG-----VAVDAVFDSVSVATTFKDKLAQHGIIFCSFSDAVQNHPELVQQYLGTVVPP 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
           GDNF+AALN+AVFTDGSFVYIPKGVRCPMELSTYFRIN K +GQFERTLII+DEG+ VSY
Sbjct: 176 GDNFFAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINAKDSGQFERTLIISDEGAQVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP+RDENQLHAAVVE++ALD+A +KYSTVQNWYPGD  GKGGIYN VTKRG+CRG
Sbjct: 236 LEGCTAPRRDENQLHAAVVEIIALDDARVKYSTVQNWYPGDKDGKGGIYNIVTKRGECRG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
            RS+ISWTQ+ETGSAITWKYPS LLRG+ S GEFYS+A++N FQQ D+GTKM+H+ +NT 
Sbjct: 296 ARSRISWTQVETGSAITWKYPSVLLRGDDSVGEFYSVALTNHFQQADTGTKMIHIGRNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG  +NTYRG V V   A  +RN+TQCDSLLIG+ CGAHT PYIE +N S 
Sbjct: 356 STIVSKGISAGRGSNTYRGLVKVLPKAEGARNYTQCDSLLIGDRCGAHTFPYIEVRNPSA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTS++ ++ LFYC+QRGI  E A+ALIV GF REV+++LPMEFAVEAQKL+ +S
Sbjct: 416 QVEHEATTSRVGEDQLFYCMQRGISAEDAVALIVGGFAREVVKQLPMEFAVEAQKLLGVS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|298387895|ref|ZP_06997444.1| FeS assembly protein SufB [Bacteroides sp. 1_1_14]
 gi|298259302|gb|EFI02177.1| FeS assembly protein SufB [Bacteroides sp. 1_1_14]
          Length = 484

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 320/486 (65%), Positives = 394/486 (81%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T +  D   +GLNED++R IS+KK+EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTEVHTDVIERGLNEDVVRLISSKKDEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD+ GKGG+YNFVTKRG+C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAAGKGGVYNFVTKRGNCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 VVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLTIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|29348815|ref|NP_812318.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|253568840|ref|ZP_04846250.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 1_1_6]
 gi|29340721|gb|AAO78512.1| ABC transporter permease [Bacteroides thetaiotaomicron VPI-5482]
 gi|251840859|gb|EES68940.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 1_1_6]
          Length = 484

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 320/486 (65%), Positives = 395/486 (81%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T +  D   +GLNED++R IS+KK+EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTEVHTDVIERGLNEDVVRLISSKKDEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 VVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLTIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|114319886|ref|YP_741569.1| cysteine desulfurase activator complex subunit SufB
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226280|gb|ABI56079.1| Iron-regulated ABC transporter membrane component SufB
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 482

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 315/487 (64%), Positives = 386/487 (79%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  + D + +     Y+ GF T+I+ +  P GL+ED +RFISAKK EP+WMLEWRL AYR
Sbjct: 1   MSASKDIIEQHTKKGYEAGFTTDIEQEHLPPGLSEDTVRFISAKKGEPEWMLEWRLEAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQ 122
            WL M  P WA + YP IDF  + Y+AAPKS    P+SL+DVDP+LL TYEKLG+P+ E+
Sbjct: 61  NWLKMPHPRWAHVDYPQIDFQAISYFAAPKSDDDRPKSLEDVDPKLLETYEKLGVPMHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E LAG     VAVDAVFDSVS+ TT++E+L + G+IF  +SEA+ EHPDLVKKY+ +VVP
Sbjct: 121 EQLAG-----VAVDAVFDSVSIGTTYREKLAEQGIIFCSMSEAVREHPDLVKKYIGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFR+N   TGQFERTLIIA+EG+ VS
Sbjct: 176 KGDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRMNASNTGQFERTLIIAEEGAEVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RD+NQLHAAVVELVA  +A IKYSTVQNWYPGD  GKGGIYNFVTKRG C 
Sbjct: 236 YLEGCTAPMRDDNQLHAAVVELVAHQDASIKYSTVQNWYPGDENGKGGIYNFVTKRGLCE 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+HL KNT
Sbjct: 296 GARSKISWTQVETGSAITWKYPSCVLKGDDSTGEFYSVAVTRGRQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISA     +YRG V +   A+ +RN++QCDS+L+ + CGAHT PYI+ ++  
Sbjct: 356 KSTIISKGISADHGQQSYRGLVRIAPTASGARNYSQCDSMLMSDTCGAHTFPYIDVQHPG 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             LEHEATTSKIS++ +FY  QRG+ EE A+ L+VNGF +EV ++LPMEFAVEAQ L+ +
Sbjct: 416 AQLEHEATTSKISEDQIFYLRQRGLSEEDAVNLVVNGFCKEVFKELPMEFAVEAQALLAV 475

Query: 483 SLEGSVG 489
           +LE SVG
Sbjct: 476 TLEDSVG 482


>gi|120437459|ref|YP_863145.1| cysteine desulfurase activator complex subunit SufB [Gramella
           forsetii KT0803]
 gi|117579609|emb|CAL68078.1| FeS assembly protein SufB [Gramella forsetii KT0803]
          Length = 481

 Score =  549 bits (1414), Expect = e-154,   Method: Composition-based stats.
 Identities = 330/489 (67%), Positives = 392/489 (80%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    + +   ++++  +Y+YGF T+I+ D  P GLNEDI+R IS KK EP+WM EWRL 
Sbjct: 1   MAYTEDDLK--KELETKEYEYGFYTDIESDTFPVGLNEDIVRAISKKKEEPEWMTEWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR W  M +P WA ++YP  DF ++ YY+AP       SLD+VDPELL T++KLGI I 
Sbjct: 59  AYRAWEDMIEPEWANVKYPKPDFQNISYYSAPNKKPKYDSLDEVDPELLDTFKKLGISID 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAG     VAVD V DSVSV TTFK+ L + G+IF  ISEAI EHP+LVKKYL TV
Sbjct: 119 EQKKLAG-----VAVDIVMDSVSVTTTFKKTLAEKGIIFCSISEAIKEHPELVKKYLGTV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL++ADE SY
Sbjct: 174 VPKKDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVVADEDSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD +EIKYSTVQNW+PG+ +GKGG++NFVTKRG 
Sbjct: 234 VSYLEGCTAPSRDENQLHAAVVELVALDGSEIKYSTVQNWFPGNKEGKGGVFNFVTKRGL 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N +QQ D+GTKM+HL K
Sbjct: 294 C-EDNAKISWTQVETGSAVTWKYPSCILKGDNSVGEFYSIAVTNNWQQADTGTKMIHLGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++  A ++RNF+QCDSLL+GN CGAHT PYIE KN
Sbjct: 353 NTKSTIISKGISAGQSQNSYRGLVQINGRAHNARNFSQCDSLLMGNKCGAHTFPYIEVKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 413 KSAQVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|153809153|ref|ZP_01961821.1| hypothetical protein BACCAC_03463 [Bacteroides caccae ATCC 43185]
 gi|149128129|gb|EDM19349.1| hypothetical protein BACCAC_03463 [Bacteroides caccae ATCC 43185]
          Length = 484

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 321/486 (66%), Positives = 395/486 (81%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T +  D   +GLNED+IR IS+KK+EP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTEVHTDIIERGLNEDVIRLISSKKDEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMDEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKYL +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYLGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIIVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 VVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLTIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|148240486|ref|YP_001225873.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. WH 7803]
 gi|147849025|emb|CAK24576.1| SufB protein, Fe-Scluster assembly [Synechococcus sp. WH 7803]
          Length = 479

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 301/483 (62%), Positives = 376/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+ED++R IS KK EPD++L++RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIAKGLSEDVVRLISEKKAEPDFLLQFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + YP ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYPPIDYQDIVYYAAPKQQEKKASLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   SEA+ EHPDL+++YL TVV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFSEAVKEHPDLIERYLGTVVASNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGARS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNRQQADTGTKMVHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +  GA+ +RN++QCDS+LIG+  GA+T PYI S+     +E
Sbjct: 357 VSKGISAGHSSNSYRGLVQIGPGASGARNYSQCDSMLIGDQAGANTYPYIRSQQPDSAVE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|189459829|ref|ZP_03008614.1| hypothetical protein BACCOP_00459 [Bacteroides coprocola DSM 17136]
 gi|189433439|gb|EDV02424.1| hypothetical protein BACCOP_00459 [Bacteroides coprocola DSM 17136]
          Length = 491

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 323/488 (66%), Positives = 396/488 (81%), Gaps = 6/488 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
              +  + V+++  ++YKYGF T +  D   KGLNED++R ISAKK EP+W+LE+RL AY
Sbjct: 9   EESQKNEFVKQLTQEKYKYGFTTEVHTDIIEKGLNEDVVRLISAKKGEPEWLLEFRLKAY 68

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           R WLTM+ P+WA +  P ID+  + YYA P K   GP+S+D+VDPEL++T+ KLGIP+ E
Sbjct: 69  RYWLTMEMPTWAHLNIPEIDYQAISYYADPTKKKEGPKSMDEVDPELVKTFNKLGIPLEE 128

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q  L+G     +AVDAV DSVSV TTFKE L + G+IF  +SEA+ EHPDLVKKYL +VV
Sbjct: 129 QMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSMSEAVREHPDLVKKYLGSVV 183

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD+ SYV
Sbjct: 184 GYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADDDSYV 243

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE+V LD AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C
Sbjct: 244 SYLEGCTAPMRDENQLHAAIVEIVVLDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNC 303

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KN
Sbjct: 304 KGVDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKN 363

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G++CGAHT PY++  N 
Sbjct: 364 TRSTIVSKGISAGKSQNSYRGLVRVSERADNARNYSQCDSLLLGSHCGAHTFPYMDIHNE 423

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS++ LFYC QRGIP E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 424 TAIVEHEATTSKISEDQLFYCNQRGIPTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLS 483

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 484 ISLEGSVG 491


>gi|30249421|ref|NP_841491.1| cysteine desulfurase activator complex subunit SufB [Nitrosomonas
           europaea ATCC 19718]
 gi|30138784|emb|CAD85361.1| Uncharacterized protein family UPF0051 [Nitrosomonas europaea ATCC
           19718]
          Length = 478

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 313/489 (64%), Positives = 392/489 (80%), Gaps = 11/489 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M AV      ++ +    YK+GF T+I+ D APKGLNEDIIR IS+KKNEP+W+L +RL 
Sbjct: 1   MSAV------LQHLVNQPYKHGFVTDIEADIAPKGLNEDIIRLISSKKNEPEWLLAFRLE 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR+WL M +P+W  ++YP IDF D+ YY+APK      S+D+VDPELLRT+EKLG+P+ 
Sbjct: 55  AYRKWLDMVEPAWQNVKYPKIDFQDISYYSAPKPKKKLASMDEVDPELLRTFEKLGVPMH 114

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG     VAVD +FDSVSV TT+KE+L + G+IF  ISEA+ ++P+L+++YL TV
Sbjct: 115 ERAALAG-----VAVDVIFDSVSVATTYKEKLAEVGIIFCSISEAVQKYPELIRQYLGTV 169

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP GDN+YAALNSAVFTDGSF +IPKGV+CPM+LSTYFRIN + +GQFERTLIIA+EG+ 
Sbjct: 170 VPPGDNYYAALNSAVFTDGSFCFIPKGVKCPMDLSTYFRINTEESGQFERTLIIAEEGAS 229

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP+ D NQLHAAVVELVALD+A+IKYSTVQNWY GD  G GGIYNFVTKRG 
Sbjct: 230 VSYLEGCTAPRFDTNQLHAAVVELVALDDADIKYSTVQNWYAGDENGVGGIYNFVTKRGL 289

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
            +G  S+ISWTQ+ETGSAITWKYPSC+LRGE S GEFYS+A++N  QQ D+GTKM+H+  
Sbjct: 290 AKGRNSRISWTQVETGSAITWKYPSCILRGENSVGEFYSVAVTNHHQQADTGTKMIHIGA 349

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S IVSKGISAG SN++YRG V +   A ++RN++QCDS+LIG+ CGAHT PYI+ +N
Sbjct: 350 NTRSTIVSKGISAGQSNSSYRGLVRIAPTARNARNYSQCDSMLIGSQCGAHTFPYIQVQN 409

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEA+TSKI ++ LFY  QRGI  E A+++I+NGF +EV Q+LP+EFAVEA KL+
Sbjct: 410 DSAQVEHEASTSKIGEDQLFYFAQRGIGAEEAVSMIINGFCKEVFQQLPLEFAVEATKLL 469

Query: 481 DISLEGSVG 489
              LEGSVG
Sbjct: 470 SFKLEGSVG 478


>gi|294626271|ref|ZP_06704874.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|294664776|ref|ZP_06730102.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
 gi|292599417|gb|EFF43551.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 11122]
 gi|292605463|gb|EFF48788.1| ABC transporter permease [Xanthomonas fuscans subsp. aurantifolii
           str. ICPB 10535]
          Length = 485

 Score =  548 bits (1413), Expect = e-154,   Method: Composition-based stats.
 Identities = 315/480 (65%), Positives = 387/480 (80%), Gaps = 6/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           ++ +    +Y  GF T I+ D  P GL+ED+IR +SAKK+EP WM +WRL AYR WL M 
Sbjct: 12  QILERLGRRYDAGFITEIESDSLPPGLDEDVIRALSAKKDEPQWMTDWRLEAYRHWLKMP 71

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA+++  AIDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+  LAG  
Sbjct: 72  MPEWAKLQISAIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHERAKLAG-- 128

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP++V++YL +VVPVGDN++A
Sbjct: 129 ---VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPEIVRQYLGSVVPVGDNYFA 185

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +YVSYLEGCTA
Sbjct: 186 ALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAYVSYLEGCTA 245

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P RDENQLHAAVVELV L++AEIKYSTVQNWYPGD +G+GGIYNFVTKR +CRG RSK++
Sbjct: 246 PMRDENQLHAAVVELVTLEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRAECRGARSKVT 305

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K T S+IVSK
Sbjct: 306 WTQVETGSAITWKYPSCVLIGDDSVGEFHSVALTHHRQQADTGTKMIHIGKRTKSKIVSK 365

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG   NTYRG+V V R A  +RN+TQCDSLLIG  CGAHT PYIE KN    +EHEA
Sbjct: 366 GISAGRGQNTYRGQVKVDRNADGARNYTQCDSLLIGKQCGAHTFPYIEVKNPGATVEHEA 425

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TTSKISD+ LFYC  RGI +E A++LIV+GF ++V ++LPMEFAVEA+KL+++SLEGSVG
Sbjct: 426 TTSKISDDQLFYCRARGISQEDAVSLIVDGFCKQVFRELPMEFAVEAKKLLEVSLEGSVG 485


>gi|254498598|ref|ZP_05111318.1| cysteine desulfurase activator complex subunit SufB [Legionella
           drancourtii LLAP12]
 gi|254352189|gb|EET11004.1| cysteine desulfurase activator complex subunit SufB [Legionella
           drancourtii LLAP12]
          Length = 486

 Score =  548 bits (1412), Expect = e-154,   Method: Composition-based stats.
 Identities = 326/489 (66%), Positives = 401/489 (82%), Gaps = 6/489 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
             V ++ +++  +   +Y++GF T+I+V+    GLNED+IR +SA K EP+++LEWRL A
Sbjct: 3   SIVAKSSEQINSLLDREYQHGFITDIEVETFEPGLNEDVIRRLSAIKGEPEFLLEWRLKA 62

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIR 120
           YR WLTM  P W+ + YP +D++ + YY+APKS    P+SLD+VDPELLRTYEKLGIP+R
Sbjct: 63  YRHWLTMPHPEWSSVYYPPVDYNAISYYSAPKSKTNAPKSLDEVDPELLRTYEKLGIPLR 122

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQE+LAG     VAVDAVFDSVSV TTFK +L + GVIF P SEA+ ++P+L+ +YL +V
Sbjct: 123 EQEMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPFSEAVHKYPELLMQYLGSV 177

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD  SY
Sbjct: 178 VPYRDNFYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAASTGQFERTLIVADVDSY 237

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG 
Sbjct: 238 VSYLEGCTAPMRDENQLHAAVVELVALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGA 297

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N +QQ D+GTKM+H+ K
Sbjct: 298 CRGKRSKISWTQIETGSAITWKYPSVVLQGDDSVGEFYSVALTNNYQQADTGTKMIHIGK 357

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN
Sbjct: 358 NTRSTIISKGISAGCAHNAYRGLVRIAPTATNARNYTQCDSMLMGSECSAHTFPYIEVKN 417

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+
Sbjct: 418 PTAQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLL 477

Query: 481 DISLEGSVG 489
            +SLEG+VG
Sbjct: 478 GLSLEGAVG 486


>gi|255692956|ref|ZP_05416631.1| FeS assembly protein SufB [Bacteroides finegoldii DSM 17565]
 gi|260621267|gb|EEX44138.1| FeS assembly protein SufB [Bacteroides finegoldii DSM 17565]
          Length = 484

 Score =  548 bits (1412), Expect = e-154,   Method: Composition-based stats.
 Identities = 323/486 (66%), Positives = 395/486 (81%), Gaps = 6/486 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
            E    V+++  ++YKYGF T +  D   +GLNED+IR IS+KKNEP+W+LE+RL AYR 
Sbjct: 4   EEPNKYVKELTQEKYKYGFTTEVHTDVIERGLNEDVIRLISSKKNEPEWLLEFRLKAYRH 63

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLT++ P+WA +R P ID+  + YYA P K   GP+S+++VDPEL++T+ KLGIP+ EQ 
Sbjct: 64  WLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMEEVDPELIKTFNKLGIPLEEQM 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV  
Sbjct: 124 ALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVVGY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGDS+GKGG+YNFVTKRG+C+G
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDSEGKGGVYNFVTKRGNCKG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N FQQ D+GTKM+HL KNT 
Sbjct: 299 VDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNFQQADTGTKMIHLGKNTR 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N + 
Sbjct: 359 STIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNETA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ IS
Sbjct: 419 VVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLTIS 478

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 479 LEGSVG 484


>gi|300863815|ref|ZP_07108740.1| cysteine desulfurase activator complex subunit SufB [Oscillatoria
           sp. PCC 6506]
 gi|300338163|emb|CBN53886.1| cysteine desulfurase activator complex subunit SufB [Oscillatoria
           sp. PCC 6506]
          Length = 479

 Score =  548 bits (1411), Expect = e-154,   Method: Composition-based stats.
 Identities = 305/490 (62%), Positives = 386/490 (78%), Gaps = 12/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  +T      +    YKYGF T I+ D  P+GL+ED++R IS+KKNEP +MLE+RL 
Sbjct: 1   MSATVQT------LVNQPYKYGFVTEIESDTIPRGLSEDVVRLISSKKNEPAFMLEFRLK 54

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGP-QSLDDVDPELLRTYEKLGIPI 119
           AYR+WL M +P+W  + YP I++ ++ YY+AP+       SL++VDP LL T+EKLGI +
Sbjct: 55  AYRQWLKMTEPTWPHVSYPPINYQEIIYYSAPRQKPKKLNSLEEVDPVLLETFEKLGISL 114

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVDAVFDSVSV TTF+E+L K GVIF  ISEA+ ++P+L++KYL +
Sbjct: 115 SEQKRLS-----NVAVDAVFDSVSVATTFREKLAKDGVIFCSISEAVKDYPELIEKYLGS 169

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPVGDN++AALNSAVF+DGSFVYIPKGV+CPMELSTYFRIN   +GQFERTLIIA+ GS
Sbjct: 170 VVPVGDNYFAALNSAVFSDGSFVYIPKGVKCPMELSTYFRINNGDSGQFERTLIIAEAGS 229

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA+IKYSTVQNWY GD  GKGGIYNFVTKRG
Sbjct: 230 SVSYLEGCTAPMFDTNQLHAAVVELVALDNADIKYSTVQNWYAGDENGKGGIYNFVTKRG 289

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N  QQ D+GTKM+H+ 
Sbjct: 290 LCQGVNSKISWTQVETGSAITWKYPSCVLVGDNSVGEFYSVALTNHKQQADTGTKMVHIG 349

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S+N+YRG V +   +  SRN++QCDS+LIG+N  A+T PYI+ +
Sbjct: 350 KNTRSTIISKGISAGKSSNSYRGLVKMGPNSKGSRNYSQCDSMLIGDNAQANTFPYIQVQ 409

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEA+TSKI ++ LF+  QRGI  E AI+++++GF ++V  +LPMEFAVEA KL
Sbjct: 410 NHTAKVEHEASTSKIGEDQLFFFAQRGISPEDAISMMISGFCKDVFNQLPMEFAVEADKL 469

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 470 LSLKLEGSVG 479


>gi|254454078|ref|ZP_05067515.1| FeS assembly protein SufB [Octadecabacter antarcticus 238]
 gi|198268484|gb|EDY92754.1| FeS assembly protein SufB [Octadecabacter antarcticus 238]
          Length = 507

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 342/494 (69%), Positives = 403/494 (81%), Gaps = 10/494 (2%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           ++TVD V+ +    YK+G+ T+++++ AP GL+EDI+R IS K  EP WML+WRL AY R
Sbjct: 15  QDTVDAVQAL-SGTYKHGWNTDVEMEYAPLGLSEDIVRLISEKNEEPQWMLDWRLEAYAR 73

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQE 123
           WLTM +P WA + YP IDF D YYYA PKS+   P+SLD+VDP+LL TY KLGIP++EQ 
Sbjct: 74  WLTMLEPDWAMVDYPKIDFQDQYYYARPKSMEVKPKSLDEVDPKLLATYAKLGIPLKEQA 133

Query: 124 ILAGVQT--------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           ILAGV+          KVAVDAVFDSVS+ TTFK+EL K+GVIF  ISEAI +HP+LV+K
Sbjct: 134 ILAGVEGAEDMSEAPRKVAVDAVFDSVSLGTTFKDELAKAGVIFCSISEAIKDHPELVRK 193

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL TV+P  DN+YA LN+AVF+DGSFVYIPKG +CPMELSTYFRIN + TGQFERTLIIA
Sbjct: 194 YLGTVIPAADNYYACLNAAVFSDGSFVYIPKGTKCPMELSTYFRINAENTGQFERTLIIA 253

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DEGSYVSYLEGCTAP+RD  QLHAA VEL+ +D+AEIKYSTVQNW+PGD  G GGIYNFV
Sbjct: 254 DEGSYVSYLEGCTAPKRDIAQLHAACVELILMDDAEIKYSTVQNWFPGDENGVGGIYNFV 313

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKR DCRG RSK+ WTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIAI+N  QQ D+GTKM
Sbjct: 314 TKRADCRGDRSKVMWTQVETGSAVTWKYPSCILRGDDSQGEFYSIAIANNMQQADTGTKM 373

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRIVSKGISAG + NTYRG VS+H  A  SRN+TQCDSLLIG+ CGAHT+PY
Sbjct: 374 VHLGKRTKSRIVSKGISAGKAQNTYRGLVSMHPKAKDSRNYTQCDSLLIGDKCGAHTVPY 433

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE KN+S  +EHEATTSKI DE +FYC  RG+ EE A+ALIVNGF +EVLQ LPMEFA+E
Sbjct: 434 IEVKNNSSRVEHEATTSKIDDEQMFYCRSRGMGEEEAVALIVNGFAKEVLQALPMEFAME 493

Query: 476 AQKLIDISLEGSVG 489
           AQ L+ ISLEGSVG
Sbjct: 494 AQALVAISLEGSVG 507


>gi|270158823|ref|ZP_06187480.1| FeS assembly protein SufB [Legionella longbeachae D-4968]
 gi|289166384|ref|YP_003456522.1| component of SufBCD complex [Legionella longbeachae NSW150]
 gi|269990848|gb|EEZ97102.1| FeS assembly protein SufB [Legionella longbeachae D-4968]
 gi|288859557|emb|CBJ13522.1| component of SufBCD complex [Legionella longbeachae NSW150]
          Length = 482

 Score =  548 bits (1411), Expect = e-153,   Method: Composition-based stats.
 Identities = 323/487 (66%), Positives = 399/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + ++ +++  +   +Y++GF T+I+VD    GL+E++IR +SA K EP+++LEWRL AY+
Sbjct: 1   MAKSSEQINSLLDREYQHGFTTDIEVDTFAPGLDEEVIRRLSAVKGEPEFLLEWRLKAYQ 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQ 122
            WLTM  P W+ + YP +DF  + YY+APK     P+SLD+VDPELLRTYEKLGIP+REQ
Sbjct: 61  HWLTMSPPQWSSVHYPPVDFQSISYYSAPKMKKDAPKSLDEVDPELLRTYEKLGIPLREQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E+LAG     VAVDAVFDSVSV TTFK +L + GVIF PISEA+ ++P+L+ +YL +VV 
Sbjct: 121 EMLAG-----VAVDAVFDSVSVATTFKAKLAEKGVIFCPISEAVHQYPELLMQYLGSVVS 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNFYAALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+AD  SYVS
Sbjct: 176 YRDNFYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAASTGQFERTLIVADVDSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVALD A+IKYSTVQNWYPGD +GKGGIYNFVTKRG CR
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALDGAQIKYSTVQNWYPGDKEGKGGIYNFVTKRGACR 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT
Sbjct: 296 GKRSKISWTQIETGSAITWKYPSVILQGDDSVGEFYSVALTNNYQQADTGTKMIHIGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG ++N YRG V +   A ++RN+TQCDS+L+G+ C AHT PYIE KN +
Sbjct: 356 RSTIISKGISAGKAHNAYRGLVRIAPTAINARNYTQCDSMLMGSECSAHTFPYIEVKNPT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS+E LFYC QRGI  E A+++IVNGF ++VL++LPMEFAVEA KL+ +
Sbjct: 416 AQVEHEATTSKISEEQLFYCQQRGIDTEDAVSMIVNGFCKQVLKELPMEFAVEATKLLGL 475

Query: 483 SLEGSVG 489
           SLEG+VG
Sbjct: 476 SLEGAVG 482


>gi|88811719|ref|ZP_01126973.1| hypothetical protein NB231_04920 [Nitrococcus mobilis Nb-231]
 gi|88791110|gb|EAR22223.1| hypothetical protein NB231_04920 [Nitrococcus mobilis Nb-231]
          Length = 482

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 326/490 (66%), Positives = 395/490 (80%), Gaps = 9/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  +T   + ++   +Y+ GF T+I+ D  P GL+EDIIRFIS KK EP+WMLEWRL 
Sbjct: 1   MSATTKT---LEELTNRKYEAGFITDIEQDTVPPGLDEDIIRFISEKKAEPEWMLEWRLK 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPI 119
           AYR WL M  P WA + YP IDF  + YY+APK     PQSLD++DP+L  TY++LGIP+
Sbjct: 58  AYRNWLQMPVPEWANVYYPPIDFQAISYYSAPKRKEDMPQSLDEIDPKLKETYDRLGIPL 117

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQE+LAG     VAVDAVFDSVSV T++K +LK+ G+IF  +SEAI EHP+LV+KYL +
Sbjct: 118 HEQEMLAG-----VAVDAVFDSVSVATSYKAKLKEKGIIFCSMSEAIREHPELVRKYLGS 172

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN+YA LNSAVFTDGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLIIA+EGS
Sbjct: 173 VVPYTDNYYAGLNSAVFTDGSFVFIPKGVRCPMELSTYFRINAANTGQFERTLIIAEEGS 232

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           +VSYLEGCTAP RDENQLHAAVVEL+ALD+A+IKYSTVQNWYPGD +G+GG+YNFVTKRG
Sbjct: 233 HVSYLEGCTAPVRDENQLHAAVVELIALDDAQIKYSTVQNWYPGDEEGRGGVYNFVTKRG 292

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C G  SKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++ G QQ D+GTKM+H+ 
Sbjct: 293 LCAGNNSKISWTQVETGSAITWKYPSCVLRGDNSVGEFYSVAVTRGRQQADTGTKMIHMG 352

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGISAG+   +YRG V V   A ++RN++QCDS+L+ + CGAHT PYI+ +
Sbjct: 353 KNTRSTIVSKGISAGYGQQSYRGLVRVTPKAENARNYSQCDSMLMSSTCGAHTFPYIDIQ 412

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NS+  LEHEATTSKI +E + YC QRGI  E A++LIVNGF +EV + LPMEFAVEAQKL
Sbjct: 413 NSTAQLEHEATTSKIGEEQILYCNQRGIATEDAVSLIVNGFCKEVFRTLPMEFAVEAQKL 472

Query: 480 IDISLEGSVG 489
           ++I+LEGSVG
Sbjct: 473 MEITLEGSVG 482


>gi|90021061|ref|YP_526888.1| cysteine desulfurase activator complex subunit SufB [Saccharophagus
           degradans 2-40]
 gi|89950661|gb|ABD80676.1| Iron-regulated ABC transporter membrane component SufB
           [Saccharophagus degradans 2-40]
          Length = 479

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 332/482 (68%), Positives = 400/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++  +    Y  GF T+++ D  P GLNE++I FIS KKNEP+W+LEWRL AYR W  M
Sbjct: 4   EQLDHLIRKDYAAGFITDVESDTLPPGLNEEVIAFISNKKNEPEWLLEWRLKAYRAWREM 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
            +P WA + YP IDFD++ YY+APKS+   P+SLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 64  DEPDWAHVSYPKIDFDEISYYSAPKSMADKPKSLDEVDPELLRTYEKLGIPLHEQEMLAG 123

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSV TTF+++L ++GVIF PISEA+ E+P+LVKKYL +VVP  DN+
Sbjct: 124 -----VAVDAVFDSVSVGTTFRKKLFEAGVIFCPISEAVHEYPELVKKYLGSVVPQKDNY 178

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALN AVF+DGSFVYIPKGVRCPMELSTYFRINE  TGQFERTLIIADEGS+VSYLEGC
Sbjct: 179 YAALNCAVFSDGSFVYIPKGVRCPMELSTYFRINESKTGQFERTLIIADEGSHVSYLEGC 238

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALDNA+IKYSTVQNWYPGD++GKGGIYNFVTKRG      + 
Sbjct: 239 TAPMRDENQLHAAVVELVALDNAKIKYSTVQNWYPGDAEGKGGIYNFVTKRGIAH-TNAH 297

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++N  QQ D+GTKM+HL KNT S I+
Sbjct: 298 ISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSVALTNNHQQADTGTKMIHLGKNTRSTII 357

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S+N YRG V ++ GA  +RN+TQCDSLLIG+ C AHT PYIESKN S  +EH
Sbjct: 358 SKGISAGKSSNAYRGLVRMNPGATGARNYTQCDSLLIGDKCAAHTFPYIESKNPSAVVEH 417

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+S++ L+ C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++SLEGS
Sbjct: 418 EATTSKVSEDQLYLCQQRGIDAEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEVSLEGS 477

Query: 488 VG 489
           VG
Sbjct: 478 VG 479


>gi|88807203|ref|ZP_01122715.1| ABC transporter, membrane component [Synechococcus sp. WH 7805]
 gi|88788417|gb|EAR19572.1| ABC transporter, membrane component [Synechococcus sp. WH 7805]
          Length = 479

 Score =  547 bits (1410), Expect = e-153,   Method: Composition-based stats.
 Identities = 300/483 (62%), Positives = 376/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+ED++R IS KK+EPD++L++RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIAKGLSEDVVRLISGKKDEPDFLLQFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + YP ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYPPIDYQDIIYYAAPKQQDKKASLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   SEA+ EHP L+++YL TVV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFSEAVKEHPALIERYLGTVVASNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGARS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNRQQADTGTKMVHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +  GA+ +RN++QCDS+LIG+  GA+T PYI S+     +E
Sbjct: 357 VSKGISAGHSSNSYRGLVQIGPGASGARNYSQCDSMLIGDQAGANTYPYIRSQQPDSAVE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|86134640|ref|ZP_01053222.1| FeS assembly protein SufB [Polaribacter sp. MED152]
 gi|85821503|gb|EAQ42650.1| FeS assembly protein SufB [Polaribacter sp. MED152]
          Length = 482

 Score =  547 bits (1409), Expect = e-153,   Method: Composition-based stats.
 Identities = 334/489 (68%), Positives = 396/489 (80%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E  D  +++   +Y+YGF T+I+ +   KGLNED++R IS KKNEP+WM EWRL 
Sbjct: 1   MSKYTEE-DLEQELKTKEYEYGFYTDIESETFAKGLNEDVVRAISKKKNEPEWMTEWRLE 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W  M +P WA ++YP  DF ++ YY+APK      SLD+VDP+LL T++KLGI I 
Sbjct: 60  AFRVWEKMTEPDWANVKYPKPDFQEIAYYSAPKKKPKLNSLDEVDPDLLETFKKLGISID 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LA      VAVD V DSVSV TTFK+ L + G+IFMPISEAI EHP+LVKKYL TV
Sbjct: 120 EQKKLA-----NVAVDIVMDSVSVATTFKKTLGEKGIIFMPISEAIQEHPELVKKYLGTV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSF YIPKGV+CPMELSTYFRINE GTGQFERTL++AD+GSY
Sbjct: 175 VPTSDNFYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINEGGTGQFERTLVVADKGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAPQRDENQLHAAVVEL+A+D+AEIKYSTVQNW+PGD  GKGG++NFVTKRG 
Sbjct: 235 VSYLEGCTAPQRDENQLHAAVVELIAMDDAEIKYSTVQNWFPGDENGKGGVFNFVTKRGL 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G  S GEFYSIA++N FQQ D+GTKM+HL K
Sbjct: 295 C-ETNAKISWTQVETGSAVTWKYPSCILKGNNSVGEFYSIAVTNHFQQADTGTKMVHLGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++  A ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 354 NTKSTIISKGISAGQSQNSYRGLVQINSRAENARNFSQCDSLLMGNACGAHTFPYIEAKN 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEATTSKI ++ LFYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 414 KSAQIEHEATTSKIGEDQLFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|254424683|ref|ZP_05038401.1| FeS assembly protein SufB [Synechococcus sp. PCC 7335]
 gi|196192172|gb|EDX87136.1| FeS assembly protein SufB [Synechococcus sp. PCC 7335]
          Length = 479

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 304/472 (64%), Positives = 381/472 (80%), Gaps = 6/472 (1%)

Query: 19  YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRY 78
           YKYGF T+I+ D  P+GL+ED++R ISAKK EP +ML++RL AYRRWL +++P+W  ++Y
Sbjct: 13  YKYGFVTDIESDSLPRGLSEDVVRAISAKKEEPQFMLDFRLKAYRRWLELEEPTWPNVKY 72

Query: 79  PAIDFDDLYYYAAPK-SIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDA 137
           P ID++++ YY+APK S     SLD+VDP LL T++KLGI I EQ+ LA      VAVD 
Sbjct: 73  PPIDYNEIVYYSAPKQSEKKLGSLDEVDPALLDTFDKLGISINEQKRLA-----NVAVDV 127

Query: 138 VFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFT 197
           VFDSVS+ TTFK++L K GVIF  ISEA+ EHP+LVK+YL TVVPVGDN++ ALNSAVF+
Sbjct: 128 VFDSVSIATTFKKDLAKHGVIFCSISEAVKEHPELVKEYLGTVVPVGDNYFTALNSAVFS 187

Query: 198 DGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQL 257
           DGSFVYIPKGV+CPM+LSTYFRIN   +GQFERTLI+A+E S V+YLEGCTAP  D NQL
Sbjct: 188 DGSFVYIPKGVKCPMDLSTYFRINNGDSGQFERTLIVAEESSSVTYLEGCTAPMYDSNQL 247

Query: 258 HAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGS 317
           HAAVVELVALD+AEIKYSTVQNW+ GD  GKGGIYNFVTKRG C+G  SKISWTQ+ETGS
Sbjct: 248 HAAVVELVALDSAEIKYSTVQNWFAGDENGKGGIYNFVTKRGLCKGDNSKISWTQVETGS 307

Query: 318 AITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSN 377
           AITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT S I+SKGISAG S 
Sbjct: 308 AITWKYPSCVLAGDNSVGEFYSVALTNNYQQADTGTKMVHVGKNTRSTIISKGISAGKSK 367

Query: 378 NTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDE 437
           N+YRG V V+  A  +RN++QCDS+L+G+   A+T PYI+ +NSS  +EHEA+TSKI ++
Sbjct: 368 NSYRGLVKVNPKAEGARNYSQCDSMLLGDASNANTFPYIQVQNSSAQVEHEASTSKIGED 427

Query: 438 HLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
            LFY  QRGI  E A+++I++GF R+V  +LPMEFA EA KL+ + LE SVG
Sbjct: 428 QLFYFAQRGISPEDAVSMIISGFCRDVFNELPMEFAAEADKLLSLKLENSVG 479


>gi|153209325|ref|ZP_01947344.1| FeS assembly SUF system regulator [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212218766|ref|YP_002305553.1| cysteine desulfurase activator complex subunit SufB [Coxiella
           burnetii CbuK_Q154]
 gi|120575396|gb|EAX32020.1| FeS assembly SUF system regulator [Coxiella burnetii 'MSU Goat
           Q177']
 gi|212013028|gb|ACJ20408.1| ABC transporter-associated protein [Coxiella burnetii CbuK_Q154]
          Length = 631

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 329/479 (68%), Positives = 399/479 (83%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           +  I    Y++GF T+I+ D    GLNE++IR ISAKK+EP++ML+WRL AYR W+T++ 
Sbjct: 158 LETIVNKTYEHGFITDIETDVIAPGLNEEVIRLISAKKDEPNFMLDWRLKAYRHWVTLEA 217

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA +R+  ID+  + YYAAPKS   P+SL++VDP+LL TY KLGIP+ EQ+ LAG   
Sbjct: 218 PQWAHVRFNPIDYQAISYYAAPKSKKKPKSLEEVDPKLLETYTKLGIPLYEQQRLAG--- 274

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVSV TTFKE+L ++GVIF   SEA+ +HP+LV+KYL +VVP GDNF+A 
Sbjct: 275 --VAVDAVFDSVSVATTFKEKLAEAGVIFCSFSEAVQKHPELVEKYLGSVVPYGDNFFAT 332

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGCTAP
Sbjct: 333 LNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADEGSYVSYLEGCTAP 392

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
           QRDENQLHAAVVELVALDNA+I+Y+TVQNWYPGD +GKGGIYNFVTKRG CRG+ SKISW
Sbjct: 393 QRDENQLHAAVVELVALDNAQIRYATVQNWYPGDEEGKGGIYNFVTKRGACRGVNSKISW 452

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ KNT S I+SKG
Sbjct: 453 TQIETGSAITWKYPSVILKGDNSVGEFYSVALTNNFQQADTGTKMIHIGKNTRSTIISKG 512

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG   N+YRG V V   A ++RN++QCDSLL+GN CGAHT PY+E KN +  +EHEAT
Sbjct: 513 ISAGRGQNSYRGLVRVLPTAENARNYSQCDSLLLGNRCGAHTFPYMEIKNKTARVEHEAT 572

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFYC QRGI EE A+++IVNGF ++V QKLPMEFAVEAQKL+++SLEG+VG
Sbjct: 573 TSKIGEDQLFYCRQRGITEEDAVSMIVNGFCKQVFQKLPMEFAVEAQKLMEVSLEGAVG 631


>gi|83644268|ref|YP_432703.1| cysteine desulfurase activator complex subunit SufB [Hahella
           chejuensis KCTC 2396]
 gi|83632311|gb|ABC28278.1| FeS assembly protein SufB [Hahella chejuensis KCTC 2396]
          Length = 482

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 337/487 (69%), Positives = 401/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +    + V +    +Y+ GF T+I+ +    GLNED+IRFISAKKNEP++ML WRL AYR
Sbjct: 1   MSTPENSVDQYIKREYQAGFITDIESEALEPGLNEDVIRFISAKKNEPEFMLNWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQ 122
            WL M +P WA + YP IDF+D+ YY+APKS   GP+SLD+VDPELL+TYEKLGIP+ E+
Sbjct: 61  EWLNMVEPQWAHVHYPKIDFNDIIYYSAPKSQKDGPKSLDEVDPELLKTYEKLGIPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSV TTFKE+L ++GVIF  ISEA+  HP+LV+KYL +VVP
Sbjct: 121 AALAG-----VAVDAVFDSVSVATTFKEKLSEAGVIFCSISEAVRNHPELVEKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           + DN++AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVS
Sbjct: 176 IRDNYFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAAKTGQFERTLIIADEGSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVAL+ AEIKYSTVQNWYPGD +GKGGIYNFVTKRG C 
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALEGAEIKYSTVQNWYPGDEEGKGGIYNFVTKRGLCA 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT
Sbjct: 296 GAHSKISWTQVETGSAITWKYPSVVLKGDHSVGEFYSVALTNNLQQADTGTKMIHMGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG S+++YRG V +   A ++RN+TQCDSLLIG  CGAHT PYIESKN+S
Sbjct: 356 RSTIISKGISAGRSDSSYRGLVRIGPNADNARNYTQCDSLLIGAKCGAHTFPYIESKNNS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSK+SDE LF C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++
Sbjct: 416 AVVEHEATTSKVSDEQLFLCRQRGIDAERAVSMIVNGFCKEVFKELPMEFAVEAGKLLEV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|126665742|ref|ZP_01736723.1| component of SufBCD complex [Marinobacter sp. ELB17]
 gi|126629676|gb|EBA00293.1| component of SufBCD complex [Marinobacter sp. ELB17]
          Length = 482

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 334/487 (68%), Positives = 400/487 (82%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  T  +VR++    Y++GF T I+ D    GLNED+IR +S  K EP++MLEWRL AYR
Sbjct: 1   MATTDKEVRELIKRDYEHGFVTEIESDTFEPGLNEDVIRRLSELKQEPEFMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL M++P WA + YP + ++++ YY+APK     PQSLD+VDPELLRTYEKLGIP+ E+
Sbjct: 61  RWLEMEEPDWAHVNYPKVKYNEISYYSAPKRPEDMPQSLDEVDPELLRTYEKLGIPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVSVVTTFKE L+K+GVIF PISEA+ ++P+LVKKYL +VVP
Sbjct: 121 AKLAG-----VAVDAVFDSVSVVTTFKEPLEKAGVIFCPISEAVQKYPELVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DN++AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVS
Sbjct: 176 AADNYFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADEGSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELV L +A+IKYSTVQNWYPGD  GKGGIYNFVTKR  C 
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVLLKDAQIKYSTVQNWYPGDENGKGGIYNFVTKRAACI 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SK+SWTQ+ETGSA+TWKYPSC+LRG+ S GEFYS+A+++ +QQ D+GTKM+HL KNT
Sbjct: 296 GDNSKVSWTQVETGSAVTWKYPSCILRGDNSVGEFYSVALTHNYQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S ++SKGISAG S+NTYRG +  + GA  +RNFTQCDSLLIG+ CGAHT PYIESKN S
Sbjct: 356 RSTVISKGISAGRSSNTYRGLIKFNPGAEGARNFTQCDSLLIGDRCGAHTFPYIESKNKS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSK+SDE +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++
Sbjct: 416 AIVEHEATTSKVSDEQMFLCRQRGINAEQAVSMIVNGFCKEVFKELPMEFAVEAGKLLEV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|225467712|ref|XP_002272917.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 554

 Score =  546 bits (1408), Expect = e-153,   Method: Composition-based stats.
 Identities = 296/487 (60%), Positives = 367/487 (75%), Gaps = 5/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A   T DK++KI    YK+G+  NI  D  PKGL+E  IR IS +KNEPDWMLE+RL +Y
Sbjct: 73  ATSSTDDKLQKILNRDYKWGWFENIDSDAIPKGLSEKTIRMISERKNEPDWMLEFRLKSY 132

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
            ++L MK+P W+  RYP IDF D+ YY+ PK      SLD+ DPELLR ++KLG+P+ EQ
Sbjct: 133 EKFLKMKEPKWSDNRYPPIDFQDMCYYSEPKKKPSLNSLDEADPELLRYFDKLGVPLNEQ 192

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LA      VAVDAV DSVS+ TT ++ L+K+GVIF  ISEAI E+PDLV+KYL  VVP
Sbjct: 193 NRLA-----NVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVRKYLGRVVP 247

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DN+YAALNSAVF+DGSF Y+PK  +CPM++STYFRIN   TGQFERTLI+AD+ S+V 
Sbjct: 248 SDDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINALETGQFERTLIVADDRSFVE 307

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP  D NQLHAAVVEL   + AEIKYSTVQNWY GD +G+GGIYNFVTKRG C 
Sbjct: 308 YLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGLCS 367

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSKISWTQ+ETGSAITWKYPS +L G+ + GEFYS+A++N +QQ D+GTKM+H  KNT
Sbjct: 368 GARSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHKGKNT 427

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            SRI+SKGISAG S N YRG V V   A ++RN +QCDS+LIG+N  A+T PYI+ KN +
Sbjct: 428 RSRIISKGISAGNSRNCYRGLVQVQSKAKNARNSSQCDSMLIGDNAAANTYPYIQVKNPT 487

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKI ++ LFY  QRGI  E A+A +++GF ++V  +LP EF  E  +L+ +
Sbjct: 488 ARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCKDVFNELPDEFGAEVNQLMSL 547

Query: 483 SLEGSVG 489
            LEGSVG
Sbjct: 548 KLEGSVG 554


>gi|285017823|ref|YP_003375534.1| ABC transporter-associated protein involved in fe-s cluster
           assembly [Xanthomonas albilineans GPE PC73]
 gi|283473041|emb|CBA15546.1| probable abc transporter-associated protein involved in fe-s
           cluster assembly [Xanthomonas albilineans]
          Length = 480

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 320/489 (65%), Positives = 390/489 (79%), Gaps = 9/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E  + + ++   +Y  GF T+I+ D    GLNED++R +SAKK+EP WM EWRL 
Sbjct: 1   MA--TENAEILERLGR-RYDAGFVTDIESDAFLPGLNEDVVRALSAKKDEPAWMTEWRLA 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WL M  P WA++    IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ 
Sbjct: 58  AYRHWLKMPMPHWAKLDIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLH 116

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  LAG     VAVDAVFDSVSV TTF++EL + GVIF  +SEAI EHP+LVK+YL +V
Sbjct: 117 ERARLAG-----VAVDAVFDSVSVGTTFRKELAEKGVIFCSMSEAIKEHPELVKQYLGSV 171

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPVGDNF+AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ ++ +Y
Sbjct: 172 VPVGDNFFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEDKAY 231

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVAL++AEIKYSTVQNWYPGD +G+GGIYNFVTKRG+
Sbjct: 232 VSYLEGCTAPMRDENQLHAAVVELVALEDAEIKYSTVQNWYPGDEEGRGGIYNFVTKRGE 291

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RSKI+WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D+GTKM+H+ K
Sbjct: 292 CRGARSKIAWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQADTGTKMIHVGK 351

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
            T S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGAHT PYIE K+
Sbjct: 352 RTKSKIVSKGISAGHGQNTYRGLVKVERSAEGARNYTQCDSLLIGKRCGAHTFPYIEVKH 411

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKISD+ LFYC  RGI +E A+++IV+GF ++V ++LPMEFAVEA+KL+
Sbjct: 412 PTATVEHEATTSKISDDQLFYCRARGIDQENAVSMIVDGFCKQVFRELPMEFAVEAKKLL 471

Query: 481 DISLEGSVG 489
           ++SLEGSVG
Sbjct: 472 EVSLEGSVG 480


>gi|124022013|ref|YP_001016320.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. MIT 9303]
 gi|123962299|gb|ABM77055.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           MIT 9303]
          Length = 480

 Score =  546 bits (1407), Expect = e-153,   Method: Composition-based stats.
 Identities = 295/480 (61%), Positives = 375/480 (78%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V ++  + YKYGF T+I+ +K PKGL+ED++R IS KKNEP ++L++R+ AYR WL ++
Sbjct: 6   HVGQLVSEPYKYGFVTDIETEKIPKGLDEDVVRLISEKKNEPQFLLDFRIRAYRHWLKLQ 65

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA + YP ID+ D+ YYAAPK      SLD+VDP LL T++KLGIP+ EQ+ L+   
Sbjct: 66  TPDWAGLGYPPIDYQDIVYYAAPKQKEKKNSLDEVDPALLETFDKLGIPLSEQKRLS--- 122

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVS+ TT+KE+L + GV+F  I++A+ E+P+LV++YL TVVP  DN++A
Sbjct: 123 --NVAVDAVFDSVSIATTYKEKLAEHGVVFCSITDAVNEYPELVRRYLGTVVPSNDNYFA 180

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IP+GV CPMELS+YFRIN    GQFERTLI+A+EG+ VSYLEGCTA
Sbjct: 181 ALNSAVFSDGSFVFIPRGVECPMELSSYFRINSGDIGQFERTLIVAEEGASVSYLEGCTA 240

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D N LHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG C G RSKIS
Sbjct: 241 PMFDTNTLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGHCCGERSKIS 300

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           W+Q+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+HL   T S IVSK
Sbjct: 301 WSQVETGSAITWKYPSCILQGADSVGEFYSVALTNHRQQADTGTKMIHLGPRTRSTIVSK 360

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S N+YRG V +   A +++N++QCDS+LIG+  GA+T PYI S+    ++EHEA
Sbjct: 361 GISAGHSANSYRGLVQMGPKAVNAKNYSQCDSMLIGDQAGANTYPYIRSQQPDASIEHEA 420

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +T +IS++ LFY   RGI  EAAI++IV+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 421 STCRISEDQLFYLQSRGIDFEAAISMIVSGFCRDVFSQLPMEFAAEADKLLALKLEGSVG 480


>gi|167997033|ref|XP_001751223.1| ATP-binding cassette transporter, subfamily I, member 15, ABC
           component protein PpABCI15 [Physcomitrella patens subsp.
           patens]
 gi|162697204|gb|EDQ83540.1| ATP-binding cassette transporter, subfamily I, member 15, ABC
           component protein PpABCI15 [Physcomitrella patens subsp.
           patens]
          Length = 480

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 303/481 (62%), Positives = 369/481 (76%), Gaps = 5/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           D +++     YKYGF ++I+    PKGL+E+ +R ISAKKNEP+WML +RL A+++W  M
Sbjct: 5   DTIQQFLKRDYKYGFVSDIESVSIPKGLSEETVRLISAKKNEPEWMLNFRLNAFKQWQKM 64

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K+P+W+  +YP IDF D+ YY  PK     QSLD+VDP+LL T+ KLGIP+ EQ+ LA  
Sbjct: 65  KEPTWSDNKYPQIDFQDVCYYTEPKKKETKQSLDEVDPDLLETFAKLGIPLSEQKRLA-- 122

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVS+ TT ++ L  +GVIF  ISEAI E+PDLVKKYL  VVPV DN+Y
Sbjct: 123 ---NVAVDAVFDSVSIATTHRKTLMAAGVIFCSISEAIREYPDLVKKYLGKVVPVADNYY 179

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSF Y+PK    PME+STYFRIN   TGQFERTLI+ DE +YVSYLEGCT
Sbjct: 180 AALNSAVFSDGSFCYVPKDTVSPMEISTYFRINAMETGQFERTLIVCDENAYVSYLEGCT 239

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D+NQLHAAVVEL     AEIKYSTVQNWY GDS+GKGGIYNFVTKRG C G RSKI
Sbjct: 240 APAYDKNQLHAAVVELYCASGAEIKYSTVQNWYAGDSEGKGGIYNFVTKRGLCDGARSKI 299

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT SRIVS
Sbjct: 300 SWTQVETGSAITWKYPSVVLKGDNSIGEFYSVALTNNKQQADTGTKMIHVGKNTRSRIVS 359

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N YRG V V   A ++RNF+QCDS+LIG+  GA+T PYI  K+ S  +EHE
Sbjct: 360 KGISAGNSVNCYRGLVQVQPSAHNARNFSQCDSMLIGDQAGANTYPYITVKDPSARVEHE 419

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LFY  QRGI  E A+A I+ GF REV ++LP+EFA E  +L+ + LEGSV
Sbjct: 420 ASTSKIGEDQLFYFQQRGIDAEKAVAAIIGGFCREVFKELPLEFAAEVNQLMSLKLEGSV 479

Query: 489 G 489
           G
Sbjct: 480 G 480


>gi|168014025|ref|XP_001759559.1| ATP-binding cassette transporter, subfamily I, member 11, ABC
           component protein PpABCI11 [Physcomitrella patens subsp.
           patens]
 gi|162689098|gb|EDQ75471.1| ATP-binding cassette transporter, subfamily I, member 11, ABC
           component protein PpABCI11 [Physcomitrella patens subsp.
           patens]
          Length = 480

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 301/481 (62%), Positives = 369/481 (76%), Gaps = 5/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           D +++     YKYGF ++I+    PKGL+E+ +R ISAKKNEP+WML +RL A+++W  M
Sbjct: 5   DTIQQFLKRDYKYGFVSDIESVSIPKGLSENTVRLISAKKNEPEWMLNFRLNAFKQWQKM 64

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K+P+W+  +YP IDF D+ YY  PK     QSLD+VDP+LL T+ KLGIP+ EQ+ LA  
Sbjct: 65  KEPTWSDNKYPQIDFQDVCYYTEPKKKETKQSLDEVDPDLLETFAKLGIPLSEQKRLA-- 122

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVS+ TT ++ L  +GVIF  ISEAI E+PDLVKK+L  VVPV DN+Y
Sbjct: 123 ---NVAVDAVFDSVSIATTHRKTLMAAGVIFCSISEAIREYPDLVKKHLGKVVPVADNYY 179

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSF Y+PK    PME+STYFRIN   TGQFERTLI+ DE +YVSYLEGCT
Sbjct: 180 AALNSAVFSDGSFCYVPKDTVSPMEISTYFRINAMETGQFERTLIVCDENAYVSYLEGCT 239

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D+NQLHAAVVEL     AEIKYSTVQNWY GDS+GKGGIYNFVTKRG C G +SKI
Sbjct: 240 APAYDKNQLHAAVVELYCASGAEIKYSTVQNWYAGDSEGKGGIYNFVTKRGLCDGAKSKI 299

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N  QQ D+GTKM+H+ KNT SRIVS
Sbjct: 300 SWTQVETGSAITWKYPSVVLKGDGSIGEFYSVALTNNKQQADTGTKMIHVGKNTRSRIVS 359

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N YRG V V   A ++RNF+QCDS+LIG+  GA+T PYI  K+ S  +EHE
Sbjct: 360 KGISAGNSVNCYRGLVQVQPSAHNARNFSQCDSMLIGDQAGANTYPYITVKDPSARVEHE 419

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TSKI ++ LFY  QRGI  E A+A I+ GF REV ++LP+EFA E  +L+ + LEGSV
Sbjct: 420 ASTSKIGEDQLFYFQQRGIDAEKAVAAIIGGFCREVFKELPLEFAAEVNQLMSLKLEGSV 479

Query: 489 G 489
           G
Sbjct: 480 G 480


>gi|330814303|ref|YP_004358542.1| iron-sulfur cluster assembly protein SufB [Candidatus Pelagibacter
           sp. IMCC9063]
 gi|327487398|gb|AEA81803.1| iron-sulfur cluster assembly protein SufB [Candidatus Pelagibacter
           sp. IMCC9063]
          Length = 483

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 334/490 (68%), Positives = 406/490 (82%), Gaps = 8/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +E ++   +    +Y  GF T+++    PKGL+E++++FIS +K EP WML+WRL 
Sbjct: 1   MSNGQEFINNYNQ--GTEYAQGFVTDVETIDVPKGLSEEVVKFISKQKKEPKWMLDWRLK 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPI 119
           A+ R  +MK+P W + +YP ID+ DLYYY+APKS    P+SLD++DPE+ +TY+KLGIP+
Sbjct: 59  AFERLQSMKEPDWQKPKYPKIDYQDLYYYSAPKSLQDQPKSLDEIDPEIRKTYDKLGIPL 118

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+G     +AVDAVFDSVSV TTFKE+L + GVIF  ISEA  EHP+LVKKYL +
Sbjct: 119 LEQKKLSG-----IAVDAVFDSVSVATTFKEKLGEIGVIFCSISEATREHPELVKKYLGS 173

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           V+P+ D+F+A LNSAVFTDGSFVYIP GVRCPMELSTYFRIN   TGQFERTLIIAD+GS
Sbjct: 174 VIPMSDHFFATLNSAVFTDGSFVYIPPGVRCPMELSTYFRINASNTGQFERTLIIADKGS 233

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA VELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG
Sbjct: 234 YVSYLEGCTAPMRDENQLHAANVELVALDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRG 293

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            CRG  SKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+AI+N +Q+ D+GTKM+HL 
Sbjct: 294 ACRGKNSKISWTQVETGSAITWKYPSCILQGDNSQGEFYSVAITNNYQKADTGTKMIHLG 353

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S+I+SKGISAG ++NTYRG VS+H  A  ++NFTQCDSLL+GN CGAHTIPYIE+K
Sbjct: 354 KNTRSKIISKGISAGHADNTYRGMVSIHPKATGAKNFTQCDSLLVGNKCGAHTIPYIENK 413

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N+S  +EHEATTSKIS++ LFYC QRG+ +E A++LIVNGF +EVLQ+LPMEFAVEAQKL
Sbjct: 414 NASSEIEHEATTSKISEDQLFYCRQRGLNQEEAVSLIVNGFCKEVLQQLPMEFAVEAQKL 473

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 474 VGISLEGSVG 483


>gi|126668345|ref|ZP_01739303.1| component of SufBCD complex [Marinobacter sp. ELB17]
 gi|126627161|gb|EAZ97800.1| component of SufBCD complex [Marinobacter sp. ELB17]
          Length = 482

 Score =  546 bits (1406), Expect = e-153,   Method: Composition-based stats.
 Identities = 336/487 (68%), Positives = 395/487 (81%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +  T  +V ++   +Y++GF T I+ D    GLNED+I  +S  K EP+WMLEWRL AYR
Sbjct: 1   MATTDKEVNELVKREYEHGFVTEIESDTFEPGLNEDVIARLSGLKKEPEWMLEWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQ 122
           RWL M +P+WA + YP ID++ + YY+APK      QSLD+VDPELLRTYEKLGIP+ E+
Sbjct: 61  RWLEMDEPNWAHVGYPKIDYNSISYYSAPKRKEDMLQSLDEVDPELLRTYEKLGIPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           E LAG     VAVDAVFDSVSV TTFKE L K+GVIF  +SEAI EHP+LVKKYL +VVP
Sbjct: 121 EQLAG-----VAVDAVFDSVSVATTFKEPLAKAGVIFCSMSEAIQEHPELVKKYLGSVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNF+A LNSAVF+DG+FVYIPKGVRCPMELSTYFRIN   TGQFERTLIIA++ SYVS
Sbjct: 176 AGDNFFAGLNSAVFSDGTFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIAEDSSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVALD+A+IKYSTVQNWYPGD  GKGGI+NFVTKRG   
Sbjct: 236 YLEGCTAPMRDENQLHAAVVELVALDDAQIKYSTVQNWYPGDENGKGGIFNFVTKRGAAI 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSA+TWKYPSC+LRGE S GEFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 296 GKNSKISWTQVETGSAVTWKYPSCILRGENSVGEFYSVALTNNYQQADTGTKMIHLGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
           +S I++KGISA  S+N YRG V    GA  +RNFTQCDSLLIG+ CGAHT PYIESKN S
Sbjct: 356 SSTIIAKGISASNSSNAYRGLVKFGPGAEGARNFTQCDSLLIGDRCGAHTFPYIESKNKS 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISDE +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++
Sbjct: 416 GIIEHEATTSKISDEQMFLCRQRGINPEQAVSMIVNGFCKEVFKELPMEFAVEAGKLLEV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|254456451|ref|ZP_05069880.1| FeS assembly protein SufB [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083453|gb|EDZ60879.1| FeS assembly protein SufB [Candidatus Pelagibacter sp. HTCC7211]
          Length = 480

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 335/490 (68%), Positives = 403/490 (82%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   ++ ++ ++      YKYGF T+I+  +APKGLNED+I+FIS  K EP WMLE+RL 
Sbjct: 1   MDNRQKEIENLKD-----YKYGFSTDIENTRAPKGLNEDVIKFISNIKKEPSWMLEFRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+ R+  +K+P W + +YP ID+ DLYYY+APKS+   P+SLD++DP+LL TY+KLGIP+
Sbjct: 56  AFERFKQLKEPDWQKPKYPKIDYQDLYYYSAPKSMDDKPKSLDELDPKLLETYKKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +EQ  L G+     AVDAVFDSVSV TTF+EEL K G+IF PISEAI  HP+LVKKYL +
Sbjct: 116 QEQARLNGI-----AVDAVFDSVSVATTFREELSKLGIIFCPISEAIQNHPELVKKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           V+P  D+F+A LNSAVFTDGSF YIP+GV+CPMELSTYFRIN   TGQFERTLI+AD+GS
Sbjct: 171 VIPTTDHFFATLNSAVFTDGSFAYIPEGVKCPMELSTYFRINASNTGQFERTLIVADKGS 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA VEL+ALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG
Sbjct: 231 YVSYLEGCTAPMRDENQLHAANVELIALDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G  SKISWTQ+ETGSAITWKYPSC+L+G+ S GEFYSIAI+N  Q+ D+GTKM+HL 
Sbjct: 291 LCKGRNSKISWTQVETGSAITWKYPSCILKGDNSVGEFYSIAITNNHQKADTGTKMIHLG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S+I+SKGISAGFS+ TYRG V +   AA+S N+TQCDSLL+GN CGAHT+PYI++K
Sbjct: 351 KNTKSKIISKGISAGFSDMTYRGLVDISPKAANSNNYTQCDSLLMGNKCGAHTVPYIKNK 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NS  N+ HEATTSKIS+E L YC QRG+  E A+ LIVNGF +EVLQ+LPMEFAVEAQKL
Sbjct: 411 NSESNIAHEATTSKISEEQLHYCQQRGLNAEEAVGLIVNGFCKEVLQQLPMEFAVEAQKL 470

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 471 VGISLEGSVG 480


>gi|56459265|ref|YP_154546.1| cysteine desulfurase activator complex subunit SufB [Idiomarina
           loihiensis L2TR]
 gi|56178275|gb|AAV80997.1| Cysteine desulfurase activator SufB [Idiomarina loihiensis L2TR]
          Length = 478

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 336/482 (69%), Positives = 402/482 (83%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y  GF + I+ +  P GL+ED+I  +SA K EP+WMLEWRL AYR WL M
Sbjct: 3   EQIDQALARKYDAGFISEIESETFPIGLDEDVIARLSAIKGEPEWMLEWRLKAYRTWLKM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP +D+  + YY+APKS    P+SLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 63  EEPDWAHVDYPKVDYQSISYYSAPKSMKDKPKSLDEVDPELLRTYEKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+E+L+++GVIF PISEA+ ++PDLVKKYL TVVP GDNF
Sbjct: 123 -----VAVDAVFDSVSVVTTFREKLEEAGVIFCPISEALHKYPDLVKKYLGTVVPRGDNF 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLI+A+EGS+VSYLEGC
Sbjct: 178 FAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTLIVAEEGSHVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFVTKRGLC-EKNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+HL KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCILKGDNSVGEFYSVALTRGRQQADTGTKMIHLGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN YRG V +  GA  +RNFT+CDSLLIG+ CGAHT PYIES N +  +EH
Sbjct: 357 SKGISAGRSNNAYRGLVRMGPGAEGARNFTECDSLLIGDQCGAHTFPYIESSNPTAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SD+ LF C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDDQLFLCRQRGLDPEKAVSMIVNGFCKEVFRELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|317967992|ref|ZP_07969382.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. CB0205]
          Length = 480

 Score =  545 bits (1405), Expect = e-153,   Method: Composition-based stats.
 Identities = 296/484 (61%), Positives = 375/484 (77%), Gaps = 5/484 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
                V  +    YKYGF T+I+ +K  KGL+ED++R IS+KK+EP ++L++RL AYR+W
Sbjct: 2   SNAQAVGDLVSQPYKYGFVTDIETEKIAKGLSEDVVRLISSKKDEPSFLLDFRLRAYRQW 61

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           L M++P WA + YP ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L
Sbjct: 62  LQMEEPDWAALGYPPIDYQDVVYYAAPKQQEKKTSLDEVDPKLLETFDKLGIPLSEQKRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           +      VAVDAVFDSVS+ TT+KE+L + GV+F  ISEA+ E+P+L+++YL TVVP  D
Sbjct: 122 S-----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSISEAVKEYPELIERYLGTVVPSND 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP  D NQLHAAVVELV LD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG R
Sbjct: 237 GCTAPMFDTNQLHAAVVELVVLDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGAR 296

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           SKISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S 
Sbjct: 297 SKISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNMQQADTGTKMIHVGPRTRST 356

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           IVSKGISAG S+N+YRG V +   A  ++N++QCDS+LIG+   A+T PYI S+     +
Sbjct: 357 IVSKGISAGRSSNSYRGLVQIGPKATGAKNYSQCDSMLIGDQAAANTYPYIRSQQPQAAV 416

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LE
Sbjct: 417 EHEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLE 476

Query: 486 GSVG 489
           GSVG
Sbjct: 477 GSVG 480


>gi|147774138|emb|CAN76788.1| hypothetical protein VITISV_038836 [Vitis vinifera]
          Length = 554

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 295/487 (60%), Positives = 366/487 (75%), Gaps = 5/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A   T DK++KI    YK+G+  NI  D  PKGL+E  IR IS +KNEP WMLE+RL +Y
Sbjct: 73  ATSSTDDKLQKILNRDYKWGWFENIDSDAIPKGLSEKTIRMISERKNEPXWMLEFRLKSY 132

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
            ++L MK+P W+  RYP IDF D+ YY+ PK      SLD+ DPELLR ++KLG+P+ EQ
Sbjct: 133 EKFLKMKEPKWSDNRYPPIDFQDMCYYSEPKKKPSLNSLDEADPELLRYFDKLGVPLNEQ 192

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LA      VAVDAV DSVS+ TT ++ L+K+GVIF  ISEAI E+PDLV+KYL  VVP
Sbjct: 193 NRLA-----NVAVDAVLDSVSIATTHRKTLEKAGVIFCSISEAIREYPDLVRKYLGRVVP 247

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DN+YAALNSAVF+DGSF Y+PK  +CPM++STYFRIN   TGQFERTLI+AD+ S+V 
Sbjct: 248 SDDNYYAALNSAVFSDGSFCYVPKDTKCPMQISTYFRINALETGQFERTLIVADDRSFVE 307

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP  D NQLHAAVVEL   + AEIKYSTVQNWY GD +G+GGIYNFVTKRG C 
Sbjct: 308 YLEGCTAPSYDRNQLHAAVVELYCAEGAEIKYSTVQNWYAGDEEGRGGIYNFVTKRGLCS 367

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSKISWTQ+ETGSAITWKYPS +L G+ + GEFYS+A++N +QQ D+GTKM+H  KNT
Sbjct: 368 GARSKISWTQVETGSAITWKYPSVVLEGDDTVGEFYSVALTNNYQQADTGTKMIHKGKNT 427

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            SRI+SKGISAG S N YRG V V   A ++RN +QCDS+LIG+N  A+T PYI+ KN +
Sbjct: 428 RSRIISKGISAGNSRNCYRGLVQVQSKAXNARNSSQCDSMLIGDNAAANTYPYIQVKNPT 487

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKI ++ LFY  QRGI  E A+A +++GF ++V  +LP EF  E  +L+ +
Sbjct: 488 ARIEHEASTSKIGEDQLFYFQQRGIDYEKAMAAMISGFCKDVFNELPDEFGAEVNQLMSL 547

Query: 483 SLEGSVG 489
            LEGSVG
Sbjct: 548 KLEGSVG 554


>gi|319900398|ref|YP_004160126.1| Iron-regulated ABC transporter membrane component SufB [Bacteroides
           helcogenes P 36-108]
 gi|319415429|gb|ADV42540.1| Iron-regulated ABC transporter membrane component SufB [Bacteroides
           helcogenes P 36-108]
          Length = 506

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 316/487 (64%), Positives = 389/487 (79%), Gaps = 7/487 (1%)

Query: 5   RETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRR 64
           + + + VRKI  ++YKYGF T++  +    GLNEDI+R IS KK EP+W+LE+RL AYR 
Sbjct: 25  KPSNELVRKIAEEKYKYGFSTDVHTEVIECGLNEDIVRLISEKKGEPEWLLEFRLKAYRY 84

Query: 65  WLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG--PQSLDDVDPELLRTYEKLGIPIREQ 122
           WLT++ P WA +  P ID+  + YYA P       PQS+D+VDPEL++T+ KLGIP+ EQ
Sbjct: 85  WLTLEMPVWAHLHIPEIDYQAISYYADPTKKKKDTPQSMDEVDPELVKTFNKLGIPLEEQ 144

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLV+KYL +VVP
Sbjct: 145 MALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVQKYLGSVVP 199

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+A++ SYVS
Sbjct: 200 YRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVAEDDSYVS 259

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAA+VE+V  D AE+KYSTVQNWYPGD++G+GG+YNFVTKRG C+
Sbjct: 260 YLEGCTAPMRDENQLHAAIVEIVVHDRAEVKYSTVQNWYPGDAEGRGGVYNFVTKRGHCK 319

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N  QQ D+GTKM+HL +NT
Sbjct: 320 GVDSKLSWTQVETGSAITWKYPSCILSGDNSTAEFYSVAVTNNHQQADTGTKMIHLGRNT 379

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N +
Sbjct: 380 RSTIVSKGISAGQSENSYRGLVRVSAKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNET 439

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS++ +FYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ I
Sbjct: 440 AIVEHEATTSKISEDQIFYCNQRGISTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLAI 499

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 500 SLEGSVG 506


>gi|223936062|ref|ZP_03627976.1| FeS assembly protein SufB [bacterium Ellin514]
 gi|223895284|gb|EEF61731.1| FeS assembly protein SufB [bacterium Ellin514]
          Length = 482

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 306/487 (62%), Positives = 378/487 (77%), Gaps = 6/487 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +    D + +    +YKYGF ++I  +  P GLNED++R IS KKNEP +ML+WRL AYR
Sbjct: 1   MSTATDTIEEFVNKEYKYGFVSDIDTETIPPGLNEDVVRLISKKKNEPQFMLDWRLKAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WLT+K+P+W +  YP ID+    YYAAPK      SLD+VDPEL +T++KLGI + EQ+
Sbjct: 61  HWLTLKEPNWQKAEYPPIDYQASIYYAAPKPKKTLNSLDEVDPELRKTFDKLGISLDEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            ++GV    V          V TTF+++L K GVIF   SEA+ +HPDLV+KY+ +VVP 
Sbjct: 121 RISGVAVDAVVDSVS-----VATTFQKDLAKVGVIFCSFSEAVQKHPDLVEKYIGSVVPY 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSF YIPKGVRCPMELSTYFRIN   TGQFERTLIIA+EG+YVSY
Sbjct: 176 TDNFFAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINTANTGQFERTLIIAEEGAYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVA-LDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           LEGCTAP RDENQLHAAVVEL+A    +EIKYSTVQNWYPGD +GKGGIYNFVTKRG C+
Sbjct: 236 LEGCTAPMRDENQLHAAVVELIALGKKSEIKYSTVQNWYPGDKEGKGGIYNFVTKRGKCQ 295

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A+ N  QQ D+GTKM+H+ KNT
Sbjct: 296 GEGSKISWTQVETGSAITWKYPSVILQGDNSVGEFYSVALVNNRQQADTGTKMIHVGKNT 355

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG   N+YRG V + + A ++RNF+QCDSLLIG+ CGAHT PYIE KN++
Sbjct: 356 KSTIISKGISAGKGQNSYRGLVKIMKNAENARNFSQCDSLLIGDKCGAHTFPYIEVKNTT 415

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEA+TSKI ++ +FYC QRGI  + A+ +IVNGF +EV ++LPMEFAVEAQKL+ +
Sbjct: 416 GRIEHEASTSKIGEDQIFYCNQRGISTQDAVNMIVNGFCKEVFRELPMEFAVEAQKLLGV 475

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 476 SLEGSVG 482


>gi|113954469|ref|YP_731677.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. CC9311]
 gi|113881820|gb|ABI46778.1| FeS assembly protein SufB [Synechococcus sp. CC9311]
          Length = 479

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 297/483 (61%), Positives = 376/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R++    YKYGF T+I+ +K  KGL+E+++R ISAKKNEP+++L++RL AYR WL
Sbjct: 2   TSTSTRELVSQPYKYGFVTDIETEKIAKGLSEEVVRLISAKKNEPEFLLDFRLKAYRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
            +++P WA + Y  ID+ ++ YYAAPK     QSLD+VDP+LL T+EKLGIP+ EQ+ L+
Sbjct: 62  KLQEPDWAALGYKEIDYQEIVYYAAPKQQEKKQSLDEVDPKLLDTFEKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   SEA+ EHP+L++KYL +VVP  DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFSEAVVEHPELIEKYLGSVVPSSDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELV LD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVVLDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGDRS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNLQQADTGTKMIHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V V   A  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGRSSNSYRGLVQVGPNATGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T ++S++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRMSEDQLFYLQSRGIDFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|116695453|ref|YP_841029.1| cysteine desulfurase activator complex subunit SufB [Ralstonia
           eutropha H16]
 gi|113529952|emb|CAJ96299.1| iron sulfur cluster assembly protein (SufB) [Ralstonia eutropha
           H16]
          Length = 482

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 316/481 (65%), Positives = 392/481 (81%), Gaps = 6/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           K+ ++    YK+GF T ++ D  P GL+ED+IR ISA K EP++MLEWRL A+R WLTM 
Sbjct: 7   KLDELISHGYKHGFYTAVETDTVPCGLDEDVIRMISAIKGEPEFMLEWRLKAFRHWLTMS 66

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           +P WA + +P ID+  + YYAAP+S   GP++L +VDPELLRTYEKLG+P+ E+E+LAG 
Sbjct: 67  EPHWATVTHPPIDYQAIAYYAAPRSQKAGPKTLAEVDPELLRTYEKLGVPLHERELLAG- 125

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVSV TTFK++L + G+IF   SEA+ EHP LV++YL +VVP  DNF+
Sbjct: 126 ----VAVDAVFDSVSVATTFKQKLGELGIIFCSFSEAVREHPALVQQYLGSVVPYTDNFF 181

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           A+LNSAVF+DGSF YIP GVRCPMELSTYFRIN   TGQFERTLIIAD+G+YVSYLEGCT
Sbjct: 182 ASLNSAVFSDGSFCYIPPGVRCPMELSTYFRINASNTGQFERTLIIADQGAYVSYLEGCT 241

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RDENQLHAAVVEL+AL++A+IKY+TVQNWYPGD  GKGGIYNFVTKRGDCRG RSKI
Sbjct: 242 APMRDENQLHAAVVELIALEDAQIKYATVQNWYPGDKDGKGGIYNFVTKRGDCRGARSKI 301

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N +QQ D+GTKM HL +NT S I+S
Sbjct: 302 SWTQVETGSAITWKYPSVILQGDDSVGEFYSVALTNHYQQADTGTKMTHLGRNTRSTILS 361

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG   N YRG V + R A  +RN++QCDSLL+G+ C AHT PYIE KN++  +EHE
Sbjct: 362 KGISAGHGQNAYRGLVKMARSAVGARNYSQCDSLLLGDKCAAHTFPYIEVKNATGQVEHE 421

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+TS+I ++ LFYC  RG+  E A+++IVNGF +EV ++LPMEFAVEAQKL+ +SLEGS+
Sbjct: 422 ASTSRIGEDQLFYCQSRGVSAEDAVSMIVNGFCKEVFKELPMEFAVEAQKLLGVSLEGSI 481

Query: 489 G 489
           G
Sbjct: 482 G 482


>gi|33863873|ref|NP_895433.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. MIT 9313]
 gi|33635456|emb|CAE21781.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           MIT 9313]
          Length = 480

 Score =  545 bits (1404), Expect = e-153,   Method: Composition-based stats.
 Identities = 295/480 (61%), Positives = 375/480 (78%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            V ++  + YKYGF T+I+ +K PKGL+ED++R IS KKNEP ++L++R+ AYR WL ++
Sbjct: 6   HVGQLVSEPYKYGFVTDIETEKIPKGLDEDVVRLISEKKNEPQFLLDFRIRAYRHWLKLQ 65

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
            P WA + YP ID+ D+ YYAAPK      SL++VDP LL T++KLGIP+ EQ+ L+   
Sbjct: 66  TPDWAGLGYPPIDYQDIVYYAAPKQKEKKNSLEEVDPTLLETFDKLGIPLSEQKRLS--- 122

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVS+ TT+KE+L + GV+F  I++A+ EHP+LV++YL TVVP  DN++A
Sbjct: 123 --NVAVDAVFDSVSIATTYKEKLAEHGVVFCSITDAVNEHPELVRRYLGTVVPSNDNYFA 180

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSFV+IP+GV CPMELS+YFRIN    GQFERTLI+A+EG+ VSYLEGCTA
Sbjct: 181 ALNSAVFSDGSFVFIPRGVECPMELSSYFRINSGDIGQFERTLIVAEEGASVSYLEGCTA 240

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P  D N LHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG C G RSKIS
Sbjct: 241 PMFDTNTLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGHCCGARSKIS 300

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           W+Q+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+HL   T S IVSK
Sbjct: 301 WSQVETGSAITWKYPSCILQGADSVGEFYSVALTNHRQQADTGTKMIHLGPRTRSTIVSK 360

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S N+YRG V +   A +++N++QCDS+LIG+  GA+T PYI S+    ++EHEA
Sbjct: 361 GISAGHSANSYRGLVQMGPKAVNAKNYSQCDSMLIGDQAGANTYPYIRSQQPDASIEHEA 420

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +T +IS++ LFY   RGI  EAAI++IV+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 421 STCRISEDQLFYLQSRGIDFEAAISMIVSGFCRDVFSQLPMEFAAEADKLLALKLEGSVG 480


>gi|71897639|ref|ZP_00679884.1| FeS assembly protein SufB [Xylella fastidiosa Ann-1]
 gi|71732542|gb|EAO34595.1| FeS assembly protein SufB [Xylella fastidiosa Ann-1]
          Length = 555

 Score =  545 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 319/487 (65%), Positives = 385/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++D  +Y+ GF T I+ D  P GLNE IIR +SAKK+EP+WM EWRL AY
Sbjct: 76  ATPQNAEILERLDR-RYEAGFVTQIESDSLPPGLNETIIRALSAKKHEPEWMTEWRLAAY 134

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA++    IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 135 RHWLNMPMPEWAKLHIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 193

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVS+ TTF++EL + G+IF  ISEAI EHPDL+++YL +VVP
Sbjct: 194 ARLAG-----VAVDAVFDSVSLGTTFRKELAEKGIIFCSISEAIQEHPDLIRQYLGSVVP 248

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           V DN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ +E +YVS
Sbjct: 249 VRDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEEQAYVS 308

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVA ++AEIKYSTVQNWYPGD  G+GGIYNFVTKR +CR
Sbjct: 309 YLEGCTAPIRDENQLHAAVVELVAQEDAEIKYSTVQNWYPGDEAGRGGIYNFVTKRAECR 368

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK+ WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A++   QQ D+GTKM+H+ K T
Sbjct: 369 GARSKVIWTQVETGSAITWKYPSCVLLGDDSTGEFHSVALTRHHQQADTGTKMIHIGKRT 428

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V + R A  +RN TQCDSLLIG  CGAHT PYIE K+ +
Sbjct: 429 KSKIVSKGISAGHGQNTYRGLVKIDRNAEGARNHTQCDSLLIGKQCGAHTFPYIEVKHPN 488

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI EE A+++IV+GF ++V ++LPMEFAVEA+KLIDI
Sbjct: 489 ATVEHEATTSKISDDQLFYCRARGIAEEDAVSIIVDGFCKQVFRELPMEFAVEAKKLIDI 548

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 549 SLEGSVG 555


>gi|332886377|gb|EGK06621.1| hypothetical protein HMPREF9456_00495 [Dysgonomonas mossii DSM
           22836]
          Length = 485

 Score =  545 bits (1403), Expect = e-153,   Method: Composition-based stats.
 Identities = 330/487 (67%), Positives = 391/487 (80%), Gaps = 3/487 (0%)

Query: 4   VRETVDKV-RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           ++ET DK+   +    YKYGF T+I+ +  P GLNED++R ISAKKNEPDW+LE+RL AY
Sbjct: 1   MQETQDKILEDVTTADYKYGFVTDIETEVIPIGLNEDVVRLISAKKNEPDWLLEYRLKAY 60

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WLTMK P WA +  P ID+  + YYAAPK   GP+SLD+VDPELL+T++KLG+P+ E+
Sbjct: 61  RHWLTMKTPEWAHLEIPEIDYQSISYYAAPKKKDGPKSLDEVDPELLKTFDKLGVPLHER 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           EILAGVQT  V        VSV TTFKE L + G+IF   SEA+ EHP+LVKKYL +VVP
Sbjct: 121 EILAGVQTMAVDAVVDS--VSVKTTFKEVLAEKGIIFCAFSEAVQEHPELVKKYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+A++ SYVS
Sbjct: 179 YRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVAEDNSYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAA+VE++ALD AE+KYSTVQNWYPGD +GKGGIYNFVTKRG C+
Sbjct: 239 YLEGCTAPMRDENQLHAAIVEIIALDYAEVKYSTVQNWYPGDKEGKGGIYNFVTKRGICK 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+HL KNT
Sbjct: 299 GKGSKISWTQVETGSAITWKYPSCILAGDDSIGEFYSVALTNHYQQADTGTKMIHLGKNT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            SRIVSKGISAGFS N YRG V V   A  +RN +QCDSLL+G+ CGAHT PY +  N  
Sbjct: 359 KSRIVSKGISAGFSQNIYRGLVKVSPKAEGARNHSQCDSLLLGDKCGAHTFPYSDIANPG 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS++ + YC QRGI  E A+ LIVNG+ +EV+Q LPMEFAVEAQKL+ I
Sbjct: 419 AIIEHEATTSKISEDQILYCNQRGIGTEEAVGLIVNGYAKEVMQNLPMEFAVEAQKLLQI 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|78213792|ref|YP_382571.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. CC9605]
 gi|78198251|gb|ABB36016.1| FeS assembly protein SufB [Synechococcus sp. CC9605]
          Length = 479

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 297/483 (61%), Positives = 373/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+E+++R ISAKK EPD++L++RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIAKGLSEEVVRLISAKKEEPDFLLQFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + YP ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYPKIDYQDIIYYAAPKQQEKKASLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   SEA+ EHP+L+++YL TVV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFSEAVKEHPELIERYLGTVVSSNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPK V CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKSVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGDRS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNCQQADTGTKMVHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGRSSNSYRGLVQMGPNAKGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|34540102|ref|NP_904581.1| cysteine desulfurase activator complex subunit SufB [Porphyromonas
           gingivalis W83]
 gi|34396413|gb|AAQ65480.1| conserved hypothetical protein [Porphyromonas gingivalis W83]
          Length = 481

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 326/486 (67%), Positives = 398/486 (81%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           ++E  + + ++   +YKYGF T+I+ +   +GL+ED +R ISAKK EP+W+LE+RL AYR
Sbjct: 1   MQENNNILDEVTGSEYKYGFVTDIETETIGRGLSEDTVRLISAKKEEPEWLLEFRLNAYR 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            WL+MK+P WA +  P ID+ D+ YYAAPK   GP+SLD+VDPELL+T++KLGIP+ EQ+
Sbjct: 61  HWLSMKEPDWAHLNIPPIDYQDIIYYAAPKKKKGPKSLDEVDPELLKTFDKLGIPLEEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
           IL+G     +AVDAV DSVSV TTFKE+L + G+IF   SEA+ + PDLVKKYL TVV  
Sbjct: 121 ILSG-----MAVDAVMDSVSVKTTFKEKLAEKGIIFCSFSEAVKDFPDLVKKYLGTVVSS 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADE SYVSY
Sbjct: 176 KDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADEDSYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAPQRDENQLHAA+VE++A  NAE+KYSTVQNWYPGD +GKGGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPQRDENQLHAAIVEIIAETNAEVKYSTVQNWYPGDKEGKGGIYNFVTKRGVCKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N FQQ D+GTKM+HL KNT 
Sbjct: 296 DNSKISWTQVETGSAITWKYPSCVLRGDNSIAEFYSVAVTNNFQQADTGTKMIHLGKNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N+YRG V + + A ++RN +QCDSLL+ ++CGAHT PY + +N + 
Sbjct: 356 SRIVSKGISAGSSQNSYRGLVKISKNAVNARNHSQCDSLLLSDHCGAHTYPYADVQNDTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS+E +FYC QRGI  E A+ LIVNG+ +EV+ KL MEFAVEAQKL+ IS
Sbjct: 416 IIEHEATTSKISEEQIFYCNQRGIGTEEAVGLIVNGYAKEVMNKLLMEFAVEAQKLLSIS 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|307824108|ref|ZP_07654335.1| FeS assembly protein SufB [Methylobacter tundripaludum SV96]
 gi|307734892|gb|EFO05742.1| FeS assembly protein SufB [Methylobacter tundripaludum SV96]
          Length = 482

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 318/490 (64%), Positives = 394/490 (80%), Gaps = 9/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  +    ++ +   +YK GF T ++ D  P GL+E++I  +S  KNEP++MLE+RL 
Sbjct: 1   MSASEQE---IKNLIGKEYKQGFVTELETDTFPPGLDEEVIHRLSKVKNEPEFMLEYRLK 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+R W TMK P WA +++  ID+  + YY+APK    GP+SLD++DP++L  Y+KLGIP+
Sbjct: 58  AFRHWQTMKTPKWAFVKFDPIDYQAISYYSAPKRKEDGPKSLDEIDPQVLEAYKKLGIPL 117

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQE LAG     VAVDAVFDSVSV TTFK +L ++GVIF PISEA+ EHP+L+K+YL +
Sbjct: 118 DEQERLAG-----VAVDAVFDSVSVATTFKGKLHEAGVIFCPISEALREHPELIKQYLGS 172

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++AALN+AVFTDGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGS
Sbjct: 173 VVPHTDNYFAALNAAVFTDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADEGS 232

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           +VSYLEGCTAP RDENQLHAAVVEL+A+ +A IKYSTVQNWYPGD  G GGIYNFVTKR 
Sbjct: 233 HVSYLEGCTAPMRDENQLHAAVVELIAMKDAVIKYSTVQNWYPGDKNGLGGIYNFVTKRA 292

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG  SK+SWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+H+ 
Sbjct: 293 DCRGENSKVSWTQVETGSAITWKYPSCILTGDNSTGEFYSVALTNNYQQADTGTKMIHIG 352

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT+S I+SKGISAG + NTYRG V V + A ++RN+TQCDSLLIG+ CGAHT PY+E K
Sbjct: 353 KNTSSTIISKGISAGRAQNTYRGLVKVLKSAENARNYTQCDSLLIGDKCGAHTFPYVEVK 412

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
             S  +EHEATTSKIS++ LF+C QRG+  E A+++IVNGF +EV ++LPMEFAVEAQ L
Sbjct: 413 QPSAQVEHEATTSKISEDQLFFCQQRGLSAEDAVSMIVNGFCKEVFRELPMEFAVEAQAL 472

Query: 480 IDISLEGSVG 489
           + +SLEGSVG
Sbjct: 473 LGLSLEGSVG 482


>gi|255534219|ref|YP_003094590.1| cysteine desulfurase activator complex subunit SufB
           [Flavobacteriaceae bacterium 3519-10]
 gi|255340415|gb|ACU06528.1| Iron-sulfur cluster assembly protein SufB [Flavobacteriaceae
           bacterium 3519-10]
          Length = 482

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 331/489 (67%), Positives = 399/489 (81%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E   +V  ++  +Y+YG+ET+I+ D+ P GLNE I+R ISAKKNEP+WM EWRL 
Sbjct: 1   MSKYTEDDLRV-DLENQKYEYGWETDIEYDEFPIGLNEGIVRMISAKKNEPEWMTEWRLE 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R WL M++P+WA ++Y   DF  + YYAAPK      SLD+VDPELL+T+EKLGI I 
Sbjct: 60  AFRIWLKMEEPTWANVKYEKPDFQGITYYAAPKKKPELASLDEVDPELLKTFEKLGINIE 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ L+G     VAVD V DSVSV TTF+E LK+ G+IF  ISEAI ++PDLV+KY+  V
Sbjct: 120 EQKRLSG-----VAVDIVIDSVSVKTTFQETLKEKGIIFCAISEAIRDYPDLVRKYIGKV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP GDNFYAALNSAVF+DGSF YIPKGV+CPMELSTYFRIN+ G+GQFERTL+IADEGSY
Sbjct: 175 VPRGDNFYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINQSGSGQFERTLLIADEGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+A+D+AEIKYSTVQNW+PGD+ GKGG++NFVTKRG 
Sbjct: 235 VSYLEGCTAPARDENQLHAAVVELIAMDDAEIKYSTVQNWFPGDASGKGGVFNFVTKRGI 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C   R+KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N  Q  D+GTKM+H+ K
Sbjct: 295 C-ETRAKISWTQVETGSAVTWKYPSCILKGDHSIGEFYSIAVTNNHQYADTGTKMIHIGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG SNN+YRG V V   A  +RNF+QCDSLL+GN+CGAHT PYIE K+
Sbjct: 354 NTRSTIISKGISAGKSNNSYRGLVKVMPSAKGARNFSQCDSLLMGNDCGAHTFPYIEIKD 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  LEHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFA+EAQKL+
Sbjct: 414 PTAQLEHEATTSKIGEDQIFYCNQRGINTEKAIALIVNGFGKEVLNKLPMEFAIEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|71083442|ref|YP_266161.1| cysteine desulfurase activator complex subunit SufB [Candidatus
           Pelagibacter ubique HTCC1062]
 gi|71062555|gb|AAZ21558.1| FeS assembly protein SufB [Candidatus Pelagibacter ubique HTCC1062]
          Length = 480

 Score =  544 bits (1402), Expect = e-152,   Method: Composition-based stats.
 Identities = 341/490 (69%), Positives = 410/490 (83%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  + ++K++      YKYGF T+I+  +APKGLNE++I+FIS  K EP WML+WRL 
Sbjct: 1   MDAREKEIEKLKD-----YKYGFSTDIENTRAPKGLNEEVIKFISNIKKEPQWMLDWRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+ R   +K+P+W + +YP ID+ DLYYY+APKS+   P+SLD++DP+LL TY KLGIP+
Sbjct: 56  AFERLKQLKEPNWQKPKYPKIDYQDLYYYSAPKSMDDKPKSLDELDPKLLETYNKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +EQ  L G+     AVDAVFDSVSV TTFK EL K G+IF  +SEAI +HP+LVKKYL +
Sbjct: 116 QEQARLNGI-----AVDAVFDSVSVATTFKGELNKKGIIFCSMSEAIQDHPELVKKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           V+P+ D+++A LNSAVFTDGSFVYIP+GVRCPMELSTYFRIN   TGQFERTLIIAD+GS
Sbjct: 171 VIPISDHYFATLNSAVFTDGSFVYIPEGVRCPMELSTYFRINATETGQFERTLIIADKGS 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA VELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG
Sbjct: 231 YVSYLEGCTAPMRDENQLHAANVELVALDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G  SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIAI+N  Q+ D+GTKM+HL 
Sbjct: 291 LCKGKNSKISWTQVETGSAITWKYPSCILMGDNSVGEFYSIAITNNHQKADTGTKMIHLG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S+I+SKGISAGF++NTYRG V + + A ++RNFTQCDSLL+GN CGAHT+PYI++K
Sbjct: 351 KNTKSKIISKGISAGFADNTYRGLVDISKNADNARNFTQCDSLLMGNKCGAHTVPYIKNK 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NSS N+EHEATTSKISDE LFYC QRG+ +E A++LIVNGF +EVLQ+LPMEFAVEAQKL
Sbjct: 411 NSSSNIEHEATTSKISDEQLFYCNQRGLNQEEAVSLIVNGFCKEVLQQLPMEFAVEAQKL 470

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 471 VGISLEGSVG 480


>gi|91762135|ref|ZP_01264100.1| FeS assembly protein SufB [Candidatus Pelagibacter ubique HTCC1002]
 gi|91717937|gb|EAS84587.1| FeS assembly protein SufB [Candidatus Pelagibacter ubique HTCC1002]
          Length = 480

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 341/490 (69%), Positives = 410/490 (83%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A  + ++K++      YKYGF T+I+  +APKGLNE++I+FIS  K EP WML+WRL 
Sbjct: 1   MDAREKEIEKLKD-----YKYGFSTDIENTRAPKGLNEEVIKFISNIKKEPQWMLDWRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+ R   +K+P+W + +YP ID+ DLYYY+APKS+   P+SLD++DP+LL TY KLGIP+
Sbjct: 56  AFERLKQLKEPNWQKPKYPKIDYQDLYYYSAPKSMDDKPKSLDELDPKLLETYNKLGIPL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
           +EQ  L G+     AVDAVFDSVSV TTFK EL K G+IF  +SEAI +HP+LVKKYL +
Sbjct: 116 QEQARLNGI-----AVDAVFDSVSVATTFKGELNKKGIIFCSMSEAIQDHPELVKKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           V+P+ D+++A LNSAVFTDGSFVYIP+GVRCPMELSTYFRIN   TGQFERTLIIAD+GS
Sbjct: 171 VIPISDHYFATLNSAVFTDGSFVYIPEGVRCPMELSTYFRINATETGQFERTLIIADKGS 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA VELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG
Sbjct: 231 YVSYLEGCTAPMRDENQLHAANVELVALDDAEIKYSTVQNWYPGDKDGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G  SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIAI+N  Q+ D+GTKM+HL 
Sbjct: 291 LCKGKNSKISWTQVETGSAITWKYPSCILMGDNSVGEFYSIAITNNHQKADTGTKMIHLG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S+I+SKGISAGF++NTYRG V + + A ++RNFTQCDSLL+GN CGAHT+PYI++K
Sbjct: 351 KNTKSKIISKGISAGFADNTYRGLVDIAKNADNARNFTQCDSLLMGNKCGAHTVPYIKNK 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NSS N+EHEATTSKISDE LFYC QRG+ +E A++LIVNGF +EVLQ+LPMEFAVEAQKL
Sbjct: 411 NSSSNIEHEATTSKISDEQLFYCNQRGLNQEEAVSLIVNGFCKEVLQQLPMEFAVEAQKL 470

Query: 480 IDISLEGSVG 489
           + ISLEGSVG
Sbjct: 471 VGISLEGSVG 480


>gi|268317572|ref|YP_003291291.1| FeS assembly protein SufB [Rhodothermus marinus DSM 4252]
 gi|262335106|gb|ACY48903.1| FeS assembly protein SufB [Rhodothermus marinus DSM 4252]
          Length = 486

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 324/485 (66%), Positives = 395/485 (81%), Gaps = 11/485 (2%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM-- 68
           + +I   +YKYGFET+I+V+KAP GL+E++I +IS ++ EPDWM EWRL A+R ++++  
Sbjct: 7   LHQIAQSEYKYGFETDIEVEKAPPGLSEEVIHYISDRRGEPDWMREWRLRAFRYFMSLLE 66

Query: 69  ----KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEI 124
                 P WA ++YP IDF  + YYAAP+     +SLD+VDP++L T+ KLGIP+ EQ  
Sbjct: 67  RYEETYPRWAHLKYPDIDFQAISYYAAPQRKPRYKSLDEVDPKILETFRKLGIPLDEQMR 126

Query: 125 LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVG 184
           LAG     VAVDAV DSVSV TTFKEEL K G+IF  + EAI  +P+LVKKYL +VVP  
Sbjct: 127 LAG-----VAVDAVMDSVSVATTFKEELAKHGIIFCSMGEAIENYPELVKKYLGSVVPYT 181

Query: 185 DNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYL 244
           DNF+AALNSAVF+DGSFVY+PKGVRCPMELSTYFRIN  GTGQFERTLIIADEGSYVSYL
Sbjct: 182 DNFFAALNSAVFSDGSFVYVPKGVRCPMELSTYFRINTAGTGQFERTLIIADEGSYVSYL 241

Query: 245 EGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGM 304
           EGCTAP RDE+QLHAAVVEL+AL +AEIKYSTVQNWYPGD++GKGG+YNFVTKRG C G 
Sbjct: 242 EGCTAPMRDEHQLHAAVVELIALKDAEIKYSTVQNWYPGDAEGKGGVYNFVTKRGICLGE 301

Query: 305 RSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTS 364
            SKISWTQLETGSAITWKYPS +L+G+ S GEFYS+A + G+QQ D+GTKM+HL +NT S
Sbjct: 302 NSKISWTQLETGSAITWKYPSVILKGDNSVGEFYSVAFTKGYQQADTGTKMIHLGRNTRS 361

Query: 365 RIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCN 424
            I+SKGI+AG+SNN+YRG V V R A ++RNF+QCDS+L+G+ CGAHT PYIE +N +  
Sbjct: 362 TIISKGIAAGYSNNSYRGLVKVARTAENARNFSQCDSMLLGDKCGAHTFPYIEIENPTAR 421

Query: 425 LEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISL 484
           +EHEATTSKI ++ +FYC QRG+ EE AI LIVNGF +EVL +LPMEFA+EAQKL+ I L
Sbjct: 422 VEHEATTSKIGEDQIFYCQQRGLSEETAIKLIVNGFCKEVLAQLPMEFAMEAQKLLAIEL 481

Query: 485 EGSVG 489
           EGSVG
Sbjct: 482 EGSVG 486


>gi|298373683|ref|ZP_06983672.1| FeS assembly protein SufB [Bacteroidetes oral taxon 274 str. F0058]
 gi|298274735|gb|EFI16287.1| FeS assembly protein SufB [Bacteroidetes oral taxon 274 str. F0058]
          Length = 478

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 313/482 (64%), Positives = 386/482 (80%), Gaps = 6/482 (1%)

Query: 8   VDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLT 67
              +     ++YKYGF T+++ +  P GLNED++R IS KKNEP+W+L++RL A+  W  
Sbjct: 3   KQTIEDFTSNEYKYGFSTDVETEVIPIGLNEDVVRLISKKKNEPEWLLDFRLKAFAHWQK 62

Query: 68  MKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
              P+WA++  P ID+  + YYAAP+    P+SLD+VD ELL+T++KLG+P+ EQ++L G
Sbjct: 63  STMPTWAKLNIPPIDYQAISYYAAPR-KNSPKSLDEVDEELLKTFDKLGVPLHEQKMLTG 121

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                +AVDAV DSVSV TT+K+ L + G+IF  ISEA+  +PDL+K+YL TVVP  DN+
Sbjct: 122 -----MAVDAVMDSVSVKTTYKDTLAEKGIIFCSISEAVENYPDLIKQYLGTVVPYTDNY 176

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +A+LNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADE SYVSYLEGC
Sbjct: 177 FASLNSAVFSDGSFVYIPKGVRCPMELSTYFRINAINTGQFERTLIVADEDSYVSYLEGC 236

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAA+VE+V LDNAE+KYSTVQNWYPGD  G GGIYNFVTKR  CRG  +K
Sbjct: 237 TAPIRDENQLHAAIVEIVILDNAEVKYSTVQNWYPGDKNGNGGIYNFVTKRAICRGDNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPSC+L+G  S GEF+SIA++N +QQ D+GTKM+HL KNT SRIV
Sbjct: 297 ISWTQVETGSAITWKYPSCILKGNNSSGEFFSIAVTNNYQQADTGTKMIHLGKNTKSRIV 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S N+YRG V + +    +RNF+QCDSLL+ + CGAHT PY+ S+N S  +EH
Sbjct: 357 SKGISAGKSQNSYRGLVHIAKDTGSARNFSQCDSLLLSSECGAHTFPYMNSQNPSAVIEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKI++E LFYC QRGIP E A+ALI+NG+ +EVL KLPMEFAVEAQKL+ ISLEGS
Sbjct: 417 EATTSKINEEQLFYCNQRGIPTEDAVALIINGYAKEVLNKLPMEFAVEAQKLLSISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|194364779|ref|YP_002027389.1| cysteine desulfurase activator complex subunit SufB
           [Stenotrophomonas maltophilia R551-3]
 gi|194347583|gb|ACF50706.1| FeS assembly protein SufB [Stenotrophomonas maltophilia R551-3]
          Length = 491

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/499 (64%), Positives = 389/499 (77%), Gaps = 18/499 (3%)

Query: 1   MVAVRETVDKVRKIDV----------DQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNE 50
           M    ET++ V   D            +Y  GF T+I+ D  P GL+ED IR +SAKK E
Sbjct: 1   MA--TETIENVASDDTPNREIHEQLGRKYSAGFITDIESDSLPAGLDEDTIRALSAKKEE 58

Query: 51  PDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLR 110
           P+WM +WRL AYR +LTM  P+WA+++   ID   L YY+APK      SLDDV  ELL 
Sbjct: 59  PEWMTQWRLDAYRHFLTMPMPNWAKLQISPIDLQALSYYSAPKG-PKYASLDDVPKELLD 117

Query: 111 TYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
           TY+KLG+P+ E+  LAG     VAVDAVFDSVSV TTF++EL + G++F  +SEAI EHP
Sbjct: 118 TYDKLGVPLHERAKLAG-----VAVDAVFDSVSVGTTFRKELAEKGIVFCSMSEAIKEHP 172

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LVK+YL TVVPVGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFER
Sbjct: 173 ELVKQYLGTVVPVGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFER 232

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLII ++ +YVSYLEGCTAP RDENQLHAAVVELVAL++AEIKYSTVQNWYPGD  G GG
Sbjct: 233 TLIICEDKAYVSYLEGCTAPMRDENQLHAAVVELVALEDAEIKYSTVQNWYPGDENGVGG 292

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKR +CRG RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D
Sbjct: 293 IYNFVTKRAECRGARSKVTWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQAD 352

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           +GTKM+H+ K T S+I+SKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGA
Sbjct: 353 TGTKMIHVGKRTKSKIISKGISAGRGQNTYRGLVRVDRNADGARNYTQCDSLLIGKQCGA 412

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT PYIE KN    +EHEATTSKISD+ LFYC  RGI +E A+++IV+GF ++V ++LPM
Sbjct: 413 HTFPYIEVKNPGATVEHEATTSKISDDQLFYCRARGISQEDAVSMIVDGFCKQVFRELPM 472

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFAVEA+KL+++SLEGSVG
Sbjct: 473 EFAVEAKKLLEVSLEGSVG 491


>gi|119476388|ref|ZP_01616739.1| Cysteine desulfurase activator SufB [marine gamma proteobacterium
           HTCC2143]
 gi|119450252|gb|EAW31487.1| Cysteine desulfurase activator SufB [marine gamma proteobacterium
           HTCC2143]
          Length = 478

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 327/482 (67%), Positives = 399/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y+ GF ++I+ +    GL+ED+IR ISA K+EPDWMLEWRL A++ W  M
Sbjct: 3   EQIDQALEREYEAGFVSDIESETFAPGLDEDVIRRISAMKSEPDWMLEWRLKAFKTWQQM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + Y  IDF  + YY+APKS+   P+SLD+VDPELL TYEKLGIP+ EQ++LAG
Sbjct: 63  EEPEWAHVDYQKIDFQAISYYSAPKSMADKPKSLDEVDPELLATYEKLGIPLLEQQMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+E+L ++GVIF PISEA+ E+P+LVKKYL +VVP  DN+
Sbjct: 123 -----VAVDAVFDSVSVVTTFREKLWEAGVIFCPISEAVQEYPELVKKYLGSVVPQRDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALN AVFTDGSFVYIPKG RCPMELSTYFRINE+ TGQFERTLIIADEGS+VSYLEGC
Sbjct: 178 FAALNCAVFTDGSFVYIPKGTRCPMELSTYFRINEQNTGQFERTLIIADEGSHVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKR  C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFVTKRAVCH-TNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           +SWTQ+ETGSA+TWKYPSC+LRG+ S GEFYS+A++ G QQ D+GTKM+H+ KNT S I+
Sbjct: 297 VSWTQVETGSAVTWKYPSCILRGDNSIGEFYSVALTRGMQQADTGTKMIHMGKNTRSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN+YRG V +   A  +RNFTQCDSLLIG+ CGAHT PY+E+KN +  +EH
Sbjct: 357 SKGISAGRSNNSYRGLVRMGPRADGARNFTQCDSLLIGDQCGAHTFPYVETKNPTAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SD+ +F C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDDQMFLCQQRGLDAEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|161830538|ref|YP_001597202.1| cysteine desulfurase activator complex subunit SufB [Coxiella
           burnetii RSA 331]
 gi|165924047|ref|ZP_02219879.1| FeS assembly protein SufB [Coxiella burnetii RSA 334]
 gi|161762405|gb|ABX78047.1| FeS assembly protein SufB [Coxiella burnetii RSA 331]
 gi|165916506|gb|EDR35110.1| FeS assembly protein SufB [Coxiella burnetii RSA 334]
          Length = 480

 Score =  544 bits (1401), Expect = e-152,   Method: Composition-based stats.
 Identities = 330/479 (68%), Positives = 399/479 (83%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           +  I    Y++GF T+I+ D    GLNE++IR ISAKKNEP++ML+WRL AYR W+T++ 
Sbjct: 7   LETIVNKTYEHGFITDIETDVIAPGLNEEVIRLISAKKNEPNFMLDWRLKAYRHWVTLEA 66

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA +R+  ID+  + YYAAPKS   P+SL++VDP+LL TY KLGIP+ EQ+ LAG   
Sbjct: 67  PQWAHVRFNPIDYQAISYYAAPKSKKKPKSLEEVDPKLLETYTKLGIPLYEQQRLAG--- 123

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVSV TTFKE+L ++GVIF   SEA+ +HP+LV+KYL +VVP GDNF+A 
Sbjct: 124 --VAVDAVFDSVSVATTFKEKLAEAGVIFCSFSEAVQKHPELVEKYLGSVVPYGDNFFAT 181

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGCTAP
Sbjct: 182 LNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADEGSYVSYLEGCTAP 241

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
           QRDENQLHAAVVELVALDNA+I+Y+TVQNWYPGD +GKGGIYNFVTKRG CRG+ SKISW
Sbjct: 242 QRDENQLHAAVVELVALDNAQIRYATVQNWYPGDEEGKGGIYNFVTKRGACRGVNSKISW 301

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ KNT S I+SKG
Sbjct: 302 TQIETGSAITWKYPSVILKGDNSVGEFYSVALTNNFQQADTGTKMIHIGKNTRSTIISKG 361

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG   N+YRG V V   A ++RN++QCDSLL+GN CGAHT PY+E KN +  +EHEAT
Sbjct: 362 ISAGRGQNSYRGLVRVLPTAENARNYSQCDSLLLGNRCGAHTFPYMEIKNKTARVEHEAT 421

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFYC QRGI EE A+++IVNGF ++V QKLPMEFAVEAQKL+++SLEG+VG
Sbjct: 422 TSKIGEDQLFYCRQRGITEEDAVSMIVNGFCKQVFQKLPMEFAVEAQKLMEVSLEGAVG 480


>gi|87118504|ref|ZP_01074403.1| Cysteine desulfurase activator SufB [Marinomonas sp. MED121]
 gi|86166138|gb|EAQ67404.1| Cysteine desulfurase activator SufB [Marinomonas sp. MED121]
          Length = 478

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 331/482 (68%), Positives = 399/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           D++ K    +Y+ GF ++++ D    GL+E++IR IS  KNEP+WMLE RL A++ W  M
Sbjct: 3   DQIDKALEREYEAGFVSDVESDTFEPGLDENVIRRISTMKNEPEWMLEARLKAFKVWQEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + Y  IDF  + Y++APKS    P+SLD+VDPEL+RTYEKLGIP+ EQ++LAG
Sbjct: 63  EEPDWAHVDYEKIDFQAISYFSAPKSMKDKPKSLDEVDPELIRTYEKLGIPLIEQQMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+E+L ++GVIF PISEAI  HP+LVKKYL +VVP  DN+
Sbjct: 123 -----VAVDAVFDSVSVVTTFREKLSEAGVIFCPISEAIQNHPELVKKYLGSVVPTKDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALN AVFTDGSFVYIPKG RCPMELSTYFRINE+ TGQFERTLIIADEGS+VSYLEGC
Sbjct: 178 YAALNCAVFTDGSFVYIPKGTRCPMELSTYFRINEQNTGQFERTLIIADEGSHVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVALD+AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDENGKGGIYNFVTKRGICH-TNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+HL KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSVALTRGAQQADTGTKMIHLGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN+YRG V ++ GA  +RNFTQCDSLLIG+ CGAHT PY+ES+N S  +EH
Sbjct: 357 SKGISAGRSNNSYRGLVRMNPGADGARNFTQCDSLLIGDQCGAHTFPYVESRNPSAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SD+ +F C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDDQMFLCQQRGLDPEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|318040529|ref|ZP_07972485.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. CB0101]
          Length = 480

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 298/484 (61%), Positives = 374/484 (77%), Gaps = 5/484 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
                V  +    YKYGF T+I+ +K  KGL+ED++R IS+KK EP ++LE+RL AY++W
Sbjct: 2   SNAQAVGDLVSQPYKYGFVTDIETEKIAKGLSEDVVRLISSKKEEPAFLLEFRLRAYKQW 61

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           L M +P WA + YP ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L
Sbjct: 62  LQMSEPDWAALGYPPIDYQDVVYYAAPKHQQKKASLDEVDPKLLETFDKLGIPLSEQKRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           +      VAVDAVFDSVS+ TT+KE+L + GVIF  ISEA+ EHP+L+++Y+ TVVP  D
Sbjct: 122 S-----NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAVKEHPELIERYIGTVVPSND 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG R
Sbjct: 237 GCTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGDR 296

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           SKISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   + S 
Sbjct: 297 SKISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNKQQADTGTKMIHVGPRSRST 356

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           IVSKGISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+    ++
Sbjct: 357 IVSKGISAGRSANSYRGLVQIGPKAVGARNYSQCDSMLIGDQAAANTYPYIRSQQPQASV 416

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LE
Sbjct: 417 EHEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLE 476

Query: 486 GSVG 489
           GSVG
Sbjct: 477 GSVG 480


>gi|209364077|ref|YP_001424795.2| cysteine desulfurase activator complex subunit SufB [Coxiella
           burnetii Dugway 5J108-111]
 gi|215919169|ref|NP_820349.2| cysteine desulfurase activator complex subunit SufB [Coxiella
           burnetii RSA 493]
 gi|206584053|gb|AAO90863.2| ABC transporter-associated protein [Coxiella burnetii RSA 493]
 gi|207082010|gb|ABS78228.2| ABC transporter-associated protein [Coxiella burnetii Dugway
           5J108-111]
          Length = 484

 Score =  543 bits (1400), Expect = e-152,   Method: Composition-based stats.
 Identities = 330/479 (68%), Positives = 399/479 (83%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           +  I    Y++GF T+I+ D    GLNE++IR ISAKKNEP++ML+WRL AYR W+T++ 
Sbjct: 11  LETIVNKTYEHGFITDIETDVIAPGLNEEVIRLISAKKNEPNFMLDWRLKAYRHWVTLEA 70

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA +R+  ID+  + YYAAPKS   P+SL++VDP+LL TY KLGIP+ EQ+ LAG   
Sbjct: 71  PQWAHVRFNPIDYQAISYYAAPKSKKKPKSLEEVDPKLLETYTKLGIPLYEQQRLAG--- 127

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVSV TTFKE+L ++GVIF   SEA+ +HP+LV+KYL +VVP GDNF+A 
Sbjct: 128 --VAVDAVFDSVSVATTFKEKLAEAGVIFCSFSEAVQKHPELVEKYLGSVVPYGDNFFAT 185

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGCTAP
Sbjct: 186 LNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADEGSYVSYLEGCTAP 245

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
           QRDENQLHAAVVELVALDNA+I+Y+TVQNWYPGD +GKGGIYNFVTKRG CRG+ SKISW
Sbjct: 246 QRDENQLHAAVVELVALDNAQIRYATVQNWYPGDEEGKGGIYNFVTKRGACRGVNSKISW 305

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ KNT S I+SKG
Sbjct: 306 TQIETGSAITWKYPSVILKGDNSVGEFYSVALTNNFQQADTGTKMIHIGKNTRSTIISKG 365

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG   N+YRG V V   A ++RN++QCDSLL+GN CGAHT PY+E KN +  +EHEAT
Sbjct: 366 ISAGRGQNSYRGLVRVLPTAENARNYSQCDSLLLGNRCGAHTFPYMEIKNKTARVEHEAT 425

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFYC QRGI EE A+++IVNGF ++V QKLPMEFAVEAQKL+++SLEG+VG
Sbjct: 426 TSKIGEDQLFYCRQRGITEEDAVSMIVNGFCKQVFQKLPMEFAVEAQKLMEVSLEGAVG 484


>gi|254786628|ref|YP_003074057.1| cysteine desulfurase activator complex subunit SufB [Teredinibacter
           turnerae T7901]
 gi|237684992|gb|ACR12256.1| FeS assembly protein SufB [Teredinibacter turnerae T7901]
          Length = 479

 Score =  543 bits (1399), Expect = e-152,   Method: Composition-based stats.
 Identities = 331/482 (68%), Positives = 399/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++  +   +Y  GF T+I+ D  P GL+ED+IRFIS+KKNEP WML+WRL AY  WL M
Sbjct: 4   EQIDHLIKKEYAAGFVTDIESDTLPPGLDEDVIRFISSKKNEPQWMLDWRLKAYHAWLDM 63

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP IDF+++ Y++APKS+   P+SLD+VDP+LL TY KLGIP+ EQ  LAG
Sbjct: 64  QEPEWAHVHYPKIDFNEVSYFSAPKSMADKPKSLDEVDPQLLETYNKLGIPLHEQAALAG 123

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSV TTF+E LK++GVIF  ISEA+ E+P+LV+KYL +VVP  DNF
Sbjct: 124 -----VAVDAVFDSVSVGTTFRENLKEAGVIFCSISEAVHEYPELVQKYLGSVVPQKDNF 178

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALN AVF+DGSFVYIPKGVRCPMELSTYFRINE  TGQFERTLIIADEGS VSYLEGC
Sbjct: 179 YAALNCAVFSDGSFVYIPKGVRCPMELSTYFRINESKTGQFERTLIIADEGSQVSYLEGC 238

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALDNA IKYSTVQNWYPGD QG+GGIYNFVTKRG      S+
Sbjct: 239 TAPMRDENQLHAAVVELVALDNAYIKYSTVQNWYPGDEQGRGGIYNFVTKRGVAH-TNSR 297

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGS++TWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+HL KNT S I+
Sbjct: 298 ISWTQVETGSSVTWKYPSCVLKGDNSVGEFYSVALTNNYQQADTGTKMIHLGKNTRSTII 357

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S+N YRG V ++ GA+ +RN+TQCDSLLIG+ C AHT PYIESKN S  +EH
Sbjct: 358 SKGISAGKSSNAYRGLVRMNPGASGARNYTQCDSLLIGDKCAAHTFPYIESKNPSAVVEH 417

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SD+ L+ C QRGI EE A+++IVNGF +EV ++LPMEFAVEA KL+++SLEGS
Sbjct: 418 EATTSKVSDDQLYLCKQRGIDEEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEVSLEGS 477

Query: 488 VG 489
           VG
Sbjct: 478 VG 479


>gi|78183983|ref|YP_376418.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. CC9902]
 gi|78168277|gb|ABB25374.1| Iron-regulated ABC transporter membrane component SufB
           [Synechococcus sp. CC9902]
          Length = 479

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 293/483 (60%), Positives = 373/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+E+++R IS+KK+EP+++L +RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIDKGLSEEVVRLISSKKDEPEFLLNFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + Y  ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYEPIDYQDIIYYAAPKQQAKKSSLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   +EA+ +HP+L++KYL +VV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFTEAVKDHPELIEKYLGSVVASNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELV LD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVVLDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGARS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNCQQADTGTKMIHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +  GA  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGRSSNSYRGLVQMSPGAKGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|284929293|ref|YP_003421815.1| Iron-regulated ABC transporter membrane component SufB
           [cyanobacterium UCYN-A]
 gi|284809737|gb|ADB95434.1| Iron-regulated ABC transporter membrane component SufB
           [cyanobacterium UCYN-A]
          Length = 480

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 304/490 (62%), Positives = 388/490 (79%), Gaps = 11/490 (2%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M A       V+ +    YKYGF T+I+ D  P GLNE+++R ISAKK+EPD+ML++RL 
Sbjct: 1   MNAT-----TVKNLVNQPYKYGFVTDIESDTIPCGLNEEVVRLISAKKDEPDFMLDFRLK 55

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPI 119
           A+++W  M +PSWA + YP ID+ ++ YYAAPK       +LD+VDP L+ T+ KLGI +
Sbjct: 56  AFKQWQKMVEPSWAHVTYPKIDYQNIIYYAAPKQKKEKLNNLDEVDPALIETFNKLGISL 115

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ L+      VAVD +FDSVS+VTTFKE+L +SGVIF  ISEA+  +P+LVKKYL +
Sbjct: 116 SEQKRLS-----NVAVDVIFDSVSIVTTFKEKLSESGVIFCSISEALKLYPELVKKYLGS 170

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           V+P+ DNF++ALNSAVF+DGSF +IPKGV+CPMELSTYFRIN   +GQFERTLI+A+EG+
Sbjct: 171 VIPITDNFFSALNSAVFSDGSFAFIPKGVKCPMELSTYFRINNGSSGQFERTLIVAEEGA 230

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
            VSYLEGCTAP  D NQLHAAVVELVALDNA IKYSTVQNWY GD +GKGGIYNFVTKRG
Sbjct: 231 SVSYLEGCTAPMFDTNQLHAAVVELVALDNASIKYSTVQNWYAGDEKGKGGIYNFVTKRG 290

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C+G+ SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYSIA++N  QQ D+GTKM+H+ 
Sbjct: 291 LCKGVNSKISWTQVETGSAITWKYPSCVLLGDNSIGEFYSIALTNNKQQADTGTKMIHIG 350

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           +NT S I+SKGISAG S N+YRG V ++  A  +RN++QCDS+LIG+N  A+T PYI++ 
Sbjct: 351 ENTRSTIISKGISAGNSKNSYRGLVKMNPKAKGARNYSQCDSMLIGDNAEANTFPYIQAN 410

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N++  +EHEA+TSKI ++ LFY  QRGIPEE A+++IV+GF ++VL +LPMEFA EA KL
Sbjct: 411 NNTTKVEHEASTSKIGEDQLFYFAQRGIPEEDAVSIIVSGFCKDVLNELPMEFASEADKL 470

Query: 480 IDISLEGSVG 489
           + + LEGSVG
Sbjct: 471 LSLKLEGSVG 480


>gi|212212265|ref|YP_002303201.1| cysteine desulfurase activator complex subunit SufB [Coxiella
           burnetii CbuG_Q212]
 gi|212010675|gb|ACJ18056.1| ABC transporter-associated protein [Coxiella burnetii CbuG_Q212]
          Length = 484

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 330/479 (68%), Positives = 399/479 (83%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           +  I    Y++GF T+I+ D    GLNE++IR ISAKKNEP++ML+WRL AYR W+T++ 
Sbjct: 11  LETIVNKTYEHGFITDIETDVVAPGLNEEVIRLISAKKNEPNFMLDWRLKAYRHWVTLEA 70

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA +R+  ID+  + YYAAPKS   P+SL++VDP+LL TY KLGIP+ EQ+ LAG   
Sbjct: 71  PQWAHVRFNPIDYQAISYYAAPKSKKKPKSLEEVDPKLLETYTKLGIPLYEQQRLAG--- 127

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVSV TTFKE+L ++GVIF   SEA+ +HP+LV+KYL +VVP GDNF+A 
Sbjct: 128 --VAVDAVFDSVSVATTFKEKLAEAGVIFCSFSEAVQKHPELVEKYLGSVVPYGDNFFAT 185

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGCTAP
Sbjct: 186 LNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIIADEGSYVSYLEGCTAP 245

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
           QRDENQLHAAVVELVALDNA+I+Y+TVQNWYPGD +GKGGIYNFVTKRG CRG+ SKISW
Sbjct: 246 QRDENQLHAAVVELVALDNAQIRYATVQNWYPGDEEGKGGIYNFVTKRGACRGVNSKISW 305

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N FQQ D+GTKM+H+ KNT S I+SKG
Sbjct: 306 TQIETGSAITWKYPSVILKGDNSVGEFYSVALTNNFQQADTGTKMIHIGKNTRSTIISKG 365

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG   N+YRG V V   A ++RN++QCDSLL+GN CGAHT PY+E KN +  +EHEAT
Sbjct: 366 ISAGRGQNSYRGLVRVLPTAENARNYSQCDSLLLGNRCGAHTFPYMEIKNKTARVEHEAT 425

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           TSKI ++ LFYC QRGI EE A+++IVNGF ++V QKLPMEFAVEAQKL+++SLEG+VG
Sbjct: 426 TSKIGEDQLFYCRQRGITEEDAVSMIVNGFCKQVFQKLPMEFAVEAQKLMEVSLEGAVG 484


>gi|226228433|ref|YP_002762539.1| putative iron-sulfur cluster assembly protein SufB [Gemmatimonas
           aurantiaca T-27]
 gi|226091624|dbj|BAH40069.1| putative iron-sulfur cluster assembly protein SufB [Gemmatimonas
           aurantiaca T-27]
          Length = 477

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 311/480 (64%), Positives = 378/480 (78%), Gaps = 6/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            +  +   +Y+YGF T+I+ D  P GL ED +RFISAKK EP+W+LEWRL A+RRW TM 
Sbjct: 4   TIESLVNREYQYGFTTDIEADTLPPGLTEDTVRFISAKKQEPEWLLEWRLKAFRRWQTMA 63

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           +P WA + YP ID+    YY+APK+     SLD+VDP+LL TY KLGI + EQ+ L+G  
Sbjct: 64  EPHWANLHYPPIDYQAASYYSAPKNSKPLASLDEVDPKLLETYSKLGISLTEQKRLSG-- 121

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVSV TT+KEEL K GVIFM   EA+ EHP+LVKKYL +VVP  DNF+A
Sbjct: 122 ---VAVDAVFDSVSVGTTYKEELGKHGVIFMSFGEAVREHPELVKKYLGSVVPYSDNFFA 178

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSF YIPKGVRCPMELSTYFRIN   TGQFERTLI+ADEGSYVSYLEGCTA
Sbjct: 179 ALNSAVFSDGSFCYIPKGVRCPMELSTYFRINAAETGQFERTLIVADEGSYVSYLEGCTA 238

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           P+RD NQLHAAVVE+VALDNA +KYSTVQNWY GD  G GGIYNFVTKRG      +KIS
Sbjct: 239 PKRDTNQLHAAVVEIVALDNATVKYSTVQNWYAGDENGVGGIYNFVTKRGKAL-TNAKIS 297

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPS +L+G+ S GEFYS+A+++  QQ D+GTKM+H+ +NT S IVSK
Sbjct: 298 WTQVETGSAITWKYPSVILQGDNSVGEFYSVAVASKMQQADTGTKMIHIGRNTKSTIVSK 357

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISA    N+YRGKV +   A  +RN+TQCDS+L+GN CGAHT PY+E  N+S  LEHEA
Sbjct: 358 GISAMKGQNSYRGKVQILPKAEGARNYTQCDSMLVGNACGAHTFPYVEVGNNSATLEHEA 417

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI ++ +FY   RG+  E A+++IV+GF +EV ++LPMEFA+EAQ+L+ I+LEGSVG
Sbjct: 418 STSKIGEDQIFYLKARGLDAEQAVSMIVSGFCKEVFKELPMEFALEAQQLLGITLEGSVG 477


>gi|114797351|ref|YP_761308.1| cysteine desulfurase activator complex subunit SufB [Hyphomonas
           neptunium ATCC 15444]
 gi|114737525|gb|ABI75650.1| FeS assembly protein SufB [Hyphomonas neptunium ATCC 15444]
          Length = 504

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 356/494 (72%), Positives = 419/494 (84%), Gaps = 11/494 (2%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           TV+  ++++ + Y  GF T+I++D APKGL+ED +RFISAKKNEP+W+LEWRL AYRRWL
Sbjct: 11  TVEAAKRLESENYSAGFITDIEMDMAPKGLSEDTVRFISAKKNEPEWLLEWRLEAYRRWL 70

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           TM++PSWAR+ YP IDF   YYYAAPK+    +S+DDV  E+L  YEKLGIP+RE E+L 
Sbjct: 71  TMEEPSWARVHYPKIDFQAYYYYAAPKAGAKYKSIDDVPKEILEAYEKLGIPLREAEVLL 130

Query: 127 GVQT-----------SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKK 175
           GV+             +VAVDAVFDSVSV TTF+EELKK GVIFM ISEA+ EHP+LVKK
Sbjct: 131 GVEGAADTAAAAREKPRVAVDAVFDSVSVATTFREELKKVGVIFMSISEAVHEHPELVKK 190

Query: 176 YLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIA 235
           YL +VVP  DNFYA LNSAVF+DGSFVYIPKGVRCPMELSTYFR+N + TGQFERTLIIA
Sbjct: 191 YLGSVVPTSDNFYATLNSAVFSDGSFVYIPKGVRCPMELSTYFRMNAENTGQFERTLIIA 250

Query: 236 DEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFV 295
           DE +YVSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNW+PGD  GKGGI+NFV
Sbjct: 251 DEAAYVSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWWPGDEDGKGGIFNFV 310

Query: 296 TKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKM 355
           TKRGDCRG RSKISWTQ+ETGSA+TWKYPSC+LRG+ S GEFYSIA++NG QQ D+GTKM
Sbjct: 311 TKRGDCRGARSKISWTQVETGSAVTWKYPSCILRGDDSVGEFYSIAVTNGRQQADTGTKM 370

Query: 356 LHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPY 415
           +HL K T SRI+SKGISAG S+NTYRG VS+H+ A  +RNFTQCDSLLIG+ CGAHT+PY
Sbjct: 371 IHLGKRTKSRIISKGISAGKSDNTYRGLVSIHKKAEGARNFTQCDSLLIGDRCGAHTVPY 430

Query: 416 IESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVE 475
           IE++ +   LEHEATT+K+S++ LFY  QRGI EE A+AL+VNGFVREVLQ+LPMEFAVE
Sbjct: 431 IENRRADAQLEHEATTTKLSEDQLFYVRQRGIAEEQAVALLVNGFVREVLQELPMEFAVE 490

Query: 476 AQKLIDISLEGSVG 489
           AQKL+++SLEGSVG
Sbjct: 491 AQKLLEVSLEGSVG 504


>gi|152995373|ref|YP_001340208.1| cysteine desulfurase activator complex subunit SufB [Marinomonas
           sp. MWYL1]
 gi|150836297|gb|ABR70273.1| FeS assembly protein SufB [Marinomonas sp. MWYL1]
          Length = 478

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 330/482 (68%), Positives = 403/482 (83%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ K    +Y+ GF ++++ +    GL+E++IR IS  K EP+WMLEWRL A+R WL M
Sbjct: 3   EQIDKALAREYEAGFVSDVESETFEPGLDENVIRRISEMKGEPEWMLEWRLSAFREWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP IDF  + YY+APKS    P+SLD+VDPELLRTYEKLGIP+ EQ++LAG
Sbjct: 63  EEPEWALVDYPKIDFQSISYYSAPKSMKDKPKSLDEVDPELLRTYEKLGIPLIEQQMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           +     AVDAVFDSVSVVTTF+E+L+++GVIF PISEA+ ++PDLVKKY+ +VVP  DN+
Sbjct: 123 I-----AVDAVFDSVSVVTTFREKLEEAGVIFCPISEAVHKYPDLVKKYIGSVVPKKDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALN AVFTDGSFVYIPKG RCPMELSTYFRINE+ TGQFERTLIIADEGS+VSYLEGC
Sbjct: 178 YAALNCAVFTDGSFVYIPKGTRCPMELSTYFRINEQNTGQFERTLIIADEGSHVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVA+DNAEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVAMDNAEIKYSTVQNWYPGDENGKGGIYNFVTKRGICH-TNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGS++TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+H+ KNT S I+
Sbjct: 297 ISWTQVETGSSVTWKYPSCILKGDNSVGEFYSVALTRGRQQADTGTKMIHIGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN+YRG V ++ GA  +RNFTQCDSLLIG+ CGAHT PY+ES+N S  +EH
Sbjct: 357 SKGISAGRSNNSYRGLVRMNPGAEGARNFTQCDSLLIGDQCGAHTFPYVESRNPSAIIEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SDE +F C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDEQMFLCRQRGLDPEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|190573182|ref|YP_001971027.1| cysteine desulfurase activator complex subunit SufB
           [Stenotrophomonas maltophilia K279a]
 gi|190011104|emb|CAQ44713.1| conserved hypothetical protein [Stenotrophomonas maltophilia K279a]
          Length = 491

 Score =  543 bits (1398), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/499 (64%), Positives = 387/499 (77%), Gaps = 18/499 (3%)

Query: 1   MVAVRETVDKVRKIDV----------DQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNE 50
           M    ET++ V   D            +Y  GF T I+ D  P GL+ED IR +SAKK+E
Sbjct: 1   MA--TETIENVAHDDTPNREIHEQLGRKYSAGFITEIESDSLPPGLDEDTIRALSAKKDE 58

Query: 51  PDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLR 110
           P+WM +WRL AYR +LTM  P WA++    ID   L YY+APK      SLDDV  ELL 
Sbjct: 59  PEWMTQWRLDAYRHFLTMPMPDWAKLEIAPIDLQALSYYSAPKG-PKYASLDDVPKELLD 117

Query: 111 TYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
           TY+KLG+P+ E+  LAG     VAVDAVFDSVSV TTF++EL + G+IF  +SEAI EHP
Sbjct: 118 TYDKLGVPLHERAKLAG-----VAVDAVFDSVSVGTTFRKELAEKGIIFCSMSEAIKEHP 172

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LV++YL TVVPVGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFER
Sbjct: 173 ELVRQYLGTVVPVGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFER 232

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLI+ ++ +YVSYLEGCTAP RDENQLHAAVVELVAL++AEIKYSTVQNWYPGD  G GG
Sbjct: 233 TLIVCEDKAYVSYLEGCTAPMRDENQLHAAVVELVALEDAEIKYSTVQNWYPGDENGVGG 292

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKR +CRG RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D
Sbjct: 293 IYNFVTKRAECRGARSKVTWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQAD 352

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           +GTKM+H+ K T S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGA
Sbjct: 353 TGTKMIHVGKRTKSKIVSKGISAGRGQNTYRGLVRVDRNADGARNYTQCDSLLIGKQCGA 412

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT PYIE KN    +EHEATTSKISD+ LFYC  RGI +E A+++IV+GF ++V ++LPM
Sbjct: 413 HTFPYIEVKNPGATVEHEATTSKISDDQLFYCRARGISQEDAVSMIVDGFCKQVFRELPM 472

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFAVEA+KL+++SLEGSVG
Sbjct: 473 EFAVEAKKLLEVSLEGSVG 491


>gi|237716682|ref|ZP_04547163.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. D1]
 gi|262405458|ref|ZP_06082008.1| FeS assembly protein SufB [Bacteroides sp. 2_1_22]
 gi|315920744|ref|ZP_07916984.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. D2]
 gi|229442665|gb|EEO48456.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. D1]
 gi|262356333|gb|EEZ05423.1| FeS assembly protein SufB [Bacteroides sp. 2_1_22]
 gi|313694619|gb|EFS31454.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. D2]
          Length = 492

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/488 (65%), Positives = 395/488 (80%), Gaps = 6/488 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
             +   + VRK   ++YKYGF T +  D   +GLNED+IR IS+KK+EP+W+LE+RL AY
Sbjct: 10  EKKTDNEFVRKFAEEKYKYGFTTEVHTDIIERGLNEDVIRLISSKKDEPEWLLEFRLKAY 69

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           R WLT++ P+WA +R P ID+  + YYA P K   GP+S+++VDPEL++T+ KLGIP+ E
Sbjct: 70  RHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMEEVDPELIKTFNKLGIPLEE 129

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV
Sbjct: 130 QMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVV 184

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYV
Sbjct: 185 GYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYV 244

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C
Sbjct: 245 SYLEGCTAPMRDENQLHAAIVEIIVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNC 304

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KN
Sbjct: 305 KGVDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKN 364

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N 
Sbjct: 365 TRSTIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNE 424

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 425 TAVVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLT 484

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 485 ISLEGSVG 492


>gi|311746540|ref|ZP_07720325.1| FeS assembly protein SufB [Algoriphagus sp. PR1]
 gi|126575440|gb|EAZ79772.1| FeS assembly protein SufB [Algoriphagus sp. PR1]
          Length = 481

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 317/486 (65%), Positives = 392/486 (80%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           + +    + +    +Y++G+  N + D+AP GLNE+II++IS KK EP W+LEWRL A++
Sbjct: 1   MSKDNQILEEFTSKEYEHGWSVNYEADEAPVGLNEEIIKWISTKKEEPQWLLEWRLKAFK 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W +M +P+WA + YP ID   L YY+APK    P+SLD+VDPELL+ YE+LGI + EQ+
Sbjct: 61  TWESMVEPAWANVTYPKIDLQSLRYYSAPKQDKKPKSLDEVDPELLQIYERLGINLNEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L G+     AVDAV DSVSV TTFK+ L K G++F   SEA+ EHP+LVKKYL +VVP+
Sbjct: 121 KLQGI-----AVDAVLDSVSVGTTFKKTLSKLGIVFCSFSEAVKEHPELVKKYLGSVVPM 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN+YAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN   TGQFERTLI+A++ SYVSY
Sbjct: 176 TDNYYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINAANTGQFERTLIVAEDESYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAPQRDENQLHAAVVE+ A  NAE+KYSTVQNW+PGD  GKGGIYNFVTKRG C G
Sbjct: 236 LEGCTAPQRDENQLHAAVVEIYAAKNAEVKYSTVQNWFPGDKDGKGGIYNFVTKRGICAG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT 
Sbjct: 296 DNSKISWTQVETGSAVTWKYPSCILKGDNSIGEFYSVAVTNNYQQADTGTKMIHIGKNTK 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRIVSKGISAG S N+YRG+V V + A++SRNF+QCDSLL+G+ CGAHT PYI+  NS+ 
Sbjct: 356 SRIVSKGISAGKSQNSYRGQVQVMKRASNSRNFSQCDSLLMGDQCGAHTFPYIDIHNSTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ LFYC QRGI  E A+ALIVNG+ +EVL +LPMEFAVEAQKL+ ++
Sbjct: 416 KVEHEATTSKIGEDQLFYCNQRGISTEDAVALIVNGYAKEVLNQLPMEFAVEAQKLLALT 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|299147099|ref|ZP_07040166.1| FeS assembly protein SufB [Bacteroides sp. 3_1_23]
 gi|298514984|gb|EFI38866.1| FeS assembly protein SufB [Bacteroides sp. 3_1_23]
          Length = 492

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 321/488 (65%), Positives = 395/488 (80%), Gaps = 6/488 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
             +   + VRK   ++YKYGF T +  D   +GLNED+IR IS+KK+EP+W+LE+RL AY
Sbjct: 10  EKKTDNEFVRKFAEEKYKYGFTTEVHTDIIERGLNEDVIRLISSKKDEPEWLLEFRLKAY 69

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           R WLT++ P+WA +R P ID+  + YYA P K   GP+S+++VDPEL++T+ KLGIP+ E
Sbjct: 70  RHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMEEVDPELIKTFNKLGIPLEE 129

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV
Sbjct: 130 QMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVV 184

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLIIAD+ SYV
Sbjct: 185 GYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIIADDDSYV 244

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C
Sbjct: 245 SYLEGCTAPMRDENQLHAAIVEIIVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNC 304

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KN
Sbjct: 305 KGVDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKN 364

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N 
Sbjct: 365 TRSTIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNE 424

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 425 TAVVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLT 484

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 485 ISLEGSVG 492


>gi|237720414|ref|ZP_04550895.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 2_2_4]
 gi|229450165|gb|EEO55956.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. 2_2_4]
          Length = 492

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/488 (65%), Positives = 395/488 (80%), Gaps = 6/488 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
             +   + VRK   ++YKYGF T +  D   +GLNED+IR IS+KK+EP+W+LE+RL AY
Sbjct: 10  EKKTDNEFVRKFAEEKYKYGFTTEVHTDIIERGLNEDVIRLISSKKDEPEWLLEFRLKAY 69

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           R WLT++ P+WA +R P ID+  + YYA P K   GP+S+++VDPEL++T+ KLGIP+ E
Sbjct: 70  RHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSIEEVDPELIKTFNKLGIPLEE 129

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV
Sbjct: 130 QMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVV 184

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYV
Sbjct: 185 GYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYV 244

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C
Sbjct: 245 SYLEGCTAPMRDENQLHAAIVEIIVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNC 304

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KN
Sbjct: 305 KGVDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKN 364

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N 
Sbjct: 365 TRSTIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNE 424

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 425 TAVVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLT 484

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 485 ISLEGSVG 492


>gi|71274754|ref|ZP_00651042.1| FeS assembly protein SufB [Xylella fastidiosa Dixon]
 gi|71901190|ref|ZP_00683293.1| FeS assembly protein SufB [Xylella fastidiosa Ann-1]
 gi|71164486|gb|EAO14200.1| FeS assembly protein SufB [Xylella fastidiosa Dixon]
 gi|71729034|gb|EAO31162.1| FeS assembly protein SufB [Xylella fastidiosa Ann-1]
          Length = 555

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 317/487 (65%), Positives = 383/487 (78%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++D   Y+ GF T I+ D  P GLNE IIR +SAKK+EP+WM EWRL AY
Sbjct: 76  ATPQNAEILERLDR-HYEAGFVTQIESDSLPPGLNETIIRALSAKKHEPEWMTEWRLAAY 134

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA++    IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 135 RHWLNMPMPEWAKLHIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 193

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVS+ TTF++EL + G+IF  ISEAI EHPDL+++YL +VVP
Sbjct: 194 ARLAG-----VAVDAVFDSVSLGTTFRKELAEKGIIFCSISEAIQEHPDLIRQYLGSVVP 248

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           V DN++AALNSAVF+DGSFV+IPK VRCPMELSTYFRIN   TGQFERTLI+ +E +YVS
Sbjct: 249 VRDNYFAALNSAVFSDGSFVFIPKSVRCPMELSTYFRINAGHTGQFERTLIVCEEQAYVS 308

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVA ++AEIKYSTVQNWYPGD  G+GGIYNFVTKR +CR
Sbjct: 309 YLEGCTAPIRDENQLHAAVVELVAQEDAEIKYSTVQNWYPGDEAGRGGIYNFVTKRAECR 368

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK+ WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A++   QQ D+GTKM+H+ K T
Sbjct: 369 GARSKVIWTQVETGSAITWKYPSCVLLGDDSTGEFHSVALTRHHQQADTGTKMIHIGKRT 428

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V + R A  +RN TQCDSLLIG  CGAHT PYIE K+ +
Sbjct: 429 KSKIVSKGISAGHGQNTYRGLVKIDRNAEGARNHTQCDSLLIGKQCGAHTFPYIEVKHPN 488

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI EE A+++IV+GF ++V ++LPMEFAVEA+KL+DI
Sbjct: 489 ATVEHEATTSKISDDQLFYCRARGIAEEDAVSIIVDGFCKQVFRELPMEFAVEAKKLLDI 548

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 549 SLEGSVG 555


>gi|327404074|ref|YP_004344912.1| Iron-regulated ABC transporter membrane component SufB [Fluviicola
           taffensis DSM 16823]
 gi|327319582|gb|AEA44074.1| Iron-regulated ABC transporter membrane component SufB [Fluviicola
           taffensis DSM 16823]
          Length = 481

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 325/483 (67%), Positives = 390/483 (80%), Gaps = 6/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
             D  + ++  +YK+GF T+I+ D+AP GLNEDIIRFISAKK EP W+LE+RL  +  W 
Sbjct: 5   ENDLAKDLENSEYKFGFTTDIESDRAPIGLNEDIIRFISAKKEEPSWLLEYRLKCFHIWS 64

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
            M +P+WA I YP  +F  + YYAAPK     +S DDVDPE+  T  KLGI + EQ+ L 
Sbjct: 65  EMTEPTWAHISYPKPNFQGISYYAAPKQTKKYESWDDVDPEMKATMAKLGISMEEQQRLT 124

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
           G     VAVD V DSVSV T+FK +LK+ G+IF   SEA+ EHP+LVK+Y+ +VVP  DN
Sbjct: 125 G-----VAVDFVMDSVSVATSFKAKLKELGIIFCSFSEAVQEHPELVKQYMGSVVPATDN 179

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           FYAALNSAVFTDGSF YIPKGVRCPMELSTYFRINE  TGQFERTL+IADEGSYVSYLEG
Sbjct: 180 FYAALNSAVFTDGSFCYIPKGVRCPMELSTYFRINEANTGQFERTLVIADEGSYVSYLEG 239

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAPQRDENQLHAAVVELVAL++AEIKYSTVQNWYPGD  G+GGI+NFVTKRG C    +
Sbjct: 240 CTAPQRDENQLHAAVVELVALNDAEIKYSTVQNWYPGDKNGQGGIFNFVTKRGIC-ETNA 298

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+HL KNT S I
Sbjct: 299 KISWTQVETGSAVTWKYPSCILKGDNSIGEFYSVAVTNNYQQADTGTKMIHLGKNTKSTI 358

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           +SKGISAG S+N+YRG V +H+ A ++RNF+QCDSLL+ + CGAHT PYIE KN +  +E
Sbjct: 359 ISKGISAGKSHNSYRGLVQIHKNAHNARNFSQCDSLLMTDECGAHTFPYIECKNPTAKIE 418

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEATTSKI ++ +FYCLQRGI EE AI+LIVNG+ +EVL +LPMEFAVEAQKL+ ISLEG
Sbjct: 419 HEATTSKIGEDQIFYCLQRGISEEKAISLIVNGYCKEVLNQLPMEFAVEAQKLLTISLEG 478

Query: 487 SVG 489
           SVG
Sbjct: 479 SVG 481


>gi|254447014|ref|ZP_05060481.1| FeS assembly protein SufB [gamma proteobacterium HTCC5015]
 gi|198263153|gb|EDY87431.1| FeS assembly protein SufB [gamma proteobacterium HTCC5015]
          Length = 481

 Score =  542 bits (1397), Expect = e-152,   Method: Composition-based stats.
 Identities = 332/481 (69%), Positives = 396/481 (82%), Gaps = 6/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           K  ++   +Y++GF T I+ D    GLNED+IR +S  K EP++MLEWRL AYR+WL M+
Sbjct: 6   KPEELIKREYEHGFVTEIEADTFEPGLNEDVIRRLSKIKQEPEFMLEWRLNAYRQWLEME 65

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           +P WA + YP ID++ + YY+APK     PQSLDDVDPELL+TYEKLGIP+ E+E LAG 
Sbjct: 66  EPEWAHVNYPKIDYNAVSYYSAPKKKEDMPQSLDDVDPELLKTYEKLGIPLHEREKLAG- 124

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVSV TTFK++L  +GVIF PISEA+  HP+LV+KYL +VVP GDNFY
Sbjct: 125 ----VAVDAVFDSVSVATTFKDKLADAGVIFCPISEAVQTHPELVEKYLGSVVPAGDNFY 180

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           A LNSAVF+DGSFVYIPKGVRCP+ELSTYFRIN   TGQFERTLIIADEGSYVSYLEGCT
Sbjct: 181 ACLNSAVFSDGSFVYIPKGVRCPLELSTYFRINAANTGQFERTLIIADEGSYVSYLEGCT 240

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RDENQLHAAVVELVAL +A+IKYSTVQNWYPGD  GKGGIYNFVTKRG C G  SKI
Sbjct: 241 APMRDENQLHAAVVELVALGDAQIKYSTVQNWYPGDENGKGGIYNFVTKRGACLGDYSKI 300

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSA+TWKYPSC+LRG+ S GEFYS+A++N +QQ D+GTKM+H+ KNT+S I++
Sbjct: 301 SWTQVETGSAVTWKYPSCVLRGDHSVGEFYSVALTNNYQQADTGTKMIHIGKNTSSTIIA 360

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S+ +YRG V     A ++RNFTQCDSLLIG+ CGAHT PYIESK+ +  LEHE
Sbjct: 361 KGISAGRSDQSYRGLVRFAPTADNARNFTQCDSLLIGDQCGAHTFPYIESKHQNATLEHE 420

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSK+SDE LF C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++SLEG+V
Sbjct: 421 ATTSKVSDEQLFLCQQRGIDPEQAVSMIVNGFCKEVFKELPMEFAVEAGKLLEVSLEGAV 480

Query: 489 G 489
           G
Sbjct: 481 G 481


>gi|160883926|ref|ZP_02064929.1| hypothetical protein BACOVA_01900 [Bacteroides ovatus ATCC 8483]
 gi|260172450|ref|ZP_05758862.1| cysteine desulfurase activator complex subunit SufB [Bacteroides
           sp. D2]
 gi|156110656|gb|EDO12401.1| hypothetical protein BACOVA_01900 [Bacteroides ovatus ATCC 8483]
          Length = 499

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/488 (65%), Positives = 395/488 (80%), Gaps = 6/488 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
             +   + VRK   ++YKYGF T +  D   +GLNED+IR IS+KK+EP+W+LE+RL AY
Sbjct: 17  EKKTDNEFVRKFAEEKYKYGFTTEVHTDIIERGLNEDVIRLISSKKDEPEWLLEFRLKAY 76

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           R WLT++ P+WA +R P ID+  + YYA P K   GP+S+++VDPEL++T+ KLGIP+ E
Sbjct: 77  RHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMEEVDPELIKTFNKLGIPLEE 136

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV
Sbjct: 137 QMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVV 191

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYV
Sbjct: 192 GYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYV 251

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C
Sbjct: 252 SYLEGCTAPMRDENQLHAAIVEIIVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNC 311

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KN
Sbjct: 312 KGVDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKN 371

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N 
Sbjct: 372 TRSTIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNE 431

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 432 TAVVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLT 491

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 492 ISLEGSVG 499


>gi|116071400|ref|ZP_01468669.1| FeS assembly protein SufB [Synechococcus sp. BL107]
 gi|116066805|gb|EAU72562.1| FeS assembly protein SufB [Synechococcus sp. BL107]
          Length = 479

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 294/483 (60%), Positives = 374/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+E+++R IS+KK+EP+++L +RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIDKGLSEEVVRLISSKKDEPEFLLNFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + Y AID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYEAIDYQDIIYYAAPKQQAKKASLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   +EA+ +HP+L++KYL +VV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFTEAVKDHPELIEKYLGSVVASNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELV LD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVVLDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGARS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNCQQADTGTKMIHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +  GA  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGRSSNSYRGLVQMGPGAKGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|332299229|ref|YP_004441150.1| FeS assembly protein SufB [Porphyromonas asaccharolytica DSM 20707]
 gi|332176292|gb|AEE11982.1| FeS assembly protein SufB [Porphyromonas asaccharolytica DSM 20707]
          Length = 502

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 310/488 (63%), Positives = 384/488 (78%), Gaps = 6/488 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
                  D +  I    YKYGF T++  +  PKGLNE+++R ISAKK EP+W+LE+RL A
Sbjct: 21  AVTPTGEDILDDITQGDYKYGFVTDVHTETIPKGLNEEVVRLISAKKEEPEWLLEFRLKA 80

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           Y  WLT++ P WA +  P ID+ D+ YYAAP+          +DPE+ +T++KLGIP+ E
Sbjct: 81  YHHWLTLERPDWAHLSIPEIDYQDIIYYAAPRHKTPGDG--TIDPEIEKTFDKLGIPLHE 138

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           + +L+G     +AVDAV DSVSV TTF+ +LK+ G+IF   +EA+ EHPDLV+KYL  VV
Sbjct: 139 RAMLSG----NMAVDAVMDSVSVKTTFRTKLKELGIIFCSFNEAVREHPDLVRKYLGKVV 194

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DN++AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADEG+YV
Sbjct: 195 SSHDNYFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADEGAYV 254

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++A  +AE+KYSTVQNWYPGD  G+GGIYNFVTKRG C
Sbjct: 255 SYLEGCTAPMRDENQLHAAIVEIIAETDAEVKYSTVQNWYPGDKDGRGGIYNFVTKRGLC 314

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           RG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++N +QQ D+GTKM+HL +N
Sbjct: 315 RGDRSKISWTQVETGSAITWKYPSCILRGDDSVGEFYSVAVTNNYQQADTGTKMIHLGRN 374

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG VS+   A ++RN +QCDSLL+ ++CGAHT PY + +N 
Sbjct: 375 TRSTIVSKGISAGSSQNSYRGLVSIAASAENARNHSQCDSLLLSDHCGAHTYPYADIRND 434

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           S  +EHEATTSKI+++ LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ 
Sbjct: 435 SAVVEHEATTSKINEDQLFYCNQRGITTEEAVGLIVNGYAREVMSKLPMEFAVEAQKLLS 494

Query: 482 ISLEGSVG 489
           ++LEGSVG
Sbjct: 495 VTLEGSVG 502


>gi|148243117|ref|YP_001228274.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. RCC307]
 gi|147851427|emb|CAK28921.1| SufB protein, Fe-Scluster assembly [Synechococcus sp. RCC307]
          Length = 492

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 290/479 (60%), Positives = 370/479 (77%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V  +    Y+YGF T+I+ +K  KGL+E+++R ISAKK EP ++L++RL A+R+W  M +
Sbjct: 19  VSDLVSQPYRYGFVTDIETEKIAKGLSEEVVRLISAKKKEPQFLLDFRLRAFRQWQRMAE 78

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA + YP ID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+    
Sbjct: 79  PDWAALGYPPIDYQDIVYYAAPKQEQKKASLDEVDPKLLETFDKLGIPLSEQKRLS---- 134

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
             VAVDAVFDSVS+ TT+KE+L + GVIF   SEA+ EHP+L+++YL +VVP+ DN++AA
Sbjct: 135 -NVAVDAVFDSVSIATTYKEQLAEHGVIFCSFSEAVEEHPELIERYLGSVVPIADNYFAA 193

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFV+IPKGV CPM+LSTYFRIN   TGQFERTLI+A+EG+ VSYLEGCTAP
Sbjct: 194 LNSAVFSDGSFVFIPKGVTCPMDLSTYFRINSGDTGQFERTLIVAEEGASVSYLEGCTAP 253

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D NQLHAAVVELVA D+A IKYSTVQNWY GD  GKGGIYNFVTKRG C+G RS ISW
Sbjct: 254 MFDTNQLHAAVVELVAFDDASIKYSTVQNWYAGDENGKGGIYNFVTKRGICKGARSHISW 313

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           TQ+ETGSAITWKYPSC+L G  S GEFYS+A++N  QQ D+GTKM+H+   + S IVSKG
Sbjct: 314 TQVETGSAITWKYPSCVLAGADSVGEFYSVALTNNCQQADTGTKMVHVGPRSRSTIVSKG 373

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +EHEA+
Sbjct: 374 ISAGRSANSYRGLVQMGAKAIGARNYSQCDSMLIGDQAAANTYPYIRSQQPQATVEHEAS 433

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           T +IS++ LFY   RGI  E A++++V+GF R+V  +LP+EFA EA KL+ + LEGSVG
Sbjct: 434 TCRISEDQLFYLQSRGIAFEEAVSMMVSGFCRDVFNQLPLEFAAEADKLLALKLEGSVG 492


>gi|116073826|ref|ZP_01471088.1| ABC transporter, membrane component [Synechococcus sp. RS9916]
 gi|116069131|gb|EAU74883.1| ABC transporter, membrane component [Synechococcus sp. RS9916]
          Length = 479

 Score =  542 bits (1396), Expect = e-152,   Method: Composition-based stats.
 Identities = 296/483 (61%), Positives = 377/483 (78%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T+I+ +K  KGL+ED++R IS+KK EP ++L++RL AYR WL
Sbjct: 2   TSVSTRDLVSQPYKYGFVTDIETEKIAKGLSEDVVRLISSKKEEPQFLLDFRLRAYRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA++ Y AID+ D+ YYAAPK      SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAQLGYTAIDYQDIVYYAAPKQQEKKASLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT++E+L + GV+F  ISEAI ++P+L+++YL +VVP  DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYREKLAEHGVVFCSISEAIKDYPELIERYLGSVVPSNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGARS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNRQQADTGTKMIHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGHSSNSYRGLVQIGPAAKGARNYSQCDSMLIGDEAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|313887333|ref|ZP_07821024.1| FeS assembly protein SufB [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312923252|gb|EFR34070.1| FeS assembly protein SufB [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 502

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 310/488 (63%), Positives = 384/488 (78%), Gaps = 6/488 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
                  D +  I    YKYGF T++  +  PKGLNE+++R ISAKK EP+W+LE+RL A
Sbjct: 21  AVTPTGEDILDDITQGDYKYGFVTDVHTETIPKGLNEEVVRLISAKKEEPEWLLEFRLKA 80

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           Y  WLT++ P WA +  P ID+ D+ YYAAP+          +DPE+ +T++KLGIP+ E
Sbjct: 81  YHHWLTLERPDWAHLSIPEIDYQDIIYYAAPRHKTSGDGP--IDPEIEKTFDKLGIPLHE 138

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           + +L+G     +AVDAV DSVSV TTF+ +LK+ G+IF   +EA+ EHPDLV+KYL  VV
Sbjct: 139 RAMLSG----NMAVDAVMDSVSVKTTFRTKLKELGIIFCSFNEAVREHPDLVRKYLGKVV 194

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DN++AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADEG+YV
Sbjct: 195 SSHDNYFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADEGAYV 254

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++A  +AE+KYSTVQNWYPGD  G+GGIYNFVTKRG C
Sbjct: 255 SYLEGCTAPMRDENQLHAAIVEIIAETDAEVKYSTVQNWYPGDKDGRGGIYNFVTKRGLC 314

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           RG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++N +QQ D+GTKM+HL +N
Sbjct: 315 RGDRSKISWTQVETGSAITWKYPSCILRGDDSVGEFYSVAVTNNYQQADTGTKMIHLGRN 374

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG VS+   A ++RN +QCDSLL+ ++CGAHT PY + +N 
Sbjct: 375 TRSTIVSKGISAGSSQNSYRGLVSIAASAENARNHSQCDSLLLSDHCGAHTYPYADIRND 434

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           S  +EHEATTSKI+++ LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ 
Sbjct: 435 SAVVEHEATTSKINEDQLFYCNQRGITTEEAVGLIVNGYAREVMSKLPMEFAVEAQKLLS 494

Query: 482 ISLEGSVG 489
           ++LEGSVG
Sbjct: 495 VTLEGSVG 502


>gi|149196443|ref|ZP_01873498.1| component of SufBCD complex [Lentisphaera araneosa HTCC2155]
 gi|149140704|gb|EDM29102.1| component of SufBCD complex [Lentisphaera araneosa HTCC2155]
          Length = 479

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 305/470 (64%), Positives = 377/470 (80%), Gaps = 5/470 (1%)

Query: 20  KYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYP 79
           K+GF T+I+ D  PKGLNED+++ IS +K EP+WMLE+RL A+ RW  M +P WA + YP
Sbjct: 15  KFGFVTDIETDSIPKGLNEDVVKLISERKEEPEWMLEFRLKAFARWKKMVEPVWADLDYP 74

Query: 80  AIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVF 139
            IDF D+ YY+APK     +SLD+VDPELL+T+EKLGIP+ EQ+ L G     VAVDAVF
Sbjct: 75  KIDFQDIVYYSAPKQAETHESLDEVDPELLKTFEKLGIPLSEQKRLTG-----VAVDAVF 129

Query: 140 DSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDG 199
           DSVSV TT +EEL + GVIF  ISEAI +HP+LVKK++++VVPVGDNFYAALN+AVFTDG
Sbjct: 130 DSVSVGTTHQEELAEHGVIFCSISEAIKDHPELVKKHMASVVPVGDNFYAALNAAVFTDG 189

Query: 200 SFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHA 259
           SF YIPKGV CPM+LSTYFRIN   TGQFERTLIIA+EGSYV+YLEGCTAPQRDENQLHA
Sbjct: 190 SFCYIPKGVTCPMDLSTYFRINAAETGQFERTLIIAEEGSYVNYLEGCTAPQRDENQLHA 249

Query: 260 AVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAI 319
           AVVE++A +NA +KYSTVQNWY GD  GKGGIYNFVTKRG C+G  S ISWTQ+E GSAI
Sbjct: 250 AVVEIIAEENATVKYSTVQNWYAGDEDGKGGIYNFVTKRGICKGDNSFISWTQVEAGSAI 309

Query: 320 TWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNT 379
           TWKYPS +L+G+ S GEFYS+A++N   Q D+GTKM+H+ KNT S I+SKGISA  S N 
Sbjct: 310 TWKYPSVILKGDNSTGEFYSVALTNNKMQADTGTKMIHIGKNTKSTIISKGISADDSRNC 369

Query: 380 YRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHL 439
           YRG V +  GA  +RN++QCDS+L+G+ C A T PY+E +N++  LEHEA+TSKIS + +
Sbjct: 370 YRGLVKIMPGAEGARNYSQCDSMLVGDKCSASTFPYLEVQNNTAVLEHEASTSKISADQI 429

Query: 440 FYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           FY L RGI  E AI L+VNGF +EV ++LP+EF+VEA KL+++ LE S+G
Sbjct: 430 FYLLSRGIDMEEAIHLLVNGFCKEVFKELPLEFSVEAVKLLEMKLENSIG 479


>gi|293370443|ref|ZP_06616996.1| FeS assembly protein SufB [Bacteroides ovatus SD CMC 3f]
 gi|294646237|ref|ZP_06723891.1| FeS assembly protein SufB [Bacteroides ovatus SD CC 2a]
 gi|294809095|ref|ZP_06767813.1| FeS assembly protein SufB [Bacteroides xylanisolvens SD CC 1b]
 gi|298480550|ref|ZP_06998747.1| FeS assembly protein SufB [Bacteroides sp. D22]
 gi|292634435|gb|EFF52971.1| FeS assembly protein SufB [Bacteroides ovatus SD CMC 3f]
 gi|292638455|gb|EFF56819.1| FeS assembly protein SufB [Bacteroides ovatus SD CC 2a]
 gi|294443649|gb|EFG12398.1| FeS assembly protein SufB [Bacteroides xylanisolvens SD CC 1b]
 gi|295086247|emb|CBK67770.1| Iron-regulated ABC transporter membrane component SufB [Bacteroides
           xylanisolvens XB1A]
 gi|298273371|gb|EFI14935.1| FeS assembly protein SufB [Bacteroides sp. D22]
          Length = 500

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/488 (65%), Positives = 395/488 (80%), Gaps = 6/488 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
             +   + VRK   ++YKYGF T +  D   +GLNED+IR IS+KK+EP+W+LE+RL AY
Sbjct: 18  EKKTDNEFVRKFAEEKYKYGFTTEVHTDIIERGLNEDVIRLISSKKDEPEWLLEFRLKAY 77

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAP-KSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           R WLT++ P+WA +R P ID+  + YYA P K   GP+S+++VDPEL++T+ KLGIP+ E
Sbjct: 78  RHWLTLEMPTWAHLRIPEIDYQAISYYADPTKKKEGPKSMEEVDPELIKTFNKLGIPLEE 137

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           Q  L+G     +AVDAV DSVSV TTFKE L + G+IF   SEA+ EHPDLVKKY+ +VV
Sbjct: 138 QMALSG-----MAVDAVMDSVSVKTTFKETLMEKGIIFCSFSEAVREHPDLVKKYMGSVV 192

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DNF+AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+AD+ SYV
Sbjct: 193 GYRDNFFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVADDDSYV 252

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++  D AE+KYSTVQNWYPGD++GKGG+YNFVTKRG+C
Sbjct: 253 SYLEGCTAPMRDENQLHAAIVEIIVHDRAEVKYSTVQNWYPGDAEGKGGVYNFVTKRGNC 312

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           +G+ SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL KN
Sbjct: 313 KGVDSKLSWTQVETGSAITWKYPSCILTGDNSTAEFYSVAVTNNYQQADTGTKMIHLGKN 372

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG V V   A ++RN++QCDSLL+G+ CGAHT PY++  N 
Sbjct: 373 TRSTIVSKGISAGHSENSYRGLVRVAEKADNARNYSQCDSLLLGDKCGAHTFPYMDIHNE 432

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS++ +FYC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 433 TAVVEHEATTSKISEDQIFYCNQRGIPTEDAIGLIVNGYAKEVLNKLPMEFAVEAQKLLT 492

Query: 482 ISLEGSVG 489
           ISLEGSVG
Sbjct: 493 ISLEGSVG 500


>gi|254523553|ref|ZP_05135608.1| FeS assembly protein SufB [Stenotrophomonas sp. SKA14]
 gi|219721144|gb|EED39669.1| FeS assembly protein SufB [Stenotrophomonas sp. SKA14]
          Length = 491

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 320/499 (64%), Positives = 386/499 (77%), Gaps = 18/499 (3%)

Query: 1   MVAVRETVDKVRKIDV----------DQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNE 50
           M    ET++ V   D            +Y  GF T I+ D  P GL+ED IR +SAKK E
Sbjct: 1   MA--TETIENVAHDDTPNREIHEQLGRKYSAGFITEIESDSLPPGLDEDTIRALSAKKEE 58

Query: 51  PDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLR 110
           P+WM +WRL AYR +LTM  P WA++    ID   L YY+APK      SLDDV  ELL 
Sbjct: 59  PEWMTQWRLDAYRHFLTMPMPDWAKLEIAPIDLQALSYYSAPKG-PKYASLDDVPKELLD 117

Query: 111 TYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHP 170
           TY+KLG+P+ E+  LAG     VAVDAVFDSVSV TTF++EL + G+IF  +SEAI EHP
Sbjct: 118 TYDKLGVPLHERAKLAG-----VAVDAVFDSVSVGTTFRKELAEKGIIFCSMSEAIKEHP 172

Query: 171 DLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFER 230
           +LV++YL TVVPVGDN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFER
Sbjct: 173 ELVRQYLGTVVPVGDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFER 232

Query: 231 TLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGG 290
           TLI+ ++ +YVSYLEGCTAP RDENQLHAAVVELVAL++AEIKYSTVQNWYPGD  G GG
Sbjct: 233 TLIVCEDKAYVSYLEGCTAPMRDENQLHAAVVELVALEDAEIKYSTVQNWYPGDENGVGG 292

Query: 291 IYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQID 350
           IYNFVTKR +CRG RSK++WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A+++  QQ D
Sbjct: 293 IYNFVTKRAECRGARSKVTWTQVETGSAITWKYPSCVLLGDDSVGEFHSVALTHHRQQAD 352

Query: 351 SGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGA 410
           +GTKM+H+ K T S+IVSKGISAG   NTYRG V V R A  +RN+TQCDSLLIG  CGA
Sbjct: 353 TGTKMIHVGKRTKSKIVSKGISAGRGQNTYRGLVKVDRNADGARNYTQCDSLLIGKQCGA 412

Query: 411 HTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPM 470
           HT PYIE KN    +EHEATTSKISD+ LFYC  RGI +E A+++IV+GF ++V ++LPM
Sbjct: 413 HTFPYIEVKNPGATVEHEATTSKISDDQLFYCRARGISQEDAVSMIVDGFCKQVFRELPM 472

Query: 471 EFAVEAQKLIDISLEGSVG 489
           EFAVEA+KL+++SLEGSVG
Sbjct: 473 EFAVEAKKLLEVSLEGSVG 491


>gi|228470979|ref|ZP_04055824.1| FeS assembly protein SufB [Porphyromonas uenonis 60-3]
 gi|228307376|gb|EEK16390.1| FeS assembly protein SufB [Porphyromonas uenonis 60-3]
          Length = 502

 Score =  541 bits (1395), Expect = e-152,   Method: Composition-based stats.
 Identities = 311/488 (63%), Positives = 386/488 (79%), Gaps = 6/488 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
                  D +  I    YKYGF T++  +  PKGLNE+++R ISAKK EP+W+LE+RL A
Sbjct: 21  AVTPTGEDILDDITQGDYKYGFVTDVHTETIPKGLNEEVVRLISAKKEEPEWLLEFRLKA 80

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           YR WLT++ P WA +  P ID+ D+ YYAAP+        D +DPE+ +T++KLGIP+ E
Sbjct: 81  YRHWLTLERPDWAHLSIPEIDYQDIIYYAAPRHKNEGD--DTIDPEIEKTFDKLGIPLHE 138

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           + +L+G     +AVDAV DSVSV TTF+ +L++ G++F   +EA+ EHPDLV+KYL  VV
Sbjct: 139 RAMLSG----NMAVDAVMDSVSVKTTFRTKLQELGIVFCSFNEAVREHPDLVRKYLGKVV 194

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
              DN++AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN   TGQFERTLI+ADEG+YV
Sbjct: 195 SSHDNYFAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINAANTGQFERTLIVADEGAYV 254

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++A  +AE+KYSTVQNWYPGD  G+GGIYNFVTKRG C
Sbjct: 255 SYLEGCTAPMRDENQLHAAIVEIIAETDAEVKYSTVQNWYPGDKDGRGGIYNFVTKRGLC 314

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           RG RSKISWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++N +QQ D+GTKM+HL +N
Sbjct: 315 RGDRSKISWTQVETGSAITWKYPSCILRGDDSVGEFYSVAVTNNYQQADTGTKMIHLGRN 374

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S IVSKGISAG S N+YRG VS+   A ++RN +QCDSLL+ N+CGAHT PY + +N 
Sbjct: 375 TRSTIVSKGISAGSSQNSYRGLVSIAASAENARNHSQCDSLLLSNHCGAHTYPYADIRND 434

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           S  +EHEATTSKI+++ LFYC QRGI  E A+ LIVNG+ REV+ KLPMEFAVEAQKL+ 
Sbjct: 435 SAVVEHEATTSKINEDQLFYCNQRGITTEEAVGLIVNGYAREVMSKLPMEFAVEAQKLLS 494

Query: 482 ISLEGSVG 489
           ++LEGSVG
Sbjct: 495 VTLEGSVG 502


>gi|33864855|ref|NP_896414.1| cysteine desulfurase activator complex subunit SufB [Synechococcus
           sp. WH 8102]
 gi|33632378|emb|CAE06834.1| ABC transporter, membrane component [Synechococcus sp. WH 8102]
          Length = 479

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 297/483 (61%), Positives = 371/483 (76%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+ED++R ISAKK EP ++LE+RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIAKGLSEDVVRLISAKKEEPAFLLEFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + YP ID+ D+ YY+APK      SLD+VDP LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYPLIDYQDIVYYSAPKQQDKKSSLDEVDPRLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   SEA+ EHP+L+++YL +VV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFSEAVKEHPELIERYLGSVVASNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
            +AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 CFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDEDGVGGIYNFVTKRGQCRGARS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNRQQADTGTKMVHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGHSSNSYRGLVQMGPAAKGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|332141975|ref|YP_004427713.1| cysteine desulfurase activator complex subunit SufB [Alteromonas
           macleodii str. 'Deep ecotype']
 gi|327551997|gb|AEA98715.1| cysteine desulfurase activator complex subunit SufB [Alteromonas
           macleodii str. 'Deep ecotype']
          Length = 478

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 332/482 (68%), Positives = 397/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y  GF + I+ +    GL+E +IR ISA KNEP+WMLEWRL +YR WL M
Sbjct: 3   EQIEQALERKYDAGFYSEIESETFESGLDESVIRRISAMKNEPEWMLEWRLKSYRAWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP ID+  + YY+APKS    PQSLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 63  EEPDWAHVDYPKIDYQSISYYSAPKSMKDKPQSLDEVDPELLRTYEKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+E+L+ +GVIF PISEA+ ++PDLVKKY+ +VVP  DN+
Sbjct: 123 -----VAVDAVFDSVSVVTTFREKLEDAGVIFCPISEAVQKYPDLVKKYIGSVVPRTDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFVYIPKG RCPMELSTYFRINE  TGQFERTLI+ADEGSYVSYLEGC
Sbjct: 178 FAALNSAVFTDGSFVYIPKGTRCPMELSTYFRINEMNTGQFERTLIVADEGSYVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVA+D+A+IKYSTVQNWYPGD  GKGGIYNFVTKRG      +K
Sbjct: 238 TAPQRDENQLHAAVVELVAMDDAQIKYSTVQNWYPGDENGKGGIYNFVTKRGVAH-TNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+H+ KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSVALTRGRQQADTGTKMIHVGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN YRG V +   A  +RNFT+CDSLLIG+ CGAHT PYIES+N S  +EH
Sbjct: 357 SKGISAGNSNNAYRGLVQMGPRADGARNFTECDSLLIGDKCGAHTFPYIESRNPSAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SDE LF C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDEQLFLCQQRGLDTEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|260435424|ref|ZP_05789394.1| FeS assembly protein SufB [Synechococcus sp. WH 8109]
 gi|260413298|gb|EEX06594.1| FeS assembly protein SufB [Synechococcus sp. WH 8109]
          Length = 479

 Score =  541 bits (1394), Expect = e-152,   Method: Composition-based stats.
 Identities = 296/483 (61%), Positives = 374/483 (77%), Gaps = 5/483 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T I+ DK  KGL+E+++R ISAKK EPD++L++RL A+R WL
Sbjct: 2   TSTSTRDLVSQPYKYGFVTEIETDKIAKGLSEEVVRLISAKKEEPDFLLQFRLKAFRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILA 126
           T+++P WA + Y  ID+ D+ YYAAPK +    SLD+VDP+LL T++KLGIP+ EQ+ L+
Sbjct: 62  TLEEPDWAALGYTEIDYQDIVYYAAPKQLEKKASLDEVDPKLLETFDKLGIPLSEQKRLS 121

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
                 VAVDAVFDSVS+ TT+KE+L + GV+F   SEA+ EHP+L+++YL TVV   DN
Sbjct: 122 -----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFSEAVKEHPELIERYLGTVVSSNDN 176

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           ++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLEG
Sbjct: 177 YFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLEG 236

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP  D +QLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG RS
Sbjct: 237 CTAPMFDTSQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGHRS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           +ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S I
Sbjct: 297 RISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNCQQADTGTKMVHVGPRTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           VSKGISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +E
Sbjct: 357 VSKGISAGRSSNSYRGLVQMGPNAKGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAIE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEG
Sbjct: 417 HEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEG 476

Query: 487 SVG 489
           SVG
Sbjct: 477 SVG 479


>gi|28198601|ref|NP_778915.1| cysteine desulfurase activator complex subunit SufB [Xylella
           fastidiosa Temecula1]
 gi|182681284|ref|YP_001829444.1| cysteine desulfurase activator complex subunit SufB [Xylella
           fastidiosa M23]
 gi|28056685|gb|AAO28564.1| ABC transporter membrane protein [Xylella fastidiosa Temecula1]
 gi|182631394|gb|ACB92170.1| FeS assembly protein SufB [Xylella fastidiosa M23]
 gi|307579735|gb|ADN63704.1| cysteine desulfurase activator complex subunit SufB [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 485

 Score =  541 bits (1393), Expect = e-151,   Method: Composition-based stats.
 Identities = 318/487 (65%), Positives = 385/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++D  +Y+ GF T I+ D  P GLNE IIR +SAKK+EP+WM EWRL AY
Sbjct: 6   ATPQNAEILERLDR-RYEAGFVTQIESDSLPPGLNETIIRALSAKKHEPEWMTEWRLAAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA++    IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLNMPMPEWAKLHIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVS+ TTF++EL + G+IF  ISEAI EHPDL+++YL +VVP
Sbjct: 124 ARLAG-----VAVDAVFDSVSLGTTFRKELAEKGIIFCSISEAIQEHPDLIRQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           V DN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ +E +YVS
Sbjct: 179 VRDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEEQAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVA ++AEIKYSTVQNWYPGD  G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPIRDENQLHAAVVELVAQEDAEIKYSTVQNWYPGDEAGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK+ WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A++   QQ D+GTKM+H+ K T
Sbjct: 299 GARSKVIWTQVETGSAITWKYPSCVLLGDDSTGEFHSVALTRHHQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V + R A  +RN TQCDSLLIG  CGAHT PYIE K+ +
Sbjct: 359 KSKIVSKGISAGHGQNTYRGLVKIDRNAEGARNHTQCDSLLIGKQCGAHTFPYIEVKHPN 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI EE A+++IV+GF ++V ++LPMEFAVEA+KL+DI
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGIAEEDAVSIIVDGFCKQVFRELPMEFAVEAKKLLDI 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|118497443|ref|YP_898493.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. novicida U112]
 gi|195536134|ref|ZP_03079141.1| FeS assembly protein SufB [Francisella tularensis subsp. novicida
           FTE]
 gi|254372804|ref|ZP_04988293.1| sufS activator complex [Francisella tularensis subsp. novicida
           GA99-3549]
 gi|254374264|ref|ZP_04989746.1| protein ycf24 [Francisella novicida GA99-3548]
 gi|118423349|gb|ABK89739.1| sufS activator complex, sufB subunit [Francisella novicida U112]
 gi|151570531|gb|EDN36185.1| sufS activator complex [Francisella novicida GA99-3549]
 gi|151571984|gb|EDN37638.1| protein ycf24 [Francisella novicida GA99-3548]
 gi|194372611|gb|EDX27322.1| FeS assembly protein SufB [Francisella tularensis subsp. novicida
           FTE]
 gi|328676939|gb|AEB27809.1| Iron-sulfur cluster assembly protein SufB [Francisella cf. novicida
           Fx1]
          Length = 481

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 337/482 (69%), Positives = 402/482 (83%), Gaps = 4/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF TNI+ +    GLNED+IR ISA+KNEP+++LEWRL AY +WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNEPEFLLEWRLKAYHKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + YP IDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQE+LAG
Sbjct: 63  KSPKWADLNYPPIDFQAISYYSSPKSLKNHPKSLDEVDPEIIETYNKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--RNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGC
Sbjct: 181 FAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCH-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   AA++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEAQKL+++SLEG+
Sbjct: 420 EATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGA 479

Query: 488 VG 489
           VG
Sbjct: 480 VG 481


>gi|88801812|ref|ZP_01117340.1| hypothetical protein PI23P_04097 [Polaribacter irgensii 23-P]
 gi|88782470|gb|EAR13647.1| hypothetical protein PI23P_04097 [Polaribacter irgensii 23-P]
          Length = 482

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 328/489 (67%), Positives = 390/489 (79%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E  D  +++   +YKYGF T I+ +   KGL+E+++  IS KKNEPDWM +WRL 
Sbjct: 1   MSKYTE-DDLEQELKTKEYKYGFYTEIESETFAKGLSEEVVIAISKKKNEPDWMTDWRLE 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR W TMK+P WA + Y    F ++ YY+APK+     SLD+VDPELL T+++LGI + 
Sbjct: 60  AYRVWKTMKEPEWANVHYEKPKFQEIAYYSAPKAKPKLNSLDEVDPELLDTFKRLGISLD 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LA      VAVD V DSVSV TTFK+ L + G+IFMPISEAI EHP+LV+KYL TV
Sbjct: 120 EQKKLA-----NVAVDIVIDSVSVATTFKKSLGEKGIIFMPISEAIQEHPELVRKYLGTV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           +P  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRINE GTGQFERTL++AD+GSY
Sbjct: 175 IPTTDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINEGGTGQFERTLVVADKGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+A+D+AEIKYSTVQNWYPG+ +GKGG+YNFVTKR  
Sbjct: 235 VSYLEGCTAPSRDENQLHAAVVELIAMDDAEIKYSTVQNWYPGNKEGKGGVYNFVTKRAL 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +K+SWTQ+ETGSAITWKYPSC+L+G  S GEFYSIA++N  QQ D+GTKM+HL K
Sbjct: 295 C-ETNAKVSWTQVETGSAITWKYPSCILKGNNSVGEFYSIAVTNNHQQADTGTKMIHLGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V +   A ++RNF+QCDSLL+GN+CGAHT PYIE KN
Sbjct: 354 NTRSTIISKGISAGKSQNSYRGLVQISPRAENARNFSQCDSLLMGNDCGAHTFPYIEVKN 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI +E LFYC QRGI  E AIALIVNGF +EVL  LPMEFAVEAQKL+
Sbjct: 414 KTAQIEHEATTSKIGEEQLFYCNQRGIDTEKAIALIVNGFSKEVLNNLPMEFAVEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|332183984|gb|AEE26238.1| Iron-sulfur cluster assembly protein SufB [Francisella cf. novicida
           3523]
          Length = 481

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 337/482 (69%), Positives = 402/482 (83%), Gaps = 4/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF TNI+ +    GLNED+IR ISA+KNEP+++LEWRL AY +WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNEPEFLLEWRLKAYHKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + YP IDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQE+LAG
Sbjct: 63  KSPKWADLNYPPIDFQAISYYSSPKSLKDHPKSLDEVDPEIIETYNKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--RNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGC
Sbjct: 181 FAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCY-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   AA++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEAQKL+++SLEG+
Sbjct: 420 EATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGA 479

Query: 488 VG 489
           VG
Sbjct: 480 VG 481


>gi|239994260|ref|ZP_04714784.1| cysteine desulfurase activator complex subunit SufB [Alteromonas
           macleodii ATCC 27126]
          Length = 478

 Score =  540 bits (1392), Expect = e-151,   Method: Composition-based stats.
 Identities = 329/482 (68%), Positives = 397/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y  GF + I+ +    GL+E +IR ISA KNEP+WMLEWRL +Y  WL M
Sbjct: 3   EQIEQALERKYDAGFYSEIESETFESGLDESVIRRISAMKNEPEWMLEWRLKSYHAWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP ID+  + YY+APKS    P+SLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 63  EEPDWAHVDYPKIDYQAISYYSAPKSMKDKPKSLDEVDPELLRTYEKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+++L+++GVIF PISEA+ ++PDLVKKY+ +VVP  DN+
Sbjct: 123 -----VAVDAVFDSVSVVTTFRDKLEEAGVIFCPISEAVQKYPDLVKKYIGSVVPRTDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFVYIPKG RCPMELSTYFRINE  TGQFERTLI+ADEGSYVSYLEGC
Sbjct: 178 FAALNSAVFTDGSFVYIPKGTRCPMELSTYFRINEMNTGQFERTLIVADEGSYVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVA+D+A+IKYSTVQNWYPGD  GKGGIYNFVTKRG      +K
Sbjct: 238 TAPQRDENQLHAAVVELVAMDDAQIKYSTVQNWYPGDENGKGGIYNFVTKRGVAH-TNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+H+ KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSVALTRGRQQADTGTKMIHVGKNTKSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN YRG V +   A  +RNFT+CDSLLIG+ CGAHT PYIES+N S  +EH
Sbjct: 357 SKGISAGNSNNAYRGLVQMGPRADGARNFTECDSLLIGDKCGAHTFPYIESRNPSAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SDE LF C QRG+  E A+++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDEQLFLCQQRGLDTEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|295132096|ref|YP_003582772.1| cysteine desulfurase activator complex subunit SufB [Zunongwangia
           profunda SM-A87]
 gi|294980111|gb|ADF50576.1| cysteine desulfurase activator complex subunit SufB [Zunongwangia
           profunda SM-A87]
          Length = 481

 Score =  540 bits (1391), Expect = e-151,   Method: Composition-based stats.
 Identities = 321/489 (65%), Positives = 385/489 (78%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    + +   ++++  +Y+YGF T+I+ D  P GLNEDI+R IS KK EP+WM EWRL 
Sbjct: 1   MAYTEDDLK--KELETKEYEYGFYTDIESDTFPVGLNEDIVRAISKKKEEPEWMTEWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W  M++P WA + Y   DF ++ YY+AP       SLD+VDPELL T++KLGI I 
Sbjct: 59  AFRAWEQMEEPEWANVHYKKPDFQNISYYSAPNKKPKYDSLDEVDPELLDTFKKLGISID 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAGV    V          V TTFK+ L + G+IF  ISEAI EHP+LVKKY+ +V
Sbjct: 119 EQKKLAGVAVDVVMDSVS-----VTTTFKKTLAEKGIIFCSISEAIKEHPELVKKYIGSV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL+IADEGSY
Sbjct: 174 VPKKDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVIADEGSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNW+PG   GKGG++NFVTKRG 
Sbjct: 234 VSYLEGCTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWFPGGKDGKGGVFNFVTKRGL 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N +QQ D+GTKM+HL K
Sbjct: 294 C-EKNAKISWTQVETGSAVTWKYPSCILKGDNSVGEFYSIAVTNNYQQADTGTKMVHLGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++  A ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 353 NTRSTIISKGISAGKSQNSYRGLVQINPRADNARNFSQCDSLLMGNACGAHTFPYIEAKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 413 KTAKVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|303235565|ref|ZP_07322172.1| FeS assembly protein SufB [Prevotella disiens FB035-09AN]
 gi|302484012|gb|EFL47000.1| FeS assembly protein SufB [Prevotella disiens FB035-09AN]
          Length = 481

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 304/488 (62%), Positives = 380/488 (77%), Gaps = 7/488 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
           ++     + VRK+   +Y++GF T++  D  PKGLNED++R IS KK EP+W+L++RL A
Sbjct: 1   MSENNNNEYVRKVAEQKYEFGFTTDVHTDIIPKGLNEDVVRLISEKKGEPEWLLDFRLKA 60

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           +R W TM+ P W  +  P ID+  + YYA P +        ++DPEL +T++KLGIP+ E
Sbjct: 61  FRHWETMEMPKWPHLNLPEIDYQAISYYADPLAKKPKN--KEIDPELEKTFDKLGIPLEE 118

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           +  L+G     VAVDA+ DSVSV TTFK++L + G+IF  I EA+ EHP+LV++YL TVV
Sbjct: 119 RLALSG-----VAVDAIMDSVSVKTTFKKQLAEKGIIFCSIGEAVKEHPELVRQYLGTVV 173

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
           P  DNF AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN   TGQFERTLIIAD+ SYV
Sbjct: 174 PYKDNFTAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINAMNTGQFERTLIIADDDSYV 233

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE+V L NAE+KYSTVQNWYPGD  GKGG+ N VTKRGD 
Sbjct: 234 SYLEGCTAPMRDENQLHAAIVEIVVLANAEVKYSTVQNWYPGDENGKGGVLNLVTKRGDL 293

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           RG  SK+SWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N  Q+ D+GTKM+H+ KN
Sbjct: 294 RGKNSKLSWTQVETGSAITWKYPSCILRGDNSQAEFYSVAVTNNHQEADTGTKMIHMGKN 353

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S I+SKGISAG S N+YRG V V   A ++RN++ CDSLL+G+ CGAHT PY++  N 
Sbjct: 354 TKSTIISKGISAGKSQNSYRGLVRVTPNADNARNYSSCDSLLLGSTCGAHTFPYMDVHND 413

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           S  +EHEATTSKIS++ LFYC QRGIP E AI LIVNG+ ++VL KLPMEFAVEAQKL+ 
Sbjct: 414 SAIVEHEATTSKISEDQLFYCNQRGIPMEDAIGLIVNGYAKDVLNKLPMEFAVEAQKLLS 473

Query: 482 ISLEGSVG 489
           ++LEG+VG
Sbjct: 474 VTLEGTVG 481


>gi|72383272|ref|YP_292627.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. NATL2A]
 gi|72003122|gb|AAZ58924.1| Iron-regulated ABC transporter membrane component SufB
           [Prochlorococcus marinus str. NATL2A]
          Length = 480

 Score =  540 bits (1390), Expect = e-151,   Method: Composition-based stats.
 Identities = 307/481 (63%), Positives = 385/481 (80%), Gaps = 5/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + V +I    YKYGF T I+ +K PKGLNED+IR ISAKKNEP+++L++RL AY +WL M
Sbjct: 5   NTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISAKKNEPEFLLKFRLRAYEQWLKM 64

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K+P W+ + Y  +D+ DL YY+APK  +  +SLD+VDP+LL T+EKLGIP+ EQ+ L+  
Sbjct: 65  KEPDWSGLTYSKVDYQDLVYYSAPKQDIKKKSLDEVDPKLLETFEKLGIPLSEQKRLS-- 122

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVS+ TT+KE+L + GVIF  ISEAI E+PDL++KY+ TVVP+ DNF+
Sbjct: 123 ---NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAISEYPDLIEKYMGTVVPINDNFF 179

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFVYIPKGV CPMELS+YFRIN   TGQFERTLIIA+E S VSYLEGCT
Sbjct: 180 AALNSAVFSDGSFVYIPKGVECPMELSSYFRINSGDTGQFERTLIIAEESSSVSYLEGCT 239

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D N LHAAVVELVALDNA IKYSTVQNWY G+ +G GGIYNFVTKRG+CRG +SKI
Sbjct: 240 APMFDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGGIYNFVTKRGECRGKKSKI 299

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SW+Q+ETGSAITWKYPSC+L+G+ S GEFYSIA++N  Q+ D+GTKM+H+ KNT S+IVS
Sbjct: 300 SWSQVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKADTGTKMIHIGKNTKSKIVS 359

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N+YRG VS+   A  +RN++QCDS+LIG+   A+T PYI+SK    N+EHE
Sbjct: 360 KGISAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKASANTYPYIQSKQPQSNIEHE 419

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+T +IS++ LFY   RGI  E +++++V+GF  +V  +LPMEFA EA KL+ + LEGSV
Sbjct: 420 ASTCRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNELPMEFASEADKLLALKLEGSV 479

Query: 489 G 489
           G
Sbjct: 480 G 480


>gi|260061110|ref|YP_003194190.1| cysteine desulfurase activator complex subunit SufB [Robiginitalea
           biformata HTCC2501]
 gi|88785242|gb|EAR16411.1| hypothetical protein RB2501_05915 [Robiginitalea biformata
           HTCC2501]
          Length = 481

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 329/471 (69%), Positives = 385/471 (81%), Gaps = 6/471 (1%)

Query: 19  YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRY 78
           Y+YGF T+I+ D  PKGL+E+I+  IS KK EPDWM EWRL A+R W  M +P WA I Y
Sbjct: 17  YEYGFYTDIESDTLPKGLSEEIVIAISKKKEEPDWMTEWRLEAFRHWKEMVEPEWANIHY 76

Query: 79  PAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAV 138
              DF ++ YY+AP      +SLD+VDPELL T++KLGIPI EQ+ LAG     VAVD V
Sbjct: 77  KKPDFQNISYYSAPNKKPKYESLDEVDPELLDTFKKLGIPIEEQKKLAG-----VAVDFV 131

Query: 139 FDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTD 198
            DSVSV TTFK+ L + G+IF  ISEAI EHP+LV+KYL TVVP  DNFYAALNSAVF+D
Sbjct: 132 MDSVSVATTFKKTLAEKGIIFCSISEAIKEHPELVRKYLGTVVPRKDNFYAALNSAVFSD 191

Query: 199 GSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLH 258
           GSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL++AD+GSYVSYLEGCTAP RDENQLH
Sbjct: 192 GSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVVADKGSYVSYLEGCTAPSRDENQLH 251

Query: 259 AAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSA 318
           AAVVEL+ALD+AEIKYSTVQNW+PGD +GKGG+YNFVTKRG C    +KISWTQ+ETGSA
Sbjct: 252 AAVVELIALDDAEIKYSTVQNWFPGDKEGKGGVYNFVTKRGLC-EKNAKISWTQVETGSA 310

Query: 319 ITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNN 378
           ITWKYPSC+L+G+ S GEFYSIA++N  QQ D+GTKM+HL  NT S I+SKGISAG S N
Sbjct: 311 ITWKYPSCVLKGDNSIGEFYSIAVTNNHQQADTGTKMIHLGNNTRSTIISKGISAGRSQN 370

Query: 379 TYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEH 438
           +YRG V + R A ++RNF+QCDSLL+GN CGAHT PYIE+ NS+  +EHEATTSKI ++ 
Sbjct: 371 SYRGLVQIGRRAKNARNFSQCDSLLMGNECGAHTFPYIEANNSTAQIEHEATTSKIGEDQ 430

Query: 439 LFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 431 IFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLLEISLEGSVG 481


>gi|94501137|ref|ZP_01307660.1| Cysteine desulfurase activator SufB [Oceanobacter sp. RED65]
 gi|94426713|gb|EAT11698.1| Cysteine desulfurase activator SufB [Oceanobacter sp. RED65]
          Length = 482

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 335/482 (69%), Positives = 404/482 (83%), Gaps = 3/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y+ GF T+I+ D  P GLNED+IRFIS KKNEP+W+LEWRL A+  W  M
Sbjct: 3   EEINQYIKSEYEAGFVTDIESDTLPPGLNEDVIRFISGKKNEPEWLLEWRLKAFAAWQEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIV-GPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P+WA + YP  DF  L YY++PKS+  GP+SLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 63  QEPNWAHVTYPKPDFQALSYYSSPKSMDDGPKSLDEVDPELLRTYEKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V+   VA+D VFDSVSV TTFKE+LK++GVIFM ISEA+  HP++VKKYL +VVP  DNF
Sbjct: 123 VKN-NVAMDVVFDSVSVATTFKEKLKEAGVIFMSISEAVHHHPEIVKKYLGSVVPQKDNF 181

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALNSAVF+DGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLI+ADEGS+VSYLEGC
Sbjct: 182 YAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTLIVADEGSHVSYLEGC 241

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALDNAEIKYSTVQNWYPGDS+GKGGIYNFVTKR       +K
Sbjct: 242 TAPMRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSEGKGGIYNFVTKRAVAH-TNAK 300

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           +SWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++N +QQ D+GTKM+HL KNT S I+
Sbjct: 301 VSWTQVETGSAVTWKYPSCVLKGDNSIGEFYSVALTNNYQQADTGTKMIHLGKNTKSTII 360

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S N YRG V ++  A  +RNFTQCDSLLIG+ CGAHT PYIESK+ S  +EH
Sbjct: 361 SKGISAGKSQNAYRGLVRMNPTAEGARNFTQCDSLLIGDKCGAHTFPYIESKHPSAVIEH 420

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTS +SD+ +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++SLEGS
Sbjct: 421 EATTSTVSDDQMFLCQQRGIDPEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEVSLEGS 480

Query: 488 VG 489
           VG
Sbjct: 481 VG 482


>gi|304311761|ref|YP_003811359.1| FeS assembly protein [gamma proteobacterium HdN1]
 gi|301797494|emb|CBL45714.1| FeS assembly protein [gamma proteobacterium HdN1]
          Length = 482

 Score =  539 bits (1389), Expect = e-151,   Method: Composition-based stats.
 Identities = 328/490 (66%), Positives = 386/490 (78%), Gaps = 9/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E    +  +   +Y  GF TNI+ +  P GLNED+I  ISAKKNEP WML+WRL 
Sbjct: 1   MANASEP---IADLIGREYAAGFVTNIESETIPPGLNEDVIATISAKKNEPQWMLDWRLE 57

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPI 119
           AYR W  M  P WA +++P +DFD + YY+APKS    P+SLD+VDPELL TYEKLGIP+
Sbjct: 58  AYRTWRAMTPPEWAHLKHPPVDFDAISYYSAPKSQKNRPKSLDEVDPELLATYEKLGIPL 117

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            E+  LAGV    V          V TTF+EEL K GVIF PISEAI E+P+LVK+YL +
Sbjct: 118 HERAALAGVAVDVVFDSVS-----VATTFREELGKVGVIFCPISEAIREYPELVKEYLGS 172

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVPV DNFYAALNSAVF+DGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLII D+ +
Sbjct: 173 VVPVRDNFYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTLIICDDDA 232

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP+RDENQLHAAVVELVA +NA+IKYSTVQNWYPGD  G GGIYNFVTKRG
Sbjct: 233 YVSYLEGCTAPKRDENQLHAAVVELVARNNAQIKYSTVQNWYPGDENGDGGIYNFVTKRG 292

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C G+ SKISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A+++ FQQ D+GTKM+H+ 
Sbjct: 293 LCAGVNSKISWTQVETGSAITWKYPSVVLRGDNSVGEFYSVALTHHFQQADTGTKMIHMG 352

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S IVSKGISAG S NTYRG V V   A  +RN+TQCDSLLIG+ CGAHT PYIE++
Sbjct: 353 KNTRSTIVSKGISAGRSQNTYRGLVRVSPNAVGARNYTQCDSLLIGDKCGAHTFPYIENR 412

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NS   +EHEATTSK+SD+ LF C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL
Sbjct: 413 NSDSIVEHEATTSKVSDDQLFLCQQRGIDAEKAVSMIVNGFCKEVFRELPMEFAVEAGKL 472

Query: 480 IDISLEGSVG 489
           +++SLEG+VG
Sbjct: 473 LEVSLEGAVG 482


>gi|159902622|ref|YP_001549966.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. MIT 9211]
 gi|159887798|gb|ABX08012.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           MIT 9211]
          Length = 482

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 307/489 (62%), Positives = 379/489 (77%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M       + +     + YKYGF TNI+ +K  KGLNED+IR IS KKNEPD++L++RL 
Sbjct: 1   MSNTNSIAEVIA--TSNSYKYGFLTNIETEKIAKGLNEDVIRLISMKKNEPDFLLKFRLD 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR+WLTMK+P WA + YP ID+ ++ YYAAPK I   +SLD+VDPE+L T+EKLGIP+ 
Sbjct: 59  AYRKWLTMKEPEWANLGYPKIDYQNIRYYAAPKDIEKKKSLDEVDPEILETFEKLGIPLS 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ L+      VAVDAVFDSVS+ TTFKE+L + GVIF  ISEA+ E+P+L+++YL TV
Sbjct: 119 EQKRLS-----NVAVDAVFDSVSIATTFKEKLAEDGVIFCSISEAVQEYPELIERYLGTV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNF+AALNSAVF+DGSFV+IPKG+ CPMELS+YFRIN   +GQFERTLI+A+ GS 
Sbjct: 174 VPKNDNFFAALNSAVFSDGSFVFIPKGITCPMELSSYFRINSGDSGQFERTLIVAESGSS 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP  D N LHAAVVEL+ALD+A IKYSTVQNWY GD  G GGIYNFVTKRG 
Sbjct: 234 VSYLEGCTAPMFDTNTLHAAVVELIALDDASIKYSTVQNWYSGDKNGVGGIYNFVTKRGQ 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG  SKISW+Q+ETGSAITWKYPSC+L G  S GEFYS+A++N  Q  D+GTKM+H+  
Sbjct: 294 CRGKNSKISWSQVETGSAITWKYPSCVLLGANSTGEFYSVALTNNKQIADTGTKMIHIGP 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
            T S+I+SKGIS G S N+YRG V +   AA ++NF+QCDSLLIG+   A+T PYI+SK 
Sbjct: 354 KTRSKIISKGISVGKSKNSYRGLVEIGTRAAGAKNFSQCDSLLIGDEAEANTYPYIQSKQ 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S  N+EHEA+TSKIS++ LFY   RGI  E A++++VNGF R+V  KLPMEFA EA  L+
Sbjct: 414 SKSNIEHEASTSKISEDQLFYLQSRGISNEEAVSMMVNGFCRDVFNKLPMEFASEANNLL 473

Query: 481 DISLEGSVG 489
            + LEGSVG
Sbjct: 474 ALKLEGSVG 482


>gi|124024850|ref|YP_001013966.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. NATL1A]
 gi|123959918|gb|ABM74701.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           NATL1A]
          Length = 480

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 307/481 (63%), Positives = 385/481 (80%), Gaps = 5/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + V +I    YKYGF T I+ +K PKGLNED+IR IS+KKNEP+++L++RL AY +WL M
Sbjct: 5   NTVEEIVSQPYKYGFITEIETEKIPKGLNEDVIRLISSKKNEPEFLLKFRLRAYEQWLKM 64

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           K+P W+ + Y  +D+ DL YYAAPK  +  +SLD+VDP+LL T+EKLGIP+ EQ+ L+  
Sbjct: 65  KEPDWSGLTYSKVDYQDLVYYAAPKQDIKKKSLDEVDPKLLETFEKLGIPLSEQKRLS-- 122

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVS+ TT+KE+L + GVIF  ISEAI E+PDL++KY+ TVVP+ DNF+
Sbjct: 123 ---NVAVDAVFDSVSIATTYKEKLAEHGVIFCSISEAISEYPDLIEKYMGTVVPLNDNFF 179

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFVYIPKGV CPMELS+YFRIN   TGQFERTLIIA+E S VSYLEGCT
Sbjct: 180 AALNSAVFSDGSFVYIPKGVECPMELSSYFRINSGDTGQFERTLIIAEESSSVSYLEGCT 239

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP  D N LHAAVVELVALDNA IKYSTVQNWY G+ +G GGIYNFVTKRG+CRG +SKI
Sbjct: 240 APMFDTNTLHAAVVELVALDNASIKYSTVQNWYAGNEEGVGGIYNFVTKRGECRGKKSKI 299

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SW+Q+ETGSAITWKYPSC+L+G+ S GEFYSIA++N  Q+ D+GTKM+H+ KNT S+IVS
Sbjct: 300 SWSQVETGSAITWKYPSCVLQGDNSIGEFYSIALTNNCQKADTGTKMIHIGKNTKSKIVS 359

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S N+YRG VS+   A  +RN++QCDS+LIG+   A+T PYI+SK    N+EHE
Sbjct: 360 KGISAGKSKNSYRGLVSISPNAEGARNYSQCDSMLIGDKASANTYPYIQSKQPQSNIEHE 419

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           A+T +IS++ LFY   RGI  E +++++V+GF  +V  +LPMEFA EA KL+ + LEGSV
Sbjct: 420 ASTCRISEDQLFYLQSRGIDFEESVSMLVSGFCSDVFNELPMEFASEADKLLALKLEGSV 479

Query: 489 G 489
           G
Sbjct: 480 G 480


>gi|15838077|ref|NP_298765.1| cysteine desulfurase activator complex subunit SufB [Xylella
           fastidiosa 9a5c]
 gi|9106500|gb|AAF84285.1|AE003977_8 ABC transporter membrane protein [Xylella fastidiosa 9a5c]
          Length = 485

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 318/487 (65%), Positives = 385/487 (79%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++D  +Y+ GF T I+ D  P GLNE IIR +SAKK+EP+WM EWRL AY
Sbjct: 6   ATPQNAEILERLDR-RYEAGFVTEIESDSLPPGLNEIIIRALSAKKHEPEWMTEWRLAAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA++    IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLNMPMPEWAKLHIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVS+ TTF++EL + G+IF  ISEAI EHPDL+++YL +VVP
Sbjct: 124 ARLAG-----VAVDAVFDSVSLGTTFRKELAEKGIIFCSISEAIQEHPDLIRQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           V DN++AALNSAVF+DGSFV+IPKGVRCPMELSTYFRIN   TGQFERTLI+ +E +YVS
Sbjct: 179 VRDNYFAALNSAVFSDGSFVFIPKGVRCPMELSTYFRINAGHTGQFERTLIVCEEQAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVA ++AEIKYSTVQNWYPGD  G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPIRDENQLHAAVVELVAQEDAEIKYSTVQNWYPGDEAGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK+ WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A++   QQ D+GTKM+H+ K T
Sbjct: 299 GARSKVIWTQVETGSAITWKYPSCVLLGDDSTGEFHSVALTRHHQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V + R A  +RN TQCDSLLIG  CGAHT PYIE K+ +
Sbjct: 359 KSKIVSKGISAGHGQNTYRGLVKIDRNAEGARNHTQCDSLLIGKQCGAHTFPYIEVKHPN 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI EE A+++IV+GF ++V ++LPMEFAVEA+KL+DI
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGIAEEDAVSIIVDGFCKQVFRELPMEFAVEAKKLLDI 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|325953988|ref|YP_004237648.1| FeS assembly protein SufB [Weeksella virosa DSM 16922]
 gi|323436606|gb|ADX67070.1| FeS assembly protein SufB [Weeksella virosa DSM 16922]
          Length = 485

 Score =  539 bits (1388), Expect = e-151,   Method: Composition-based stats.
 Identities = 328/491 (66%), Positives = 390/491 (79%), Gaps = 8/491 (1%)

Query: 1   MVAVRETVDKVRKIDVD--QYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWR 58
           M   + T D +R+      +Y++G+ET ++ +  P GLNEDI+R IS KK EP+WM EWR
Sbjct: 1   MSNTKYTEDDLREDLAKPREYEFGWETEMEYEDFPIGLNEDIVRAISKKKEEPEWMTEWR 60

Query: 59  LLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIP 118
           L A+R W  M +P WA I Y   DF  + YYAAPK      SLD+VDPELLRT+E+LGI 
Sbjct: 61  LEAFRAWQKMTEPEWANIHYEKPDFQAIRYYAAPKVKKELASLDEVDPELLRTFERLGIS 120

Query: 119 IREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLS 178
           + EQ+ L G     VA+DAV DSVSV TTF+E L + G+IFM ISEAI EHP+LV+KY+ 
Sbjct: 121 LDEQKRLTG-----VAIDAVIDSVSVKTTFQETLAEKGIIFMSISEAIKEHPELVRKYIG 175

Query: 179 TVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEG 238
            VVP  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN  GTGQFERTL+IADEG
Sbjct: 176 KVVPPTDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINSAGTGQFERTLLIADEG 235

Query: 239 SYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKR 298
           SYVSYLEGCTAP RDENQLHAAVVEL+ +++AEIKYSTVQNWYPGD  GKGG++NFVTKR
Sbjct: 236 SYVSYLEGCTAPMRDENQLHAAVVELIVMEDAEIKYSTVQNWYPGDEHGKGGVFNFVTKR 295

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
             C    +K+SWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N +QQ D+GTKM H+
Sbjct: 296 AVC-EKNAKVSWTQVETGSAVTWKYPSCILKGDNSVGEFYSIAVTNNYQQADTGTKMYHI 354

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
            KNT S I+SKGISAG S N+YRG V +++ A+ +RNFTQCDSLL+GN CGAHT PYIE 
Sbjct: 355 GKNTRSTIISKGISAGRSQNSYRGLVKINKNASGARNFTQCDSLLMGNECGAHTFPYIEM 414

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           +NS+  LEHEATTSKI ++ LFYC QRGI  E AIALIVNGF REVL KLPMEFAVEA+K
Sbjct: 415 ENSTAKLEHEATTSKIGEDQLFYCNQRGIDTEKAIALIVNGFSREVLDKLPMEFAVEAKK 474

Query: 479 LIDISLEGSVG 489
           L++ISLEGSVG
Sbjct: 475 LLEISLEGSVG 485


>gi|301166542|emb|CBW26118.1| putative ABC transportsystem, membrane protein [Bacteriovorax
           marinus SJ]
          Length = 475

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 309/478 (64%), Positives = 389/478 (81%), Gaps = 5/478 (1%)

Query: 12  RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP 71
            +I  ++YKYGF T+I+ ++ PKGLNE+I+R IS KK EP W+LE+RL A++ W TMK+P
Sbjct: 3   EEILQEEYKYGFYTDIETEEFPKGLNEEIVRLISKKKEEPQWLLEYRLKAFKLWKTMKEP 62

Query: 72  SWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTS 131
           +WA++  PAIDF+DLYYYAAPK      SLD+VDPELL T+EKLGIP+ EQ+ ++G    
Sbjct: 63  NWAKLDIPAIDFEDLYYYAAPKKKEALSSLDEVDPELLATFEKLGIPLSEQKRISG---- 118

Query: 132 KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAAL 191
            VAVDAVFDSVSV TT+KE+L+K GVIF  ISEA+ ++P+LVKKYL TVVP  DNFYAAL
Sbjct: 119 -VAVDAVFDSVSVATTYKEDLEKVGVIFCSISEAVKDYPELVKKYLGTVVPPADNFYAAL 177

Query: 192 NSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQ 251
           NSAVF+DGSFVYIP+GV CPM+LSTYFRIN K TGQFERTLI+A++GS+V+YLEGCTAPQ
Sbjct: 178 NSAVFSDGSFVYIPEGVTCPMDLSTYFRINAKETGQFERTLIVAEKGSFVNYLEGCTAPQ 237

Query: 252 RDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWT 311
           RDENQLHAA+VE+VALD+AE+KYSTVQNWY G+ +G GGIYNFVTKRG+C G  SKISWT
Sbjct: 238 RDENQLHAAIVEIVALDDAEVKYSTVQNWYAGNKEGIGGIYNFVTKRGNCLGRNSKISWT 297

Query: 312 QLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGI 371
           Q+E GSAITWKYPSC L G+ S G FYS+A++N   Q D+GTKM+H+ KNT S I+SKGI
Sbjct: 298 QVEAGSAITWKYPSCNLIGDNSQGAFYSVALTNNKMQADTGTKMVHIGKNTKSTIISKGI 357

Query: 372 SAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATT 431
           SA  S N YRG V V   A  +RN++QCDS+L+G+ C A+T PYI+ KN++  +EHEA+T
Sbjct: 358 SAEQSENNYRGLVKVMPSATGARNYSQCDSMLVGDKCAANTFPYIDVKNNTATVEHEAST 417

Query: 432 SKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           SKIS++ LFY  QRG+  E  I++IVNGF  +V ++LP+EF+VEA KLI++ LE S+G
Sbjct: 418 SKISEDQLFYLQQRGMDMEKCISMIVNGFCSDVFKELPLEFSVEAVKLIEMKLENSIG 475


>gi|288928617|ref|ZP_06422463.1| FeS assembly protein SufB [Prevotella sp. oral taxon 317 str.
           F0108]
 gi|288329601|gb|EFC68186.1| FeS assembly protein SufB [Prevotella sp. oral taxon 317 str.
           F0108]
          Length = 483

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 304/490 (62%), Positives = 386/490 (78%), Gaps = 8/490 (1%)

Query: 1   MVAVRETVDK-VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRL 59
           M  V+   +  VR +   +Y++GF T+++ D   KGLNED++R IS+KKNEP+W+L +RL
Sbjct: 1   MEEVKNEKNAYVRSVAEQKYEFGFTTDVETDIIEKGLNEDVVRLISSKKNEPEWLLAFRL 60

Query: 60  LAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPI 119
            A+  W T+K P+WA +  P ID+ D+ YYA P +        ++DPEL +T++KLGIP+
Sbjct: 61  KAFNHWKTLKQPNWAHVNLPEIDYQDISYYADPMAKKPAN--KELDPELEKTFDKLGIPL 118

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            E+ +L G     VAVDA+ DSVSV TTFKE+L + GVIF  I EA+ EHPDLV++YL +
Sbjct: 119 EERLVLGG-----VAVDAIMDSVSVKTTFKEKLAEKGVIFCSIGEAVQEHPDLVQQYLGS 173

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DNF+AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN + TGQFERTLI+A++ +
Sbjct: 174 VVPYSDNFFAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINARNTGQFERTLIVAEDDT 233

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA+VE++  DNAE+KYSTVQNWYPGD  GKGG++N VTKRG
Sbjct: 234 YVSYLEGCTAPMRDENQLHAAIVEIIVKDNAEVKYSTVQNWYPGDEHGKGGVFNLVTKRG 293

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           D RG+ SK+SWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N +QQ D+GTKM+H+ 
Sbjct: 294 DLRGVNSKLSWTQVETGSAITWKYPSCILRGDNSQAEFYSVAVTNNYQQADTGTKMIHMG 353

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G+ CGAHT PY++  
Sbjct: 354 KNTKSTIISKGISAGRSQNSYRGLVRATANADNARNYSSCDSLLLGDKCGAHTFPYMDIH 413

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEATTSKIS+  LFYC QRGIP E A+ LIVNG+ +EVL KLPMEFAVEAQKL
Sbjct: 414 NDTAIIEHEATTSKISEAQLFYCNQRGIPTEQAVGLIVNGYAKEVLNKLPMEFAVEAQKL 473

Query: 480 IDISLEGSVG 489
           + +SLEG+VG
Sbjct: 474 LSVSLEGTVG 483


>gi|119945240|ref|YP_942920.1| cysteine desulfurase activator complex subunit SufB [Psychromonas
           ingrahamii 37]
 gi|119863844|gb|ABM03321.1| FeS assembly protein SufB [Psychromonas ingrahamii 37]
          Length = 483

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 314/490 (64%), Positives = 397/490 (81%), Gaps = 9/490 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   R+ +D+       +Y +GF T+++ D  P GL+E +IR ISA+K+EPD+ML+WRL 
Sbjct: 2   MAKSRQNLDR---FVGSEYPHGFVTDLETDSLPAGLSETVIRQISARKHEPDFMLQWRLK 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSI-VGPQSLDDVDPELLRTYEKLGIPI 119
           AY+ WLT+K P W+++ YP I+FD++ +Y+APK+   GP+SLD + PE+L+TYEKLGIP+
Sbjct: 59  AYQHWLTLKVPKWSKLHYPPINFDEIVFYSAPKTAADGPKSLDQIAPEILQTYEKLGIPL 118

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            E+  LAG     VAVDAVFDSVSV TTFK++L   GVIF   S+A+ EHP+LVK+YL T
Sbjct: 119 HERPQLAG-----VAVDAVFDSVSVATTFKKKLAAVGVIFCSFSDAVQEHPELVKRYLGT 173

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN+YAALN+AVF+DGSF Y+PKGVRCPMELSTYFRIN   TGQFERTLI+ +EG+
Sbjct: 174 VVPYTDNYYAALNAAVFSDGSFCYVPKGVRCPMELSTYFRINSLNTGQFERTLIVVEEGA 233

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDE+QLHAAVVEL+ALD+ EIKY+TVQNWYPGD +GKGGIYNFVTKRG
Sbjct: 234 YVSYLEGCTAPIRDEHQLHAAVVELIALDDGEIKYATVQNWYPGDKKGKGGIYNFVTKRG 293

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            CRG  SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A++N +QQ D+GTKM+H+ 
Sbjct: 294 LCRGHHSKISWTQVETGSAITWKYPSVILQGDNSRGEFYSVALTNNYQQADTGTKMIHIG 353

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT+S I+SKGISAG  +N YRG V +   A ++RN++QCDSLL+G NC AHT PYIE K
Sbjct: 354 KNTSSTIISKGISAGHGSNAYRGLVKIGPKAVNARNYSQCDSLLLGENCAAHTFPYIEVK 413

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           NS+  +EHEA+TSKISD+ LFYC+QRGI +E  +A+I+NGF + V +KLPMEFAVEAQ L
Sbjct: 414 NSTAKVEHEASTSKISDQQLFYCMQRGISQEDTVAMIINGFCKTVFRKLPMEFAVEAQAL 473

Query: 480 IDISLEGSVG 489
           +++SLEG  G
Sbjct: 474 MEVSLEGCTG 483


>gi|170730003|ref|YP_001775436.1| cysteine desulfurase activator complex subunit SufB [Xylella
           fastidiosa M12]
 gi|167964796|gb|ACA11806.1| ABC transporter membrane protein [Xylella fastidiosa M12]
          Length = 485

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 317/487 (65%), Positives = 383/487 (78%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           A  +  + + ++D   Y+ GF T I+ D  P GLNE IIR +SAKK+EP+WM EWRL AY
Sbjct: 6   ATPQNAEILERLDR-HYEAGFVTQIESDSLPPGLNETIIRALSAKKHEPEWMTEWRLAAY 64

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R WL M  P WA++    IDF  L YY+APK      SLD+V  ELL TY+KLG+P+ E+
Sbjct: 65  RHWLNMPMPEWAKLHIAPIDFQALSYYSAPKG-PKYASLDEVPKELLDTYDKLGVPLHER 123

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             LAG     VAVDAVFDSVS+ TTF++EL + G+IF  ISEAI EHPDL+++YL +VVP
Sbjct: 124 ARLAG-----VAVDAVFDSVSLGTTFRKELAEKGIIFCSISEAIQEHPDLIRQYLGSVVP 178

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
           V DN++AALNSAVF+DGSFV+IPK VRCPMELSTYFRIN   TGQFERTLI+ +E +YVS
Sbjct: 179 VRDNYFAALNSAVFSDGSFVFIPKSVRCPMELSTYFRINAGHTGQFERTLIVCEEQAYVS 238

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVELVA ++AEIKYSTVQNWYPGD  G+GGIYNFVTKR +CR
Sbjct: 239 YLEGCTAPIRDENQLHAAVVELVAQEDAEIKYSTVQNWYPGDEAGRGGIYNFVTKRAECR 298

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G RSK+ WTQ+ETGSAITWKYPSC+L G+ S GEF+S+A++   QQ D+GTKM+H+ K T
Sbjct: 299 GARSKVIWTQVETGSAITWKYPSCVLLGDDSTGEFHSVALTRHHQQADTGTKMIHIGKRT 358

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S+IVSKGISAG   NTYRG V + R A  +RN TQCDSLLIG  CGAHT PYIE K+ +
Sbjct: 359 KSKIVSKGISAGHGQNTYRGLVKIDRNAEGARNHTQCDSLLIGKQCGAHTFPYIEVKHPN 418

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKISD+ LFYC  RGI EE A+++IV+GF ++V ++LPMEFAVEA+KL+DI
Sbjct: 419 ATVEHEATTSKISDDQLFYCRARGIAEEDAVSIIVDGFCKQVFRELPMEFAVEAKKLLDI 478

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 479 SLEGSVG 485


>gi|87301373|ref|ZP_01084214.1| FeS assembly protein SufB [Synechococcus sp. WH 5701]
 gi|87284341|gb|EAQ76294.1| FeS assembly protein SufB [Synechococcus sp. WH 5701]
          Length = 480

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 298/489 (60%), Positives = 379/489 (77%), Gaps = 9/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M +       V  +    YKYGF T+I+ DK  KGL+ED++R IS+KK+EP ++L++RL 
Sbjct: 1   MSSTTS----VGDLVSQPYKYGFVTDIETDKIDKGLSEDVVRLISSKKDEPQFLLDFRLR 56

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR+WL M++P WA + +PAID+ ++ YYAAP+      SLD+VDP+LL T++KLGIP+ 
Sbjct: 57  AYRQWLRMEEPDWAALGHPAIDYQEMIYYAAPRQQEKKASLDEVDPKLLETFDKLGIPLS 116

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ L+      VAVDAVFDSVS+ TT++E+L + GVIF  ISEA+ +HP+L+++YL TV
Sbjct: 117 EQKRLS-----NVAVDAVFDSVSIATTYREKLAEHGVIFCSISEAVKDHPELIERYLGTV 171

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNF+AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ 
Sbjct: 172 VPSNDNFFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGAS 231

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG 
Sbjct: 232 VSYLEGCTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGH 291

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           CRG RS ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+  
Sbjct: 292 CRGDRSHISWTQVETGSAITWKYPSCVLQGAHSVGEFYSVALTNNLQQADTGTKMVHVGP 351

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           +T S IVSKGISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+ 
Sbjct: 352 HTRSTIVSKGISAGHSSNSYRGLVQIGPKARGARNYSQCDSMLIGDQAAANTYPYIRSQQ 411

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
              ++EHEA+T +IS + LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+
Sbjct: 412 PEASVEHEASTCRISADQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLL 471

Query: 481 DISLEGSVG 489
            + LEGSVG
Sbjct: 472 ALKLEGSVG 480


>gi|110834726|ref|YP_693585.1| cysteine desulfurase activator complex subunit SufB [Alcanivorax
           borkumensis SK2]
 gi|110647837|emb|CAL17313.1| permease component of ABC transporter for Fe-S cluster assmb
           [Alcanivorax borkumensis SK2]
          Length = 479

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 330/481 (68%), Positives = 393/481 (81%), Gaps = 7/481 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
           ++ K+    Y+ GF T +  +  P GL+E++IRF+SAKK EP+WMLEWRL +YR+W  M 
Sbjct: 5   ELDKLIRSNYEAGFTTTVDTETLPPGLSEEVIRFLSAKKGEPEWMLEWRLDSYRKWQEMP 64

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
            P WA + +P IDF+++ YY+ PKS    P+SLD+VDPELL TYEKLGIP+ EQE+LAG 
Sbjct: 65  TPGWAHLHHPPIDFNEVSYYSKPKSLDDAPKSLDEVDPELLATYEKLGIPLHEQEMLAG- 123

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVD VFDS SV TTFKE+L ++GVIF  ISEAI E+P+LV+KY+ +VVP GDNFY
Sbjct: 124 ----VAVDVVFDSSSVFTTFKEKLWEAGVIFCSISEAIQEYPELVQKYMGSVVPKGDNFY 179

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           AALNSAVF+DGSFVYIPKGVRCPMELSTYFRINE  TGQFERTLIIADEGSYVSYLEGCT
Sbjct: 180 AALNSAVFSDGSFVYIPKGVRCPMELSTYFRINEANTGQFERTLIIADEGSYVSYLEGCT 239

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           APQRDENQLHAAVVELVAL  AEIKYSTVQNWYPGD  GKGGIYNFVTKRG      SKI
Sbjct: 240 APQRDENQLHAAVVELVALPGAEIKYSTVQNWYPGDENGKGGIYNFVTKRGIAH-DNSKI 298

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+S
Sbjct: 299 SWTQVETGSAITWKYPSVILRGDNSIGEFYSVALTRHMQQADTGTKMIHLGKNTKSTIIS 358

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISAG S+N+YRG V +   A ++RNFTQCDSLL+G+ CGAHT PYIESKN +  +EHE
Sbjct: 359 KGISAGRSSNSYRGLVRISPRAENARNFTQCDSLLLGDTCGAHTFPYIESKNPTATIEHE 418

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSK+SD+ +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++SLEG+V
Sbjct: 419 ATTSKVSDDQMFLCRQRGIDPEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEVSLEGAV 478

Query: 489 G 489
           G
Sbjct: 479 G 479


>gi|208779237|ref|ZP_03246583.1| FeS assembly protein SufB [Francisella novicida FTG]
 gi|208745037|gb|EDZ91335.1| FeS assembly protein SufB [Francisella novicida FTG]
          Length = 481

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 336/482 (69%), Positives = 402/482 (83%), Gaps = 4/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF TNI+ +    GLNED+IR ISA+KNEP+++LEWRL AY +WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNEPEFLLEWRLKAYHKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + +P IDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQE+LAG
Sbjct: 63  KSPKWADLNHPPIDFQAISYYSSPKSLKNHPKSLDEVDPEIIETYNKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--RNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGC
Sbjct: 181 FAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCH-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   AA++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEAQKL+++SLEG+
Sbjct: 420 EATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGA 479

Query: 488 VG 489
           VG
Sbjct: 480 VG 481


>gi|11467362|ref|NP_043219.1| putative ABC transporter [Cyanophora paradoxa]
 gi|1351747|sp|P48260|YCF24_CYAPA RecName: Full=UPF0051 protein ycf24
 gi|1016163|gb|AAA81250.1| ABC transporter subunit [Cyanophora paradoxa]
          Length = 486

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 313/491 (63%), Positives = 380/491 (77%), Gaps = 7/491 (1%)

Query: 1   MVAVRETVDK-VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRL 59
           MV  +   +  +  +    YKYG     +++   KGL E+ IR IS KKNEP +MLE+RL
Sbjct: 1   MVNTQSPKNSGLENLVNQPYKYGLPLIFEIETISKGLTEETIRLISEKKNEPQFMLEFRL 60

Query: 60  LAYRRWLTMK-DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIP 118
            AYR+WL M  +P WA + YP I++ D+ YY+APK     QSLD+VDP LL T+EKLGIP
Sbjct: 61  QAYRKWLEMSNEPEWAHLNYPKINYQDMVYYSAPKQKKKLQSLDEVDPTLLETFEKLGIP 120

Query: 119 IREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLS 178
           + EQ+ LA      VAVDA+FDSVSV TTFKEEL K GVIF PISEA+ ++PDL+KKYL 
Sbjct: 121 LTEQKRLA-----NVAVDAIFDSVSVATTFKEELAKEGVIFCPISEAVQKYPDLIKKYLG 175

Query: 179 TVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEG 238
           +VV   DN+++ LN+AVF+DGSF YIPK VRCP+ELSTYFRIN   +GQFERTLI+ADEG
Sbjct: 176 SVVSTSDNYFSCLNAAVFSDGSFCYIPKNVRCPLELSTYFRINNGESGQFERTLIVADEG 235

Query: 239 SYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKR 298
           SYVSYLEGCTAPQ D NQLHAAVVELVALDNAEIKYSTVQNWY GD  GKGGIYNFVTKR
Sbjct: 236 SYVSYLEGCTAPQFDTNQLHAAVVELVALDNAEIKYSTVQNWYAGDENGKGGIYNFVTKR 295

Query: 299 GDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHL 358
           G C G  SKISWTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+H+
Sbjct: 296 GLCAGKNSKISWTQVETGSAITWKYPSCVLLGDNSIGEFYSVALTNRYQQADTGTKMIHI 355

Query: 359 AKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIES 418
            KNT SRI+SKGISAG S N+YRG V +   A  +RN++QCDSLLIG+N  A+T P+++ 
Sbjct: 356 GKNTRSRIISKGISAGHSQNSYRGLVKIGPKAVGARNYSQCDSLLIGDNSQANTFPHLQI 415

Query: 419 KNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQK 478
           KN +  +EHEA+TSKI +E +FY LQRGI  E AI+LI++GF REV   LPMEFA+EA K
Sbjct: 416 KNPTAKVEHEASTSKIGEEQIFYFLQRGINAEEAISLIISGFCREVFNNLPMEFALEADK 475

Query: 479 LIDISLEGSVG 489
           L+ + LEGSVG
Sbjct: 476 LLGLKLEGSVG 486


>gi|87125292|ref|ZP_01081138.1| FeS assembly protein SufB [Synechococcus sp. RS9917]
 gi|86167061|gb|EAQ68322.1| FeS assembly protein SufB [Synechococcus sp. RS9917]
          Length = 480

 Score =  538 bits (1387), Expect = e-151,   Method: Composition-based stats.
 Identities = 298/484 (61%), Positives = 374/484 (77%), Gaps = 6/484 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T    R +    YKYGF T+I  DK  KGL+ED++R ISAKK EP+++L +RL AYR WL
Sbjct: 2   TSVSTRDLVSQPYKYGFVTDIATDKIAKGLSEDVVRLISAKKGEPEFLLNFRLKAYRHWL 61

Query: 67  TMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQS-LDDVDPELLRTYEKLGIPIREQEIL 125
           T+++P WA + YP I++ D+ YYAAPK     +S LD+VDP+LL T+EKLGIP+ EQ+ L
Sbjct: 62  TLEEPDWAALGYPPINYQDIIYYAAPKQPQEKKSSLDEVDPKLLETFEKLGIPLNEQKRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           +      VAVDAVFDSVS+ TT+KE+L + GV+F   +EA+ EHP+L+++YL TVV   D
Sbjct: 122 S-----NVAVDAVFDSVSIATTYKEKLAEHGVVFCSFAEAVKEHPELIERYLGTVVSSND 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLI+A+EG+ VSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIVAEEGASVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  G GGIYNFVTKRG CRG R
Sbjct: 237 GCTAPMFDTNQLHAAVVELVALDDASIKYSTVQNWYAGDENGVGGIYNFVTKRGQCRGAR 296

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           S+ISWTQ+ETGSAITWKYPSC+L+G  S GEFYS+A++N  QQ D+GTKM+H+   T S 
Sbjct: 297 SRISWTQVETGSAITWKYPSCVLQGADSVGEFYSVALTNNCQQADTGTKMVHVGPRTRST 356

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           IVSKGISAG S+N+YRG V +   A  +RN++QCDS+LIG+   A+T PYI S+     +
Sbjct: 357 IVSKGISAGRSSNSYRGLVQMAPSAKGARNYSQCDSMLIGDQAAANTYPYIRSQQPQAAI 416

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEA+T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LE
Sbjct: 417 EHEASTCRISEDQLFYLQSRGIGFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLE 476

Query: 486 GSVG 489
           GSVG
Sbjct: 477 GSVG 480


>gi|88799894|ref|ZP_01115466.1| Cysteine desulfurase activator SufB [Reinekea sp. MED297]
 gi|88777325|gb|EAR08528.1| Cysteine desulfurase activator SufB [Reinekea sp. MED297]
          Length = 479

 Score =  537 bits (1384), Expect = e-150,   Method: Composition-based stats.
 Identities = 334/483 (69%), Positives = 400/483 (82%), Gaps = 8/483 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           ++V++    +Y+ GF TN++    P GLNED+IR ISAKK EP+W+LEWRL AYR W  M
Sbjct: 3   EEVKQYIKSEYEAGFTTNVESATIPPGLNEDVIRLISAKKQEPEWLLEWRLKAYRAWEQM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVG--PQSLDDVDPELLRTYEKLGIPIREQEILA 126
           ++P WA + YP  DF  L YY++PKS+    P+SLD+VDPELL TYEKLGIP+ EQE+LA
Sbjct: 63  EEPDWAHVTYPKPDFQALSYYSSPKSMEENRPKSLDEVDPELLATYEKLGIPVHEQEVLA 122

Query: 127 GVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDN 186
           G     VAVD VFDSVSV TTF+++LK +GVIF PISEA+ E+P+LVKKYL +VVP  DN
Sbjct: 123 G-----VAVDMVFDSVSVGTTFRQKLKDAGVIFCPISEAVHEYPELVKKYLGSVVPQRDN 177

Query: 187 FYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEG 246
           +YAALNSAVF+DGSFVYIPKGVRCPMELSTYFRINE  TGQFERTLIIADE S+VSYLEG
Sbjct: 178 YYAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINEAKTGQFERTLIIADESSHVSYLEG 237

Query: 247 CTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRS 306
           CTAP RDENQLHAAVVELVALD+AEIKYSTVQNWYPGD++GKGGIYNFVTKRG     RS
Sbjct: 238 CTAPMRDENQLHAAVVELVALDDAEIKYSTVQNWYPGDAEGKGGIYNFVTKRGIAH-TRS 296

Query: 307 KISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRI 366
           KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A+++  QQ D+GTKM+HL KNT S I
Sbjct: 297 KISWTQVETGSAVTWKYPSCILKGDDSIGEFYSVALTSNHQQADTGTKMIHLGKNTRSTI 356

Query: 367 VSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLE 426
           +SKGISA  S NTYRG V ++ GA+ +RNFTQCDSLLIG+  GAHT PYIESKN S  +E
Sbjct: 357 ISKGISAMKSENTYRGLVRMNPGASGARNFTQCDSLLIGDQSGAHTFPYIESKNPSAVVE 416

Query: 427 HEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEG 486
           HEATTSK+SD+ +F C QRGI  E A+++IVNGF +EV ++LPMEFAVEA KL+++SLEG
Sbjct: 417 HEATTSKVSDDQMFLCQQRGIDPEKAVSMIVNGFCKEVFKELPMEFAVEAGKLLEVSLEG 476

Query: 487 SVG 489
           +VG
Sbjct: 477 AVG 479


>gi|315636033|ref|ZP_07891292.1| FeS assembly protein SufB [Arcobacter butzleri JV22]
 gi|315479689|gb|EFU70363.1| FeS assembly protein SufB [Arcobacter butzleri JV22]
          Length = 478

 Score =  537 bits (1384), Expect = e-150,   Method: Composition-based stats.
 Identities = 319/481 (66%), Positives = 386/481 (80%), Gaps = 7/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
            ++  +   +YK GFET +Q D   KGLNED+IR ISAKK+EP W+L++RL AY +WL M
Sbjct: 5   QQIHDVINKEYKLGFETLVQSDTFEKGLNEDVIRAISAKKDEPSWLLDFRLKAYEKWLKM 64

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           ++P+WA ++YP ID+ D+ YY+APK      SLD+VDPE+L+TYEKLGIP+ EQ+ LAG 
Sbjct: 65  EEPTWANLKYPKIDYQDIAYYSAPK--KALNSLDEVDPEILKTYEKLGIPLEEQKQLAG- 121

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVSV TT++EEL+K G+IF  ISEA  ++P+LVK YL++VVP  DN++
Sbjct: 122 ----VAVDAVFDSVSVKTTYQEELEKLGIIFCSISEAAHKYPELVKNYLASVVPTVDNYF 177

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           + LNSAVFTDGSFVYIP   RCPMELSTYFRIN   TGQFERTLII DE SYVSY EGC+
Sbjct: 178 SCLNSAVFTDGSFVYIPPNTRCPMELSTYFRINALNTGQFERTLIICDENSYVSYNEGCS 237

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RDE QLHAAVVEL AL NA IKYST+QNW+PGD +GKGGI NFVTKRG C+G  SKI
Sbjct: 238 APTRDERQLHAAVVELCALKNAHIKYSTIQNWFPGDDKGKGGILNFVTKRGLCKGDNSKI 297

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+AI++  QQ D+GTKM+HL KNT S I+S
Sbjct: 298 SWTQVETGSAITWKYPSCVLQGDNSVGEFYSVAIASKSQQADTGTKMIHLGKNTKSTIIS 357

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISA    N YRG V V + A ++RN ++CDSLLIG+ C AHT PY E +NSS N+EHE
Sbjct: 358 KGISAMHGVNAYRGLVKVGKNAQNARNISECDSLLIGHKCQAHTYPYHEIRNSSANIEHE 417

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSKISDE LFY  QRGI EE AIA+IVNGF +EVL++LPMEFA EA++L++ISLEGSV
Sbjct: 418 ATTSKISDEQLFYLNQRGIDEENAIAMIVNGFCKEVLKELPMEFAAEAKELLNISLEGSV 477

Query: 489 G 489
           G
Sbjct: 478 G 478


>gi|157736862|ref|YP_001489545.1| Fe-S assembly ABC transporter, permease protein [Arcobacter
           butzleri RM4018]
 gi|157698716|gb|ABV66876.1| Fe-S assembly ABC transporter, permease protein [Arcobacter
           butzleri RM4018]
          Length = 489

 Score =  537 bits (1384), Expect = e-150,   Method: Composition-based stats.
 Identities = 319/481 (66%), Positives = 386/481 (80%), Gaps = 7/481 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
            ++  +   +YK GFET +Q D   KGLNED+IR ISAKK+EP W+L++RL AY +WL M
Sbjct: 16  QQIHDVINKEYKLGFETLVQSDTFEKGLNEDVIRAISAKKDEPSWLLDFRLKAYEKWLKM 75

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGV 128
           ++P+WA ++YP ID+ D+ YY+APK      SLD+VDPE+L+TYEKLGIP+ EQ+ LAG 
Sbjct: 76  EEPTWANLKYPKIDYQDIAYYSAPK--KALNSLDEVDPEILKTYEKLGIPLEEQKQLAG- 132

Query: 129 QTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFY 188
               VAVDAVFDSVSV TT++EEL+K G+IF  ISEA  ++P+LVK YL++VVP  DN++
Sbjct: 133 ----VAVDAVFDSVSVKTTYQEELEKLGIIFCSISEAAHKYPELVKNYLASVVPTVDNYF 188

Query: 189 AALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCT 248
           + LNSAVFTDGSFVYIP   RCPMELSTYFRIN   TGQFERTLII DE SYVSY EGC+
Sbjct: 189 SCLNSAVFTDGSFVYIPPNTRCPMELSTYFRINALNTGQFERTLIICDENSYVSYNEGCS 248

Query: 249 APQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKI 308
           AP RDE QLHAAVVEL AL NA IKYST+QNW+PGD +GKGGI NFVTKRG C+G  SKI
Sbjct: 249 APTRDERQLHAAVVELCALKNAHIKYSTIQNWFPGDDKGKGGILNFVTKRGLCKGDNSKI 308

Query: 309 SWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVS 368
           SWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+AI++  QQ D+GTKM+HL KNT S I+S
Sbjct: 309 SWTQVETGSAITWKYPSCVLQGDNSVGEFYSVAIASKSQQADTGTKMIHLGKNTKSTIIS 368

Query: 369 KGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHE 428
           KGISA    N YRG V V + A ++RN ++CDSLLIG+ C AHT PY E +NSS N+EHE
Sbjct: 369 KGISAMHGVNAYRGLVKVGKNAQNARNISECDSLLIGHKCQAHTYPYHEIRNSSANIEHE 428

Query: 429 ATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSV 488
           ATTSKISDE LFY  QRGI EE AIA+IVNGF +EVL++LPMEFA EA++L++ISLEGSV
Sbjct: 429 ATTSKISDEQLFYLNQRGIDEENAIAMIVNGFCKEVLKELPMEFAAEAKELLNISLEGSV 488

Query: 489 G 489
           G
Sbjct: 489 G 489


>gi|89256549|ref|YP_513911.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. holarctica LVS]
 gi|115314980|ref|YP_763703.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. holarctica OSU18]
 gi|156502668|ref|YP_001428733.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. holarctica FTNF002-00]
 gi|167010974|ref|ZP_02275905.1| FeS assembly protein SufB [Francisella tularensis subsp. holarctica
           FSC200]
 gi|254367873|ref|ZP_04983893.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|254369465|ref|ZP_04985477.1| ABC transporter [Francisella tularensis subsp. holarctica FSC022]
 gi|290953095|ref|ZP_06557716.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. holarctica URFT1]
 gi|295313701|ref|ZP_06804283.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. holarctica URFT1]
 gi|89144380|emb|CAJ79669.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica LVS]
 gi|115129879|gb|ABI83066.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Francisella tularensis subsp. holarctica OSU18]
 gi|134253683|gb|EBA52777.1| ABC transporter, membrane protein [Francisella tularensis subsp.
           holarctica 257]
 gi|156253271|gb|ABU61777.1| FeS assembly protein SufB [Francisella tularensis subsp. holarctica
           FTNF002-00]
 gi|157122415|gb|EDO66555.1| ABC transporter [Francisella tularensis subsp. holarctica FSC022]
          Length = 481

 Score =  537 bits (1384), Expect = e-150,   Method: Composition-based stats.
 Identities = 335/482 (69%), Positives = 400/482 (82%), Gaps = 4/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF TNI+ +    GLNED+IR ISA+KNEP+++LEWRL AY +WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNEPEFLLEWRLKAYHKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + YP IDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQE+L G
Sbjct: 63  KSPKWADLNYPPIDFQAISYYSSPKSLKNHPKSLDEVDPEIIETYNKLGIPLHEQEMLVG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--RNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGC
Sbjct: 181 FAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCH-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   AA++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEA KL+++SLEG+
Sbjct: 420 EATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAHKLMEVSLEGA 479

Query: 488 VG 489
           VG
Sbjct: 480 VG 481


>gi|86140878|ref|ZP_01059437.1| hypothetical protein MED217_17040 [Leeuwenhoekiella blandensis
           MED217]
 gi|85832820|gb|EAQ51269.1| hypothetical protein MED217_17040 [Leeuwenhoekiella blandensis
           MED217]
          Length = 481

 Score =  537 bits (1384), Expect = e-150,   Method: Composition-based stats.
 Identities = 320/489 (65%), Positives = 388/489 (79%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    + ++  +++   +YKYGF T+I+ +  P GLNEDI+R IS KK EP+WM EWR+ 
Sbjct: 1   MAYTEDDLE--KELATKEYKYGFYTDIESETFPVGLNEDIVRAISKKKEEPEWMTEWRIE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W T+++P WA + Y   +F ++ YY+AP       SLD+VDPELL T+++LGI + 
Sbjct: 59  AFRHWQTLEEPEWANVHYEKPNFQNISYYSAPSKKPKYDSLDEVDPELLDTFKRLGISLD 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAGV    V          V TTFK+ L + G+IF  ISEAI EHP+LVKKY+ TV
Sbjct: 119 EQKKLAGVAVDVVMDSVS-----VTTTFKKTLAEKGIIFCSISEAIKEHPELVKKYIGTV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL++ADEGSY
Sbjct: 174 VPKTDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVVADEGSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+ALD+AEIKYSTVQNWYPG+ +GKGG+YNFVTKRG 
Sbjct: 234 VSYLEGCTAPSRDENQLHAAVVELIALDDAEIKYSTVQNWYPGNDEGKGGVYNFVTKRGL 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N FQQ D+GTKM+HL K
Sbjct: 294 C-EKNAKISWTQVETGSAVTWKYPSCVLKGDNSIGEFYSIAVTNNFQQADTGTKMIHLGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++  A ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 353 NTKSTIISKGISAGQSQNSYRGLVQINGRAENARNFSQCDSLLMGNKCGAHTFPYIEAKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 413 KSAKVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|228471850|ref|ZP_04056621.1| FeS assembly protein SufB [Capnocytophaga gingivalis ATCC 33624]
 gi|228276780|gb|EEK15483.1| FeS assembly protein SufB [Capnocytophaga gingivalis ATCC 33624]
          Length = 489

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 318/476 (66%), Positives = 383/476 (80%), Gaps = 3/476 (0%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP-SWA 74
             +YKYGF T+I+ D  PKGLNE+++  +S KKNEP WM +WR+ A+R W  M +P  WA
Sbjct: 15  NSEYKYGFYTDIESDTFPKGLNEEVVIALSKKKNEPQWMTDWRVEAFRIWQAMPEPPHWA 74

Query: 75  RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSK-V 133
            I++   DF D+ YY+APK      SLD+VDP+LL T++KLGI + EQ+ L GV+    V
Sbjct: 75  NIKFETPDFQDIAYYSAPKKKPKLNSLDEVDPQLLETFQKLGISLEEQKRLTGVEDKPAV 134

Query: 134 AVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNS 193
           A+D V DSVSV TTF++ L + G+IF  ISEAI +HPDLV+KYL TVVP  DNFYAALNS
Sbjct: 135 AMDVVMDSVSVATTFQKTLAEKGIIFCAISEAIQKHPDLVRKYLGTVVPKTDNFYAALNS 194

Query: 194 AVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRD 253
           AVFTDGSF Y+PKGVRCPMELSTYFRIN+ GTGQFERTL+I DEG+YVSYLEGCTAP+RD
Sbjct: 195 AVFTDGSFCYVPKGVRCPMELSTYFRINQAGTGQFERTLLIVDEGAYVSYLEGCTAPKRD 254

Query: 254 ENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQL 313
           ENQLHAAVVEL+A++  EIKYSTVQNW+PGD +GKGG+YNFVTKR       +KISWTQ+
Sbjct: 255 ENQLHAAVVELIAMEGGEIKYSTVQNWFPGDKEGKGGVYNFVTKRALA-EKNAKISWTQV 313

Query: 314 ETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISA 373
           ETGSAITWKYPS +L+G+ S GEFYSIA++N FQQ D+GTKM+HL  NT S I+SKGISA
Sbjct: 314 ETGSAITWKYPSVVLKGDNSIGEFYSIAVTNHFQQADTGTKMIHLGNNTKSTIISKGISA 373

Query: 374 GFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSK 433
           G S N+YRG V V   A ++RNF+QCDSLL+GNNCGAHT PYIE+KN +  +EHEATTSK
Sbjct: 374 GRSQNSYRGLVKVVPNAKNARNFSQCDSLLMGNNCGAHTFPYIEAKNPTAQIEHEATTSK 433

Query: 434 ISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           I ++ +FYC QRGI  E AI+LIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 434 IGEDQIFYCNQRGIDTEKAISLIVNGFGKEVLNKLPMEFAVEAQKLLEISLEGSVG 489


>gi|300774698|ref|ZP_07084561.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Chryseobacterium gleum ATCC 35910]
 gi|300506513|gb|EFK37648.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Chryseobacterium gleum ATCC 35910]
          Length = 482

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 329/489 (67%), Positives = 389/489 (79%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E   +V  ++  +Y++G+ET I  +  P GLNEDIIR ISAKK EP+WM EWRL 
Sbjct: 1   MSKYTEDDLRV-DLENKKYEFGWETKIDYEDFPIGLNEDIIRAISAKKEEPEWMTEWRLE 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           +++ W  M +P+WA I+Y   DF  + YYAAPK      SLD+VDPELL+T+EKLGI I 
Sbjct: 60  SFKIWQKMVEPTWANIKYEKPDFQAIRYYAAPKVKPELASLDEVDPELLKTFEKLGINIE 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ L+G     VAVD V DSVSV TTF++ L + G+IF  ISEAI  HPDLV+KYL  V
Sbjct: 120 EQKRLSG-----VAVDIVMDSVSVKTTFQDTLAEKGIIFCSISEAIKNHPDLVRKYLGKV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP GDNFYAALNSAVF+DGSF YIPKGV+CPMELSTYFRIN+ GTGQFERTL+IADEGSY
Sbjct: 175 VPRGDNFYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINQAGTGQFERTLVIADEGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+ALDNAEIKYSTVQNWYPG+ +GKGG++NFVTKRG 
Sbjct: 235 VSYLEGCTAPSRDENQLHAAVVELIALDNAEIKYSTVQNWYPGNEEGKGGVFNFVTKRGL 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ + GEFYSIA++N  Q  D+GTKM+H+ K
Sbjct: 295 C-ERNAKISWTQVETGSAVTWKYPSCILKGDNAIGEFYSIAVTNNHQYADTGTKMIHIGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V V   A  +RNF+QCDSLL+GN CGAHT PYIE K+
Sbjct: 354 NTKSTIISKGISAGKSQNSYRGLVKVMPSAKGARNFSQCDSLLMGNECGAHTFPYIEIKD 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  LEHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFA+EAQKL+
Sbjct: 414 PSAQLEHEATTSKIGEDQIFYCNQRGIDTERAIALIVNGFSKEVLNKLPMEFAIEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|89889827|ref|ZP_01201338.1| FeS assembly permease SufB [Flavobacteria bacterium BBFL7]
 gi|89518100|gb|EAS20756.1| FeS assembly permease SufB [Flavobacteria bacterium BBFL7]
          Length = 482

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 329/489 (67%), Positives = 396/489 (80%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E  +  +++   +Y+YGF T+I+ D  P GL+ED+IR ISAKKNEP WML+WRL 
Sbjct: 1   MSKYTEE-ELEKELQNKEYEYGFYTDIKSDTIPIGLSEDVIRIISAKKNEPQWMLDWRLQ 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR ++ M++P WA + Y   D   + YY+AP S     SLD+VDPELL T++KLGI I 
Sbjct: 60  AYRVFIEMEEPDWANVNYEKPDLQAISYYSAPNSKPKYDSLDEVDPELLETFKKLGISID 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAG     VA+D V DSVSV TTFK+ L + G+IF PISEAI EHP+LVKKYL T+
Sbjct: 120 EQKKLAG-----VAMDIVVDSVSVATTFKKTLAEKGIIFCPISEAIQEHPELVKKYLGTI 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           +P  DN+YAALNSAVF+DGSF YIPKGV+CPMELSTYFRINE GTGQFERTL+IADEGSY
Sbjct: 175 IPQSDNYYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINEGGTGQFERTLVIADEGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAA VEL+ALD+AEIKYSTVQNWYPG+++GKGG++NFVTKRG 
Sbjct: 235 VSYLEGCTAPSRDENQLHAACVELIALDDAEIKYSTVQNWYPGNAEGKGGVFNFVTKRGL 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N FQQ D+GTKM+HL K
Sbjct: 295 C-ENNAKISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSIAVTNNFQQADTGTKMVHLGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++  A ++RNF+QCDSLL+GN CGAHT PYIE+ N
Sbjct: 354 NTKSTIISKGISAGKSQNSYRGLVKINSRATNARNFSQCDSLLMGNECGAHTFPYIENSN 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
           S+  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 414 STSKVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|313206623|ref|YP_004045800.1| iron-regulated ABC transporter membrane component sufb [Riemerella
           anatipestifer DSM 15868]
 gi|312445939|gb|ADQ82294.1| Iron-regulated ABC transporter membrane component SufB [Riemerella
           anatipestifer DSM 15868]
 gi|325335936|gb|ADZ12210.1| ABC-type transport system involved in Fe-S cluster assembly,
           permease component [Riemerella anatipestifer RA-GD]
          Length = 481

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 321/487 (65%), Positives = 383/487 (78%), Gaps = 7/487 (1%)

Query: 4   VRETVDKV-RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           ++ T D +   +   +Y+ GF T+I+ +  P GLNEDIIR ISAKKNEP+WM EWRL ++
Sbjct: 1   MKYTEDDLREDLKNKEYEAGFYTDIEYEDFPTGLNEDIIRQISAKKNEPEWMTEWRLESF 60

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R W  M++P WA ++Y   DF  + YYAAPK      SLD+VDPELL+T+EKLGI + EQ
Sbjct: 61  RIWQKMEEPDWANVKYEKPDFQAIKYYAAPKKKPELASLDEVDPELLKTFEKLGISLDEQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           + L GV    V          V TTF+E LK+ G+IF  ISEAI E+PDLVKKY+  VVP
Sbjct: 121 KRLTGVAVDVVMDSVS-----VKTTFQETLKEKGIIFCSISEAIQEYPDLVKKYIGKVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNFYAALNSAVF+DGSF YIPKGV+CPMELSTYFRIN+ GTGQFERTL++ADEGSYVS
Sbjct: 176 RGDNFYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINQAGTGQFERTLVVADEGSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+A++ AEIKYSTVQNWYPGD  GKGG++NFVTKRG C 
Sbjct: 236 YLEGCTAPSRDENQLHAAVVELIAMEGAEIKYSTVQNWYPGDESGKGGVFNFVTKRGLC- 294

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
              +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N  Q  D+GTKM+H+ KNT
Sbjct: 295 EKNAKISWTQVETGSAVTWKYPSCILKGDNSIGEFYSIAVTNNHQWADTGTKMIHIGKNT 354

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG SNN+YRG V V   A  +RNF+QCDSLL+GN CGAHT PYIE K+ S
Sbjct: 355 KSTIISKGISAGKSNNSYRGLVKVMPSAKGARNFSQCDSLLMGNECGAHTFPYIEIKDPS 414

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             LEHEATTSKI ++ +FYC QRG+  E AIALIVNGF +EVL KLPMEFA+EAQKL++I
Sbjct: 415 AQLEHEATTSKIGEDQIFYCNQRGLDTEKAIALIVNGFSKEVLNKLPMEFAIEAQKLLEI 474

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 475 SLEGSVG 481


>gi|163753696|ref|ZP_02160819.1| iron-regulated ABC transporter, membrane-spanning permease [Kordia
           algicida OT-1]
 gi|161325910|gb|EDP97236.1| iron-regulated ABC transporter, membrane-spanning permease [Kordia
           algicida OT-1]
          Length = 482

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 329/489 (67%), Positives = 394/489 (80%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E   + ++++  +Y+YGF T+I+ D  P GLNEDI+R IS KKNEP+WM EWR+ 
Sbjct: 1   MSKYTEEELQ-KELETKEYEYGFYTDIESDTFPSGLNEDIVRAISKKKNEPEWMTEWRID 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W  M++P WA +RY   DF  + YY+APK     ++LDDVDPELL  Y+KLGI I 
Sbjct: 60  AFRIWSEMEEPEWANVRYDKPDFQAISYYSAPKKADPNKTLDDVDPELLEMYKKLGISID 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ L G     VA+D V DSVSV TTFK+ L + G+IF PISEAI ++P+LV+KYL T+
Sbjct: 120 EQKKLQG-----VAIDIVVDSVSVATTFKKTLAEKGIIFCPISEAIQDYPELVQKYLGTI 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVFTDGSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL+IADEGSY
Sbjct: 175 VPKKDNFYAALNSAVFTDGSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVIADEGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+ALD+AEIKYSTVQNW+PG ++GKGG+YNFVTKRG 
Sbjct: 235 VSYLEGCTAPSRDENQLHAAVVELIALDDAEIKYSTVQNWFPGTAEGKGGVYNFVTKRGL 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    SKISWTQ+ETGSA+TWKYPSC+L+G  S GEFYSIA++N +QQ D+GTKM+HL K
Sbjct: 295 C-ETNSKISWTQVETGSAVTWKYPSCVLKGNNSVGEFYSIAVTNNYQQADTGTKMIHLGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V +   A ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 354 NTKSTIISKGISAGKSQNSYRGLVQIAAKAENARNFSQCDSLLMGNKCGAHTFPYIEAKN 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF ++VL KLPMEFAVEAQKL+
Sbjct: 414 KTAQIEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKDVLNKLPMEFAVEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|167627990|ref|YP_001678490.1| cysteine desulfurase activator complex subunit SufB [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|241668544|ref|ZP_04756122.1| cysteine desulfurase activator complex subunit SufB [Francisella
           philomiragia subsp. philomiragia ATCC 25015]
 gi|254877079|ref|ZP_05249789.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|167597991|gb|ABZ87989.1| SufS activator complex, SufB subunit [Francisella philomiragia
           subsp. philomiragia ATCC 25017]
 gi|254843100|gb|EET21514.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 481

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 335/482 (69%), Positives = 403/482 (83%), Gaps = 4/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF T I+ +    GLNED+IR ISA+K EP+++LEWRL AY++WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTEIEAETIDAGLNEDVIRLISARKKEPEFLLEWRLKAYKKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + YPAIDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQE+LAG
Sbjct: 63  KSPEWADLSYPAIDFQAISYYSSPKSLKDHPKSLDEVDPEIIETYNKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--KNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLI+ADEGSYVSYLEGC
Sbjct: 181 YAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIVADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD +GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGVCH-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   A+++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNASNARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEAQKL+++SLEG+
Sbjct: 420 EATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGA 479

Query: 488 VG 489
           VG
Sbjct: 480 VG 481


>gi|315022117|gb|EFT35146.1| cysteine desulfurase activator complex subunit SufB [Riemerella
           anatipestifer RA-YM]
          Length = 481

 Score =  537 bits (1383), Expect = e-150,   Method: Composition-based stats.
 Identities = 321/487 (65%), Positives = 383/487 (78%), Gaps = 7/487 (1%)

Query: 4   VRETVDKV-RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
           ++ T D +   +   +Y+ GF T+I+ +  P GLNEDIIR ISAKKNEP+WM EWRL ++
Sbjct: 1   MKYTEDDLREDLKNKEYEAGFYTDIEYEDFPTGLNEDIIRQISAKKNEPEWMTEWRLESF 60

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
           R W  M++P WA ++Y   DF  + YYAAPK      SLD+VDPELL+T+EKLGI + EQ
Sbjct: 61  RIWQKMEEPDWANVKYEKPDFQAIKYYAAPKKKPELASLDEVDPELLKTFEKLGISLDEQ 120

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
           + L GV    V          V TTF+E LK+ G+IF  ISEAI E+PDLVKKY+  VVP
Sbjct: 121 KRLTGVAVDVVMDSVS-----VKTTFQETLKEKGIIFCSISEAIQEYPDLVKKYIGKVVP 175

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
            GDNFYAALNSAVF+DGSF YIPKGV+CPMELSTYFRIN+ GTGQFERTL++ADEGSYVS
Sbjct: 176 RGDNFYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINQAGTGQFERTLVVADEGSYVS 235

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAP RDENQLHAAVVEL+A++ AEIKYSTVQNWYPGD  GKGG++NFVTKRG C 
Sbjct: 236 YLEGCTAPSRDENQLHAAVVELIAMEGAEIKYSTVQNWYPGDESGKGGVFNFVTKRGLC- 294

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
              +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N  Q  D+GTKM+H+ KNT
Sbjct: 295 EKDAKISWTQVETGSAVTWKYPSCILKGDNSIGEFYSIAVTNNHQWADTGTKMIHIGKNT 354

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S I+SKGISAG SNN+YRG V V   A  +RNF+QCDSLL+GN CGAHT PYIE K+ S
Sbjct: 355 KSTIISKGISAGKSNNSYRGLVKVMPSAKGARNFSQCDSLLMGNECGAHTFPYIEIKDPS 414

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             LEHEATTSKI ++ +FYC QRG+  E AIALIVNGF +EVL KLPMEFA+EAQKL++I
Sbjct: 415 AQLEHEATTSKIGEDQIFYCNQRGLDTEKAIALIVNGFSKEVLNKLPMEFAIEAQKLLEI 474

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 475 SLEGSVG 481


>gi|332878133|ref|ZP_08445862.1| FeS assembly protein SufB [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332683871|gb|EGJ56739.1| FeS assembly protein SufB [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 489

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 318/476 (66%), Positives = 384/476 (80%), Gaps = 3/476 (0%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP-SWA 74
             +YKYGF T+I+ D  PKGLNE+++  +S KKNEP+WM EWRL A+R W  M +P  WA
Sbjct: 15  NSEYKYGFYTDIESDTFPKGLNEEVVIALSKKKNEPEWMTEWRLEAFRAWQAMAEPPHWA 74

Query: 75  RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSK-V 133
            +++   +F D+ YY+APK      SLD+VDP+LL T+EKLGI + EQ+ LAGV+    V
Sbjct: 75  NVQFETPNFQDIAYYSAPKQKPKLNSLDEVDPQLLETFEKLGISLEEQKRLAGVEDKPAV 134

Query: 134 AVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNS 193
           A+D V DSVSV TTF++ L + G+IF  +SEAI +HPDLV+KYL TVVP  DNFYAALNS
Sbjct: 135 AMDVVMDSVSVATTFQKTLAERGIIFCSMSEAIQKHPDLVRKYLGTVVPKTDNFYAALNS 194

Query: 194 AVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRD 253
           AVF+DGSF Y+PKGVRCPMELSTYFRIN+ GTGQFERTL+I DEG+YVSYLEGCTAP+RD
Sbjct: 195 AVFSDGSFCYVPKGVRCPMELSTYFRINQAGTGQFERTLLIVDEGAYVSYLEGCTAPRRD 254

Query: 254 ENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQL 313
           ENQLHAAVVEL+A++  EIKYSTVQNW+PGD  GKGG+YNFVTKR       +KISWTQ+
Sbjct: 255 ENQLHAAVVELIAMEGGEIKYSTVQNWFPGDKDGKGGVYNFVTKRALA-EKNAKISWTQV 313

Query: 314 ETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISA 373
           ETGSAITWKYPS +L+G+ S GEFYSIA++N FQQ D+GTKM+HL  NT S I+SKGISA
Sbjct: 314 ETGSAITWKYPSVVLKGDNSIGEFYSIAVTNHFQQADTGTKMIHLGNNTKSTIISKGISA 373

Query: 374 GFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSK 433
           G S N+YRG V V   A ++RNF+QCDSLL+GNNCGAHT PYIE+KN +  +EHEATTSK
Sbjct: 374 GKSQNSYRGLVKVVPKAKNARNFSQCDSLLMGNNCGAHTFPYIEAKNPTAQIEHEATTSK 433

Query: 434 ISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           I ++ +FYC QRGI  E AI+LIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 434 IGEDQIFYCNQRGIDTEKAISLIVNGFGKEVLNKLPMEFAVEAQKLLEISLEGSVG 489


>gi|288800578|ref|ZP_06406036.1| FeS assembly protein SufB [Prevotella sp. oral taxon 299 str.
           F0039]
 gi|288332791|gb|EFC71271.1| FeS assembly protein SufB [Prevotella sp. oral taxon 299 str.
           F0039]
          Length = 484

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 307/486 (63%), Positives = 383/486 (78%), Gaps = 6/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
            ++  + VR +   +Y++GF T++  D  PKGLNE+++R IS KKNEP+W+LE+RL A+ 
Sbjct: 5   EQQKNEYVRSVAERKYEFGFTTDVHTDIIPKGLNEEVVRLISHKKNEPEWLLEFRLKAFE 64

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W TMK P+WA I  P ID+  + YYA P     P     +DPEL +T++KLGIP+ E+ 
Sbjct: 65  HWKTMKQPTWAHIDLPEIDYQAISYYADP-MAKKPAGDGKIDPELEKTFDKLGIPLEERL 123

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
           IL+G     VAVDA+ DSVSV TTFKE+L + GVIF  I EA+ EHP+L+K+YL TVVP 
Sbjct: 124 ILSG-----VAVDAIMDSVSVKTTFKEKLAEKGVIFSSIGEAVQEHPELIKEYLGTVVPY 178

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF+AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN + TGQFERTLI+A++ SYVSY
Sbjct: 179 RDNFFAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINARNTGQFERTLIVAEDDSYVSY 238

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE++  DNAE+KYSTVQNWYPGD  GKGG++N VTKRGD RG
Sbjct: 239 LEGCTAPMRDENQLHAAIVEIIIKDNAEVKYSTVQNWYPGDENGKGGVFNLVTKRGDLRG 298

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N +QQ D+GTKM+H+ KNT 
Sbjct: 299 VNSKLSWTQVETGSAITWKYPSCILRGDNSQAEFYSVAVTNNYQQADTGTKMIHMGKNTK 358

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G+ CGAHT PY++  N S 
Sbjct: 359 STIISKGISAGHSQNSYRGLVRATPNADNARNYSSCDSLLLGDKCGAHTFPYMDIHNDSA 418

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ L YC QRGIP E AI LIVNG+ +EVL KLPMEFAVEAQKL+ +S
Sbjct: 419 VIEHEATTSKIGEDQLLYCNQRGIPTEQAIGLIVNGYAKEVLNKLPMEFAVEAQKLLSVS 478

Query: 484 LEGSVG 489
           LEG+VG
Sbjct: 479 LEGTVG 484


>gi|123967622|ref|YP_001008480.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. AS9601]
 gi|123197732|gb|ABM69373.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           AS9601]
          Length = 480

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 297/479 (62%), Positives = 372/479 (77%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +  + YKYGF T+I+ +K  KGLNEDII+ IS KK EP ++L++RL A++RW  MK+
Sbjct: 7   VKDVVKEPYKYGFVTDIETEKIEKGLNEDIIKLISQKKEEPKFLLDFRLKAFKRWQKMKE 66

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA + Y  ID+ D+ YY+APK      SLD+VDP+LL T++KLGIP+ EQ+ L     
Sbjct: 67  PDWAALGYKKIDYQDIIYYSAPKQKEKISSLDEVDPKLLETFDKLGIPLTEQKKL----- 121

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
           + VAVDAVFDSVS+ TTF+EEL + GVIF  ISEA+  H DL++KYL TVVP  DN++AA
Sbjct: 122 TNVAVDAVFDSVSIATTFREELAEHGVIFCSISEAVKNHADLIEKYLGTVVPASDNYFAA 181

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV CPM+LS+YFRIN   +GQFERTLIIA+E S VSYLEGCTAP
Sbjct: 182 LNSAVFSDGSFVYIPKGVTCPMDLSSYFRINSGDSGQFERTLIIAEESSSVSYLEGCTAP 241

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D N LHAAVVEL+ALD+A IKYSTVQNWY GD +G GGI+NFVTKRG C G RSKISW
Sbjct: 242 MFDTNTLHAAVVELIALDDASIKYSTVQNWYAGDEEGIGGIFNFVTKRGKCLGKRSKISW 301

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           +Q+ETGSAITWKYPSCLL GE+S GEFYS+A++N  QQ D+GTKM+H+   T S IVSKG
Sbjct: 302 SQVETGSAITWKYPSCLLLGEESVGEFYSVALTNNLQQADTGTKMIHIGPKTKSTIVSKG 361

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  SRN++QCDS+LIG+   A+T PYI+S+  +  +EHEA+
Sbjct: 362 ISAGNSKNSYRGLVKMGTKATGSRNYSQCDSMLIGDQASANTFPYIKSQQPNSEIEHEAS 421

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 422 TCRISEDQLFYLQSRGIEFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEGSVG 480


>gi|326334703|ref|ZP_08200910.1| FeS assembly protein SufB [Capnocytophaga sp. oral taxon 338 str.
           F0234]
 gi|325693153|gb|EGD35085.1| FeS assembly protein SufB [Capnocytophaga sp. oral taxon 338 str.
           F0234]
          Length = 489

 Score =  536 bits (1382), Expect = e-150,   Method: Composition-based stats.
 Identities = 313/476 (65%), Positives = 379/476 (79%), Gaps = 3/476 (0%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP-SWA 74
             +YKYGF T+I+ D  PKGLNE+++  +S KKNEP WM +WR+ A+R W  M +P  WA
Sbjct: 15  NSEYKYGFYTDIESDTFPKGLNEEVVVALSKKKNEPQWMTDWRVEAFRIWKAMPEPPHWA 74

Query: 75  RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTS-KV 133
            +++   DF D+ YY+APK      SL++VDP+LL T+ KLGI + EQ+ L+GV+    V
Sbjct: 75  NLKFETPDFQDIAYYSAPKQKPKLNSLNEVDPKLLETFNKLGISLEEQKRLSGVEEKPTV 134

Query: 134 AVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNS 193
           A+D V DSVSV TTF+  L + GVIF  ISEAI +HPDLV+KYL TVVP  DNFYAALNS
Sbjct: 135 AMDVVMDSVSVATTFQRTLAEKGVIFCSISEAIQKHPDLVRKYLGTVVPKTDNFYAALNS 194

Query: 194 AVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRD 253
           AVFTDGSF Y+PKGVRCPMELSTYFRIN+ GTGQFERTL+I DEG+YVSYLEGCTAP+RD
Sbjct: 195 AVFTDGSFCYVPKGVRCPMELSTYFRINQAGTGQFERTLLIVDEGAYVSYLEGCTAPKRD 254

Query: 254 ENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQL 313
           ENQLHAAVVEL+A++  EIKYSTVQNW+PGD  G GG+YNFVTKR       +KISWTQ+
Sbjct: 255 ENQLHAAVVELIAMEGGEIKYSTVQNWFPGDKDGSGGVYNFVTKRALA-EKNAKISWTQV 313

Query: 314 ETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISA 373
           ETGSAITWKYPS +L+G+ + GEFYSIA++N FQQ D+GTKM+H+  NT S I+SKGISA
Sbjct: 314 ETGSAITWKYPSVVLKGDNAIGEFYSIAVTNHFQQADTGTKMIHIGNNTKSTIISKGISA 373

Query: 374 GFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSK 433
           G S N+YRG V V   A ++RNF+QCDSLL+GN CGAHT PYIE+KN +  +EHEATTSK
Sbjct: 374 GKSQNSYRGLVKVVPSAKNARNFSQCDSLLMGNKCGAHTFPYIEAKNPTAQIEHEATTSK 433

Query: 434 ISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           I ++ +FYC QRGI  E AI+LIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 434 IGEDQIFYCNQRGIDTEKAISLIVNGFGKEVLNKLPMEFAVEAQKLLEISLEGSVG 489


>gi|315224611|ref|ZP_07866436.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Capnocytophaga ochracea F0287]
 gi|314945396|gb|EFS97420.1| ABC superfamily ATP binding cassette transporter, membrane protein
           [Capnocytophaga ochracea F0287]
          Length = 490

 Score =  536 bits (1380), Expect = e-150,   Method: Composition-based stats.
 Identities = 316/477 (66%), Positives = 383/477 (80%), Gaps = 4/477 (0%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP-SWA 74
             +YKYGF T+I+ +  PKGLNE+++  +S KKNEP WM +WRL A+R W  M++P  WA
Sbjct: 15  NSEYKYGFYTDIESETFPKGLNEEVVIALSKKKNEPQWMTDWRLEAFRAWQAMEEPPHWA 74

Query: 75  RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSK-- 132
            +++   DF D+ YY+APK      SLD+VDP+LL T++KLGI + EQ+ L GV+  K  
Sbjct: 75  NLKFETPDFQDIAYYSAPKQKPKLNSLDEVDPQLLETFQKLGISLEEQKRLVGVEDEKPA 134

Query: 133 VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALN 192
           VA+D V DSVSV TTF++ L + G+IF  ISEAI +HPDLV+KYL TVVP  DNFYAALN
Sbjct: 135 VAMDVVMDSVSVATTFQKTLAERGIIFCSISEAIQKHPDLVRKYLGTVVPKTDNFYAALN 194

Query: 193 SAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQR 252
           SAVF+DGSF Y+PKGVRCPMELSTYFRIN+ GTGQFERTL+I DEG+YVSYLEGCTAP+R
Sbjct: 195 SAVFSDGSFCYVPKGVRCPMELSTYFRINQAGTGQFERTLLIVDEGAYVSYLEGCTAPKR 254

Query: 253 DENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQ 312
           DENQLHAAVVEL+A++  EIKYSTVQNW+PGD  GKGG+YNFVTKR       +KISWTQ
Sbjct: 255 DENQLHAAVVELIAMEGGEIKYSTVQNWFPGDKDGKGGVYNFVTKRALA-EKNAKISWTQ 313

Query: 313 LETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGIS 372
           +ETGSAITWKYPS +L+G+ S GEFYSIA++N FQQ D+GTKM+HL  NT S I+SKGIS
Sbjct: 314 VETGSAITWKYPSVVLKGDNSIGEFYSIAVTNHFQQADTGTKMIHLGNNTKSTIISKGIS 373

Query: 373 AGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTS 432
           AG S N+YRG V V   A ++RNF+QCDSLL+GN CGAHT PYIE+KN +  +EHEATTS
Sbjct: 374 AGKSQNSYRGLVKVVPNAKNARNFSQCDSLLMGNLCGAHTFPYIEAKNPTAQIEHEATTS 433

Query: 433 KISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           KI ++ +FYC QRGI  E AI+LIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 434 KIGEDQIFYCNQRGIDTEKAISLIVNGFGKEVLNKLPMEFAVEAQKLLEISLEGSVG 490


>gi|157412424|ref|YP_001483290.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. MIT 9215]
 gi|254526853|ref|ZP_05138905.1| FeS assembly protein SufB [Prochlorococcus marinus str. MIT 9202]
 gi|157386999|gb|ABV49704.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           MIT 9215]
 gi|221538277|gb|EEE40730.1| FeS assembly protein SufB [Prochlorococcus marinus str. MIT 9202]
          Length = 480

 Score =  535 bits (1379), Expect = e-150,   Method: Composition-based stats.
 Identities = 295/479 (61%), Positives = 371/479 (77%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +  + YKYGF T+I+ +K  KGLNEDIIR IS KK EP ++L++RL A+++W  M +
Sbjct: 7   VKDVVKEPYKYGFVTDIETEKIAKGLNEDIIRLISQKKEEPKYLLDFRLKAFKKWQKMDE 66

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA + Y  ID+ D+ YY+APK      SLD+VDP+LL T++KLGIP+ EQ+ L     
Sbjct: 67  PDWAGLGYKQIDYQDIIYYSAPKQKEKISSLDEVDPKLLETFDKLGIPLTEQKKL----- 121

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
           + VAVDAVFDSVS+ TTF+EEL + GVIF  ISEA+  H DL+++YL TVVP  DN++AA
Sbjct: 122 TNVAVDAVFDSVSIATTFREELAEHGVIFCSISEAVKNHSDLIEQYLGTVVPASDNYFAA 181

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV CPM+LS+YFRIN   +GQFERTLIIA+E S VSYLEGCTAP
Sbjct: 182 LNSAVFSDGSFVYIPKGVTCPMDLSSYFRINSGDSGQFERTLIIAEESSSVSYLEGCTAP 241

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D N LHAAVVEL+ALD+A IKYSTVQNWY GD +G GGI+NFVTKRG C G RSKISW
Sbjct: 242 MFDTNTLHAAVVELIALDDASIKYSTVQNWYAGDEEGIGGIFNFVTKRGKCLGKRSKISW 301

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           +Q+ETGSAITWKYPSCLL GE+S GEFYS+A++N  QQ D+GTKM+H+   T S IVSKG
Sbjct: 302 SQVETGSAITWKYPSCLLLGEESVGEFYSVALTNNLQQADTGTKMIHIGPKTKSTIVSKG 361

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  SRN++QCDS+LIG+   A+T PYI+S+  +  +EHEA+
Sbjct: 362 ISAGNSINSYRGLVKMGTKATGSRNYSQCDSMLIGDQASANTFPYIKSQQPNSEIEHEAS 421

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           T +IS++ LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 422 TCRISEDQLFYLQSRGIEFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEGSVG 480


>gi|194477107|ref|YP_002049286.1| FeS assembly protein SufB [Paulinella chromatophora]
 gi|171192114|gb|ACB43076.1| FeS assembly protein SufB [Paulinella chromatophora]
          Length = 480

 Score =  535 bits (1379), Expect = e-150,   Method: Composition-based stats.
 Identities = 305/484 (63%), Positives = 378/484 (78%), Gaps = 5/484 (1%)

Query: 6   ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRW 65
            T   V  +    Y+YGF T+I+ +K  KGL+ED++R IS+KK EPD++L++RL AYR W
Sbjct: 2   STSTNVADLVSQPYRYGFVTDIETEKIAKGLSEDVVRLISSKKEEPDFLLQFRLRAYRNW 61

Query: 66  LTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           L MK+P WA + YP ID+ +L YYAAPK+     SLD++DP+LL T+ KLGIP+ EQ+ L
Sbjct: 62  LQMKEPHWATLGYPPIDYQELIYYAAPKNQGKKASLDEIDPKLLETFNKLGIPLSEQKRL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           +      VAVDAVFDSVS+ TT+KE+L K GVIF  ISEA+ EHP+LV++YL T+VP  D
Sbjct: 122 S-----NVAVDAVFDSVSIATTYKEKLSKHGVIFYSISEAVKEHPELVERYLGTIVPSND 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           N++AALNSAVF+DGSFV+IPKGV CPMELSTYFRIN   TGQFERTLIIA+EGS VSYLE
Sbjct: 177 NYFAALNSAVFSDGSFVFIPKGVECPMELSTYFRINSGDTGQFERTLIIAEEGSSVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAP  D NQLHAAVVELVALD+A IKYSTVQNWY GD  GKGGIYNFVTKRG CRG R
Sbjct: 237 GCTAPMFDTNQLHAAVVELVALDDATIKYSTVQNWYAGDENGKGGIYNFVTKRGHCRGER 296

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           S+ISWTQ+ETGSAITWKYPSC+L+G+ S GEFYS+A++N  QQ D+GTKM+H+   T S 
Sbjct: 297 SRISWTQVETGSAITWKYPSCVLQGKDSVGEFYSVALTNNRQQADTGTKMIHIGCGTRSV 356

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           IVSKGISAG S+N+YRG V V   A  ++N++QCDSLLIG+   A+T PYI S+    ++
Sbjct: 357 IVSKGISAGQSSNSYRGLVQVLPKAIGAKNYSQCDSLLIGDQAAANTYPYIRSQQPQASI 416

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEA+T +IS + LFY   RG+  E A++++VNGF R+V  +LPMEFA EA KL+ + LE
Sbjct: 417 EHEASTCRISADQLFYLQSRGVGFEEAVSMMVNGFCRDVFNQLPMEFAAEADKLLALKLE 476

Query: 486 GSVG 489
           GSVG
Sbjct: 477 GSVG 480


>gi|126695422|ref|YP_001090308.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. MIT 9301]
 gi|126542465|gb|ABO16707.1| ABC transporter, membrane component [Prochlorococcus marinus str.
           MIT 9301]
          Length = 500

 Score =  535 bits (1379), Expect = e-150,   Method: Composition-based stats.
 Identities = 297/479 (62%), Positives = 372/479 (77%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +  + YKYGF T+I+ +K  KGLNEDII+ IS KK EP ++L++RL A+++W  MK+
Sbjct: 27  VKDVVNETYKYGFVTDIETEKIEKGLNEDIIKLISQKKEEPRFLLDFRLKAFKKWQKMKE 86

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P WA + Y  ID+ D+ YY+APK      SLD+VDP+LL T++KLGIP+ EQ+ L     
Sbjct: 87  PDWAALGYEKIDYQDIIYYSAPKQKEKISSLDEVDPKLLETFDKLGIPLTEQKKL----- 141

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
           + VAVDAVFDSVS+ TTF+EEL + GVIF  ISEA+  H DL++KYL TVVP  DN++AA
Sbjct: 142 TNVAVDAVFDSVSIATTFREELAEHGVIFCSISEAVKNHADLIEKYLGTVVPASDNYFAA 201

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV CPM+LS+YFRIN   +GQFERTLIIA+E S VSYLEGCTAP
Sbjct: 202 LNSAVFSDGSFVYIPKGVTCPMDLSSYFRINSGDSGQFERTLIIAEESSSVSYLEGCTAP 261

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D N LHAAVVEL+ALD+A IKYSTVQNWY GD +G GGI+NFVTKRG C G RSKISW
Sbjct: 262 MFDTNTLHAAVVELIALDDASIKYSTVQNWYAGDEEGIGGIFNFVTKRGKCLGKRSKISW 321

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           +Q+ETGSAITWKYPSCLL GE+S GEFYS+A++N  QQ D+GTKM+H+   T S IVSKG
Sbjct: 322 SQVETGSAITWKYPSCLLLGEESVGEFYSVALTNNLQQADTGTKMIHIGPKTKSTIVSKG 381

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  SRN++QCDS+LIG+   A+T PYI+S+  +  +EHEA+
Sbjct: 382 ISAGNSKNSYRGLVKMGTKATGSRNYSQCDSMLIGDQASANTFPYIKSQQPNSEIEHEAS 441

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           T +IS+E LFY   RGI  E A++++V+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 442 TCRISEEQLFYLQSRGIEFEEAVSMMVSGFCRDVFNQLPMEFAAEADKLLALKLEGSVG 500


>gi|225010412|ref|ZP_03700884.1| FeS assembly protein SufB [Flavobacteria bacterium MS024-3C]
 gi|225005891|gb|EEG43841.1| FeS assembly protein SufB [Flavobacteria bacterium MS024-3C]
          Length = 481

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 326/471 (69%), Positives = 385/471 (81%), Gaps = 6/471 (1%)

Query: 19  YKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRY 78
           Y+YGF T+I+ D  P GL+E+I+  IS KK EP+WM +WRL AYR WL M++P WA + Y
Sbjct: 17  YEYGFYTDIESDTFPIGLSEEIVVAISKKKEEPEWMTQWRLDAYRSWLEMEEPEWANVHY 76

Query: 79  PAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAV 138
              DF  + YY+AP       S+D+VDPELL T+++LGI + EQ++LAG     VAVD V
Sbjct: 77  TKPDFQAISYYSAPNKKPKYDSIDEVDPELLDTFKRLGISLDEQKMLAG-----VAVDIV 131

Query: 139 FDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTD 198
            DSVSV TTFK+ L + G+IF  ISEAI EHP+LVKKY+ +VVP  DN+YAALNSAVF+D
Sbjct: 132 MDSVSVATTFKKTLGEKGIIFCSISEAIREHPELVKKYIGSVVPQKDNYYAALNSAVFSD 191

Query: 199 GSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLH 258
           GSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL+IADEGSYVSYLEGCTAP RDENQLH
Sbjct: 192 GSFCYIPKGVRCPMELSTYFRINQAGTGQFERTLVIADEGSYVSYLEGCTAPSRDENQLH 251

Query: 259 AAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSA 318
           AAVVELVALD+AEIKYSTVQNW+PGD QGKGG+YNFVTKRG C    +KISWTQ+ETGSA
Sbjct: 252 AAVVELVALDHAEIKYSTVQNWFPGDKQGKGGVYNFVTKRGIC-ENHAKISWTQVETGSA 310

Query: 319 ITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNN 378
           +TWKYPSC+L+G+ S GEFYSIA++N FQQ D+GTKM+HL KNT S I+SKGISAG S N
Sbjct: 311 VTWKYPSCVLKGDHSIGEFYSIAVTNNFQQADTGTKMIHLGKNTRSTIISKGISAGKSQN 370

Query: 379 TYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEH 438
           +YRG V V   A ++RNF+QCDSLL+G+ CGAHT PYIE KN +  +EHEATTSKI ++ 
Sbjct: 371 SYRGLVQVGARAENARNFSQCDSLLMGDQCGAHTFPYIEVKNKTAQIEHEATTSKIGEDQ 430

Query: 439 LFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +FYC QRGIP E AIALIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 431 IFYCNQRGIPTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLLEISLEGSVG 481


>gi|317504202|ref|ZP_07962196.1| FeS assembly protein SufB [Prevotella salivae DSM 15606]
 gi|315664691|gb|EFV04364.1| FeS assembly protein SufB [Prevotella salivae DSM 15606]
          Length = 507

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 299/488 (61%), Positives = 383/488 (78%), Gaps = 7/488 (1%)

Query: 2   VAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA 61
           +A +E    V+++   +Y++GF T++Q D   KGLNED++R IS KK EP+W+L++RL A
Sbjct: 27  MAEKEKNKFVKQVAEKKYEFGFTTDVQTDIIEKGLNEDVVRLISKKKGEPEWLLDFRLKA 86

Query: 62  YRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIRE 121
           Y  W  +K P+W  +  P ID+  + YYA P +        ++DPEL +T++KLGIP+ E
Sbjct: 87  YEYWKDLKQPTWGHVHLPEIDYQAISYYADPLAKKPKN--KEIDPELEKTFDKLGIPLEE 144

Query: 122 QEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVV 181
           +  L+G      AVDA+ DSVSV TTFKE+L++ G+IF  I EA+ EH DLVK+YL +VV
Sbjct: 145 RLALSGT-----AVDAIMDSVSVKTTFKEKLREKGIIFCSIGEAVKEHADLVKEYLGSVV 199

Query: 182 PVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYV 241
           P  DN++AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN + TGQFERTLI+A++ +YV
Sbjct: 200 PYRDNYFAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINARNTGQFERTLIVAEDNAYV 259

Query: 242 SYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDC 301
           SYLEGCTAP RDENQLHAA+VE++  DNAE+KYSTVQNWYPGD  GKGG+ N VTKRGD 
Sbjct: 260 SYLEGCTAPMRDENQLHAAIVEIIVKDNAEVKYSTVQNWYPGDEHGKGGVLNLVTKRGDL 319

Query: 302 RGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKN 361
           RG+ SK+SWTQ+ETGSAITWKYPSC+LRG+ +  EFYS+A++N FQ+ D+GTKM+H+ KN
Sbjct: 320 RGVNSKLSWTQVETGSAITWKYPSCILRGDNAVAEFYSVAVTNNFQEADTGTKMIHMGKN 379

Query: 362 TTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNS 421
           T S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G+NCGAHT PY++  N 
Sbjct: 380 TKSTIISKGISAGHSQNSYRGLVRATANADNARNYSSCDSLLLGSNCGAHTFPYMDIHND 439

Query: 422 SCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLID 481
           +  +EHEATTSKIS+E LFYC QRGIP E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ 
Sbjct: 440 TAVIEHEATTSKISEEQLFYCNQRGIPTEQAVGLIVNGYAKEVLNKLPMEFAVEAQKLLS 499

Query: 482 ISLEGSVG 489
           +SLEG+VG
Sbjct: 500 VSLEGTVG 507


>gi|332992278|gb|AEF02333.1| cysteine desulfurase activator complex subunit SufB [Alteromonas
           sp. SN2]
          Length = 478

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 330/482 (68%), Positives = 396/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           +++ +    +Y  GF + I+ +    GL+E +IR ISA KNEP+WMLEWRL AY  WL M
Sbjct: 3   EQIEQALERKYDAGFYSEIESETFESGLDESVIRRISAMKNEPEWMLEWRLKAYHSWLVM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA + YP +D+  + YY+APKS    PQSLD+VDPELLRTYEKLGIP+ EQE+LAG
Sbjct: 63  EEPDWAHVDYPKVDYQAISYYSAPKSMKDKPQSLDEVDPELLRTYEKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAVFDSVSVVTTF+ +L+++GVIF PISEA+ ++PDLVKKY+ +VVP  DN+
Sbjct: 123 -----VAVDAVFDSVSVVTTFRSKLEEAGVIFCPISEALVKYPDLVKKYIGSVVPRTDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVFTDGSFVYIPKG RCPMELSTYFRINE  TGQFERTLI+A+EGSYVSYLEGC
Sbjct: 178 FAALNSAVFTDGSFVYIPKGTRCPMELSTYFRINEMNTGQFERTLIVAEEGSYVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVA+D+A IKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVAMDDATIKYSTVQNWYPGDENGKGGIYNFVTKRGICH-KNAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYS+A++ G QQ D+GTKM+HL KNT S I+
Sbjct: 297 ISWTQVETGSAVTWKYPSCVLKGDNSVGEFYSVALTRGRQQADTGTKMIHLGKNTRSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG SNN YRG V +   A  +RNFT+CDSLLIG+ CGAHT PYIES+N S  +EH
Sbjct: 357 SKGISAGNSNNAYRGLVQMGPRADGARNFTECDSLLIGDKCGAHTFPYIESRNPSAIVEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+SDE LF C QRG+  E ++++IVNGF +EV ++LPMEFAVEA KL++ISLEGS
Sbjct: 417 EATTSKVSDEQLFLCQQRGLDTEKSVSMIVNGFCKEVFKELPMEFAVEAGKLLEISLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|297620329|ref|YP_003708466.1| FeS assembly protein SufB [Waddlia chondrophila WSU 86-1044]
 gi|297375630|gb|ADI37460.1| FeS assembly protein SufB [Waddlia chondrophila WSU 86-1044]
          Length = 483

 Score =  535 bits (1378), Expect = e-150,   Method: Composition-based stats.
 Identities = 304/476 (63%), Positives = 389/476 (81%), Gaps = 6/476 (1%)

Query: 15  DVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWA 74
           + ++YKYGF TN++ ++ P GLNE+IIR IS K+ EP+++L +R+ A+++WLTM +P+W 
Sbjct: 13  ENNEYKYGFVTNVETERLPPGLNEEIIREISRKRGEPEFLLNFRVKAFQKWLTMAEPTWP 72

Query: 75  RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVA 134
            + YP ID+  + YY+APK+     SLD+VDPE+LRT+EKLGIP+ EQ+ LA      VA
Sbjct: 73  NVAYPPIDYQAISYYSAPKTKSSLSSLDEVDPEILRTFEKLGIPLDEQKRLA-----NVA 127

Query: 135 VDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSA 194
           VD VFDSVS+ TTFK++L+++GV+   ISEAI E+P+LV+KYL +VVPVGDNF+AALNSA
Sbjct: 128 VDMVFDSVSIGTTFKKKLEEAGVVLCSISEAIHEYPELVEKYLGSVVPVGDNFFAALNSA 187

Query: 195 VFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDE 254
           VF+DGSFVY+PKGV+CPMELSTYFRIN+K +GQFERTLIIA+E S VSYLEGCTAP  D 
Sbjct: 188 VFSDGSFVYVPKGVKCPMELSTYFRINDKESGQFERTLIIAEERSSVSYLEGCTAPAYDT 247

Query: 255 NQLHAAVVELVALDNAEIKYSTVQNWYPGD-SQGKGGIYNFVTKRGDCRGMRSKISWTQL 313
           NQLHAAVVELVALD+AEIKYSTVQNWY GD   G GG+YNFVTKRG C G RSKISWTQ+
Sbjct: 248 NQLHAAVVELVALDDAEIKYSTVQNWYAGDPKTGSGGVYNFVTKRGRCAGKRSKISWTQV 307

Query: 314 ETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISA 373
           E G+AITWKYPSCLL+G+ S GEFYS+A++NG  Q D+GTKM+H+ KNT S I+SKGISA
Sbjct: 308 EVGAAITWKYPSCLLQGDDSVGEFYSVALTNGKMQADTGTKMIHMGKNTRSTIISKGISA 367

Query: 374 GFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSK 433
             S+NTYRG V +   AA +RN+TQCDS+L+G+ C A+T PYI+  NSS  +EHEA+TSK
Sbjct: 368 DQSHNTYRGLVKMTPKAAGARNYTQCDSMLVGDQCSANTFPYIDVGNSSSEVEHEASTSK 427

Query: 434 ISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +++E +FY L RGI +E AI +IVNGF +EV+Q+LP+EFA EA++L+ + LE SVG
Sbjct: 428 MNEEQIFYFLSRGISQEDAINMIVNGFCKEVIQELPLEFATEAKQLLALKLENSVG 483


>gi|192359328|ref|YP_001981954.1| cysteine desulfurase activator complex subunit SufB [Cellvibrio
           japonicus Ueda107]
 gi|190685493|gb|ACE83171.1| FeS assembly protein SufB [Cellvibrio japonicus Ueda107]
          Length = 478

 Score =  535 bits (1377), Expect = e-150,   Method: Composition-based stats.
 Identities = 330/482 (68%), Positives = 400/482 (82%), Gaps = 7/482 (1%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           ++V ++   +Y  GF T I  +    GLNE++IRFISAKKNEP W+L+WRL A+  W  M
Sbjct: 3   EEVERLIKKEYAAGFTTQIDSETLSPGLNEEVIRFISAKKNEPQWLLDWRLKAFNAWREM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKSIVG-PQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           ++P WA ++Y  IDF  L YY+APKS+   P+SLD+VDP+LL TYEKLGIP+ EQ  LAG
Sbjct: 63  EEPEWAHVKYDDIDFQALSYYSAPKSMANRPKSLDEVDPKLLETYEKLGIPLHEQAALAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VA+D VFDSVSVVTTF+E+L ++GVIF  ISEA+ ++P+LVK+YL +VVP  DN+
Sbjct: 123 -----VAMDVVFDSVSVVTTFREKLAEAGVIFCSISEAVEKYPELVKQYLGSVVPQKDNY 177

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           YAALNSAVF+DGSFVYIPKGVRCPMELSTYFRINE+ TGQFERTLI+ADEGSYVSYLEGC
Sbjct: 178 YAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINEQNTGQFERTLIVADEGSYVSYLEGC 237

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGD QGKGGIYNFVTKRG C    +K
Sbjct: 238 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDEQGKGGIYNFVTKRGVCF-THAK 296

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGS++TWKYPSC+LRG+ S GEFYS+A++N +QQ D+GTKM+H+ KNT S I+
Sbjct: 297 ISWTQVETGSSVTWKYPSCILRGDNSVGEFYSVALTNNYQQADTGTKMIHIGKNTRSTII 356

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S+N YRG V ++ GA  +RN+TQCDSLLIG+ CGAHT PYIESKN +  +EH
Sbjct: 357 SKGISAGRSSNAYRGLVRMNPGAEGARNYTQCDSLLIGDKCGAHTFPYIESKNPTAVIEH 416

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSK+S++ LF C QRG+  E A+++IVNGF REV ++LPMEFAVEA KL+++SLEGS
Sbjct: 417 EATTSKVSEDQLFLCQQRGLDAEKAVSMIVNGFCREVFKELPMEFAVEAGKLLEVSLEGS 476

Query: 488 VG 489
           VG
Sbjct: 477 VG 478


>gi|160872331|ref|ZP_02062463.1| FeS assembly protein SufB [Rickettsiella grylli]
 gi|159121130|gb|EDP46468.1| FeS assembly protein SufB [Rickettsiella grylli]
          Length = 480

 Score =  535 bits (1377), Expect = e-150,   Method: Composition-based stats.
 Identities = 321/484 (66%), Positives = 388/484 (80%), Gaps = 6/484 (1%)

Query: 7   TVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWL 66
           T   +  +    Y +GF ++I  D    GLNED+IR ISAKKNEP+++L WRL AYR WL
Sbjct: 2   TQATLETLLQQDYPHGFVSDIPADTLACGLNEDVIRHISAKKNEPEFLLAWRLKAYRHWL 61

Query: 67  TMKDPSWA-RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEIL 125
           ++ +P WA  + YPAID+  + YY+APK     +SLD+VDPELLR Y KLGI ++EQE L
Sbjct: 62  SLTEPHWADYMDYPAIDYQAISYYSAPKLKKQLKSLDEVDPELLRIYTKLGISLKEQERL 121

Query: 126 AGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGD 185
           AG     VAVDAVFDS+SV TTFKE+LK  G++F   SEA+ E+P+L+K+YL TVVP  D
Sbjct: 122 AG-----VAVDAVFDSISVATTFKEKLKAMGILFCSFSEAVQEYPELIKRYLGTVVPYAD 176

Query: 186 NFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLE 245
           NFYA LN+AVFTDGSF YIPKG+RCPMELSTYFR+N   TGQFERTLIIADEGSYVSYLE
Sbjct: 177 NFYACLNAAVFTDGSFCYIPKGIRCPMELSTYFRMNAANTGQFERTLIIADEGSYVSYLE 236

Query: 246 GCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMR 305
           GCTAPQRDENQLHAAVVEL+ALD+AEIKYSTVQNWYPGD +GKGGIYNFVTKRG CRG +
Sbjct: 237 GCTAPQRDENQLHAAVVELIALDHAEIKYSTVQNWYPGDKEGKGGIYNFVTKRGHCRGKQ 296

Query: 306 SKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSR 365
           SKISWTQ+ETGSAITWKYPS +L+G+ S GEFYS+A+++  QQ D+GTKM+H+ K+T S 
Sbjct: 297 SKISWTQVETGSAITWKYPSVILQGDASVGEFYSVALTHHKQQADTGTKMIHIGKHTKST 356

Query: 366 IVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNL 425
           I+SKGISAG   N+YRG V +   A H+RN+TQCDSLLIG +C AHT P IE KN +  +
Sbjct: 357 ILSKGISAGHGQNSYRGLVKIAETADHARNYTQCDSLLIGQHCKAHTFPSIEVKNQTAQI 416

Query: 426 EHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLE 485
           EHEA+ SKIS++ LFYCLQRGI  E A++LIVNGF + V ++LPMEFAVEAQKL+ +SLE
Sbjct: 417 EHEASASKISEDQLFYCLQRGITREDALSLIVNGFCKAVFKELPMEFAVEAQKLLSLSLE 476

Query: 486 GSVG 489
           GS+G
Sbjct: 477 GSIG 480


>gi|261881037|ref|ZP_06007464.1| FeS assembly protein SufB [Prevotella bergensis DSM 17361]
 gi|270332219|gb|EFA43005.1| FeS assembly protein SufB [Prevotella bergensis DSM 17361]
          Length = 485

 Score =  535 bits (1377), Expect = e-150,   Method: Composition-based stats.
 Identities = 302/486 (62%), Positives = 386/486 (79%), Gaps = 7/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
            +E    V+++   +Y++GF T+I+ +  P GL+ED++R IS KK EPDW+L++RL A+R
Sbjct: 7   EQEKNKFVKQVAEQKYEFGFTTDIETEIIPVGLDEDVVRLISRKKQEPDWLLDFRLEAFR 66

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            W T++ P+W  +  P IDF  + YYA P +        ++DPEL +T++KLGIP+ E+ 
Sbjct: 67  YWKTLEVPTWGHLHLPEIDFQGISYYADPLAKKPAN--KEIDPELEKTFDKLGIPLEERL 124

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            L+G      AVDAV DSVSV TTFK++L + GVIF  ISEA+ E+PDLV++YL +VVP+
Sbjct: 125 ALSGT-----AVDAVMDSVSVKTTFKKQLAEKGVIFCSISEAVREYPDLVRQYLGSVVPI 179

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DNF +ALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN + TGQFERTLI+AD+ SYVSY
Sbjct: 180 RDNFTSALNSAVFSDGSFVYIPKGVRCPMELSSYFRINARNTGQFERTLIVADDDSYVSY 239

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP RDENQLHAA+VE+V ++NAE+KYSTVQNWYPGD  GKGG+ N VTKRGDCRG
Sbjct: 240 LEGCTAPMRDENQLHAAIVEIVVMNNAEVKYSTVQNWYPGDKDGKGGVLNLVTKRGDCRG 299

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
           + SK+SWTQ+ETGSAITWKYPSC+LRG+ S GEFYS+A++N  Q+ D+GTKM+H+ KNT 
Sbjct: 300 VNSKLSWTQVETGSAITWKYPSCILRGDNSQGEFYSVAVTNNHQEADTGTKMIHMGKNTK 359

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           S I+SKGISAG S N+YRG V V   A ++RN++ CDSLL+G++CGAHT PY++  N + 
Sbjct: 360 STIISKGISAGNSQNSYRGLVRVTANAENARNYSSCDSLLLGSHCGAHTFPYLDIHNETA 419

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKIS++ LFYC QRGI  E A+ LIVNG+ +EVL KLPMEFAVEAQKL+ +S
Sbjct: 420 IVEHEATTSKISEDQLFYCNQRGIGMEDAVGLIVNGYAKEVLNKLPMEFAVEAQKLLSVS 479

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 480 LEGSVG 485


>gi|256819177|ref|YP_003140456.1| cysteine desulfurase activator complex subunit SufB [Capnocytophaga
           ochracea DSM 7271]
 gi|256580760|gb|ACU91895.1| FeS assembly protein SufB [Capnocytophaga ochracea DSM 7271]
          Length = 490

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 315/477 (66%), Positives = 382/477 (80%), Gaps = 4/477 (0%)

Query: 16  VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP-SWA 74
             +YKYGF T+I+ +  PKGLNE+++  +S KKNEP WM +WRL A+R W  M++P  WA
Sbjct: 15  NSEYKYGFYTDIESETFPKGLNEEVVIALSKKKNEPQWMTDWRLEAFRAWQAMEEPPHWA 74

Query: 75  RIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSK-- 132
            +++   DF D+ YY+APK      SLD+VDP+LL T++KLGI + EQ+ LAGV+  K  
Sbjct: 75  NLKFETPDFQDIAYYSAPKQKPKLNSLDEVDPQLLETFQKLGISLEEQKRLAGVEDEKPA 134

Query: 133 VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALN 192
           VA+D V DSVSV TTF++ L + G+IF  ISEAI +HPDLV+KYL  VVP  DNFYAALN
Sbjct: 135 VAMDVVMDSVSVATTFQKTLAERGIIFCSISEAIQKHPDLVRKYLGIVVPKTDNFYAALN 194

Query: 193 SAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQR 252
           SAVF+DGSF Y+PKGVRCPMELSTYFRIN+ GTGQFERTL+I DEG+YVSYLEGCTAP+R
Sbjct: 195 SAVFSDGSFCYVPKGVRCPMELSTYFRINQAGTGQFERTLLIVDEGAYVSYLEGCTAPKR 254

Query: 253 DENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQ 312
           DENQLHA VVEL+A++  EIKYSTVQNW+PGD  GKGG+YNFVTKR       +KISWTQ
Sbjct: 255 DENQLHATVVELIAMEGGEIKYSTVQNWFPGDKDGKGGVYNFVTKRALA-EKNAKISWTQ 313

Query: 313 LETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGIS 372
           +ETGSAITWKYPS +L+G+ S GEFYSIA++N FQQ D+GTKM+HL  NT S I+SKGIS
Sbjct: 314 VETGSAITWKYPSVVLKGDNSIGEFYSIAVTNHFQQADTGTKMIHLGNNTKSTIISKGIS 373

Query: 373 AGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTS 432
           AG S N+YRG V V   A ++RNF+QCDSLL+GN CGAHT PYIE+KN +  +EHEATTS
Sbjct: 374 AGKSQNSYRGLVKVVPNAKNARNFSQCDSLLMGNLCGAHTFPYIEAKNPTAQIEHEATTS 433

Query: 433 KISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           KI ++ +FYC QRGI  E AI+LIVNGF +EVL KLPMEFAVEAQKL++ISLEGSVG
Sbjct: 434 KIGEDQIFYCNQRGIDTEKAISLIVNGFGKEVLNKLPMEFAVEAQKLLEISLEGSVG 490


>gi|86132485|ref|ZP_01051079.1| FeS assembly protein SufB [Dokdonia donghaensis MED134]
 gi|85817046|gb|EAQ38230.1| FeS assembly protein SufB [Dokdonia donghaensis MED134]
          Length = 481

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 326/489 (66%), Positives = 396/489 (80%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    +  D   ++   +Y+YGF T+I+ +  P GLNEDIIR IS KK EP WM +WRL 
Sbjct: 1   MAYTED--DLREELKTKEYEYGFFTDIETETFPVGLNEDIIRAISKKKEEPQWMTDWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+ W +M++P WA + Y   DF  + YY+APKS+   ++LDDVDP+LL  Y+KLGI I 
Sbjct: 59  AYKVWQSMEEPDWANVNYEKPDFQSIAYYSAPKSVDPNKTLDDVDPDLLAMYKKLGISID 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ +     + VA+D V DSVSV TTFK+ L + G+IFM ISEAI EHP+LV+K+L T+
Sbjct: 119 EQKRM-----NNVAMDIVVDSVSVATTFKKTLAEKGIIFMSISEAIKEHPELVRKHLGTI 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DN+YAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN+ GTGQFERTL++ADEGSY
Sbjct: 174 VPVKDNYYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQGGTGQFERTLLVADEGSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+ALD+AEIKYSTVQNWYPG+++GKGG+YNFVTKRG 
Sbjct: 234 VSYLEGCTAPSRDENQLHAAVVELIALDDAEIKYSTVQNWYPGNAEGKGGVYNFVTKRGL 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N  QQ D+GTKM+HL K
Sbjct: 294 C-EKNAKISWTQVETGSAVTWKYPSCILKGDNSIGEFYSIAVTNNHQQADTGTKMIHLGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++ GA ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 353 NTKSTIISKGISAGKSQNSYRGLVKINSGATNARNFSQCDSLLMGNECGAHTFPYIETKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 413 KTAQVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|260910871|ref|ZP_05917515.1| FeS assembly protein SufB [Prevotella sp. oral taxon 472 str.
           F0295]
 gi|260635022|gb|EEX53068.1| FeS assembly protein SufB [Prevotella sp. oral taxon 472 str.
           F0295]
          Length = 483

 Score =  534 bits (1376), Expect = e-149,   Method: Composition-based stats.
 Identities = 300/490 (61%), Positives = 385/490 (78%), Gaps = 8/490 (1%)

Query: 1   MVAVRETVDK-VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRL 59
           M  V+   +  VR +   +Y++GF T+++ D   KGLNED++R IS+KKNEP+W+L +RL
Sbjct: 1   MEEVKNEKNAYVRSVAEQKYEFGFTTDVETDIIEKGLNEDVVRLISSKKNEPEWLLAFRL 60

Query: 60  LAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPI 119
            A+  W T++ P+WA +  P ID+  + YYA P +        ++DPEL +T++KLGIP+
Sbjct: 61  KAFNHWKTLEQPNWAHVNLPEIDYQGISYYADPMAKKPAN--KELDPELEKTFDKLGIPL 118

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            E+ +L G     VAVDA+ DSVSV TTFKE+L + GVIF  I EA+ EHP+LV++YL +
Sbjct: 119 EERLVLGG-----VAVDAIMDSVSVKTTFKEKLAEKGVIFSSIGEAVQEHPELVRQYLGS 173

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN++AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN + TGQFERTLI+A++ +
Sbjct: 174 VVPYSDNYFAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINARNTGQFERTLIVAEDDT 233

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA+VE++  DNAE+KYSTVQNWYPGD  GKGG++N VTKRG
Sbjct: 234 YVSYLEGCTAPMRDENQLHAAIVEIIVKDNAEVKYSTVQNWYPGDEHGKGGVFNLVTKRG 293

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           D RG+ SK+SWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N +QQ D+GTKM+H+ 
Sbjct: 294 DLRGVNSKLSWTQVETGSAITWKYPSCILRGDNSQAEFYSVAVTNNYQQADTGTKMIHMG 353

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G+ CGAHT PY++  
Sbjct: 354 KNTKSTIISKGISAGRSQNSYRGLVRATANADNARNYSSCDSLLLGDKCGAHTFPYMDIH 413

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +  +EHEATTSKIS+  LFYC QRGIP E A+ LIVNG+ +EVL KLPMEFAVEAQKL
Sbjct: 414 NDTAIIEHEATTSKISEAQLFYCNQRGIPTEQAVGLIVNGYAKEVLNKLPMEFAVEAQKL 473

Query: 480 IDISLEGSVG 489
           + +SLEG+VG
Sbjct: 474 LSVSLEGTVG 483


>gi|302344945|ref|YP_003813298.1| FeS assembly protein SufB [Prevotella melaninogenica ATCC 25845]
 gi|302150098|gb|ADK96360.1| FeS assembly protein SufB [Prevotella melaninogenica ATCC 25845]
          Length = 481

 Score =  534 bits (1375), Expect = e-149,   Method: Composition-based stats.
 Identities = 295/489 (60%), Positives = 381/489 (77%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +   + V+K+   +Y++GF T++  +  PKGLNED++R IS KK EP+W+L++RL 
Sbjct: 1   MSENKNN-EFVKKVAEQKYEFGFTTDVHTEVIPKGLNEDVVRLISQKKGEPEWLLDFRLK 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W T+  P+W  +  P +   D+ YYA P +        ++DPEL +T++KLGIP+ 
Sbjct: 60  AFRYWQTLPIPTWGHLHLPELHLQDISYYADPLAKKPKN--KEIDPELAKTFDKLGIPLE 117

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  L+G      AVDA+ DSVSV TTFK++L + G+IF  I EA+ EHPDL++KYL +V
Sbjct: 118 ERLALSGT-----AVDAIMDSVSVKTTFKKQLAEKGIIFCSIGEAVQEHPDLIRKYLGSV 172

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+ AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN   TGQFERTLI+AD+ SY
Sbjct: 173 VPYRDNYSAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINAVNTGQFERTLIVADDDSY 232

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVE+V LDNAE+KYSTVQNWYPGD  GKGG+ N VTKRG+
Sbjct: 233 VSYLEGCTAPMRDENQLHAAVVEIVVLDNAEVKYSTVQNWYPGDENGKGGVLNLVTKRGE 292

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
            RG+ SK+SWTQ+ETGSAITWKYPSC+L+G+ S  EFYS+A++N +Q+ D+GTKM+H+ K
Sbjct: 293 LRGVNSKLSWTQVETGSAITWKYPSCVLKGDNSQAEFYSVAVTNNYQEADTGTKMIHMGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G++CGAHT PY++  N
Sbjct: 353 NTKSTIISKGISAGHSQNSYRGLVRATANAENARNYSSCDSLLLGSDCGAHTFPYMDIHN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKIS++ LFYC QRGIP E A+ LIVNG+ ++VL KLPMEFAVEAQKL+
Sbjct: 413 DTAIVEHEATTSKISEDQLFYCNQRGIPTEDAVGLIVNGYAKDVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
            ++LEG+VG
Sbjct: 473 SVTLEGTVG 481


>gi|288801644|ref|ZP_06407086.1| FeS assembly protein SufB [Prevotella melaninogenica D18]
 gi|288335686|gb|EFC74119.1| FeS assembly protein SufB [Prevotella melaninogenica D18]
          Length = 493

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 296/489 (60%), Positives = 381/489 (77%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +   + V+K+   +Y++GF T++  +  PKGLNED++R IS KK EP+W+L++RL 
Sbjct: 13  MSENKNN-EFVKKVAEQKYEFGFTTDVHTEVIPKGLNEDVVRLISQKKGEPEWLLDFRLK 71

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+R W T+  P+W  +  P +   D+ YYA P +        ++DPEL +T++KLGIP+ 
Sbjct: 72  AFRYWQTLPIPTWGHLHLPELHLQDISYYADPLAKKPKN--KEIDPELEKTFDKLGIPLE 129

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  L+G      AVDA+ DSVSV TTFK++L + G+IF  I EA+ EHPDLV+KYL +V
Sbjct: 130 ERLALSGT-----AVDAIMDSVSVKTTFKKQLAEKGIIFCSIGEAVQEHPDLVRKYLGSV 184

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+ AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN   TGQFERTLI+AD+ SY
Sbjct: 185 VPYRDNYSAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINAVNTGQFERTLIVADDDSY 244

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVE+V LDNAE+KYSTVQNWYPGD  GKGG+ N VTKRG+
Sbjct: 245 VSYLEGCTAPMRDENQLHAAVVEIVVLDNAEVKYSTVQNWYPGDENGKGGVLNLVTKRGE 304

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
            RG+ SK+SWTQ+ETGSAITWKYPSC+L+G+ S  EFYS+A++N +Q+ D+GTKM+H+ K
Sbjct: 305 LRGVNSKLSWTQVETGSAITWKYPSCVLKGDNSQAEFYSVAVTNNYQEADTGTKMIHMGK 364

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G++CGAHT PY++  N
Sbjct: 365 NTKSTIISKGISAGHSQNSYRGLVRATANAENARNYSSCDSLLLGSDCGAHTFPYMDIHN 424

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKIS++ LFYC QRGIP E A+ LIVNG+ ++VL KLPMEFAVEAQKL+
Sbjct: 425 DTAIVEHEATTSKISEDQLFYCNQRGIPTEDAVGLIVNGYAKDVLNKLPMEFAVEAQKLL 484

Query: 481 DISLEGSVG 489
            ++LEG+VG
Sbjct: 485 SVTLEGTVG 493


>gi|134301878|ref|YP_001121847.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. tularensis WY96-3418]
 gi|134049655|gb|ABO46726.1| FeS assembly protein SufB [Francisella tularensis subsp. tularensis
           WY96-3418]
          Length = 481

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 335/482 (69%), Positives = 400/482 (82%), Gaps = 4/482 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF TNI+ +    GLNED+IR ISA+KNE +++LEWRL AY +WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNELEFLLEWRLKAYHKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + YP IDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQE+LAG
Sbjct: 63  KSPKWADLNYPPIDFQAISYYSSPKSLKNHPKSLDEVDPEIIETYNKLGIPLHEQEMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--RNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGC
Sbjct: 181 FAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCH-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   AA++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EAT SKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEAQKL+++SLEG+
Sbjct: 420 EATISKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGA 479

Query: 488 VG 489
           VG
Sbjct: 480 VG 481


>gi|312282597|dbj|BAJ34164.1| unnamed protein product [Thellungiella halophila]
          Length = 566

 Score =  533 bits (1374), Expect = e-149,   Method: Composition-based stats.
 Identities = 295/490 (60%), Positives = 360/490 (73%), Gaps = 7/490 (1%)

Query: 2   VAVRETVDKVRKIDVDQY--KYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRL 59
             V  T    +      Y  KYGF   I     PKGL+E+ IR IS  KNEPDWMLE+R 
Sbjct: 82  PTVSSTDKLKQYFQNQDYDKKYGFVEEIDSFTIPKGLSEETIRSISKLKNEPDWMLEFRF 141

Query: 60  LAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPI 119
            AY ++L +++P W+  RYP+I+F D+ YY+APK      SLD+ +P+LL  ++KLG+P+
Sbjct: 142 KAYAKFLKLEEPKWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEANPQLLEYFDKLGVPL 201

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            EQ+ LA      VAVDAV DSVS+ TT ++ L+KSGVIF PISEAI E+PDL+KKYL  
Sbjct: 202 TEQKRLA-----NVAVDAVLDSVSIATTHRKTLEKSGVIFCPISEAIREYPDLIKKYLGR 256

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DN+YAALNSAVF+DGSF YIPK  RCPM +STYFRIN   TGQFERTLI+A+EGS
Sbjct: 257 VVPSDDNYYAALNSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVAEEGS 316

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           +V YLEGCTAP  D NQLHAAVVEL   + AEIKYSTVQNWY GD +GKGGIYNFVTKRG
Sbjct: 317 FVEYLEGCTAPSYDTNQLHAAVVELYCGEGAEIKYSTVQNWYAGDEEGKGGIYNFVTKRG 376

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
            C G RSKISWTQ+ETGSAITWKYPS +L G+ S GEFYS+A++N +QQ D+GTKM+H  
Sbjct: 377 LCAGDRSKISWTQVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHKG 436

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT SRI+SKGISAG S N YRG V V   A +++N + CDS+LIG+   A+T PYI+ K
Sbjct: 437 KNTKSRIISKGISAGHSRNCYRGLVQVQSKAENAKNTSTCDSMLIGDKAAANTYPYIQVK 496

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  +EHEA+TSKI ++ LFY  QRGI  E A+A +++GF R+V  KLP EF  E  +L
Sbjct: 497 NPSAKVEHEASTSKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAEVNQL 556

Query: 480 IDISLEGSVG 489
           + I LEGSVG
Sbjct: 557 MSIKLEGSVG 566


>gi|282879390|ref|ZP_06288133.1| FeS assembly protein SufB [Prevotella buccalis ATCC 35310]
 gi|281298503|gb|EFA90929.1| FeS assembly protein SufB [Prevotella buccalis ATCC 35310]
          Length = 494

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 307/490 (62%), Positives = 385/490 (78%), Gaps = 8/490 (1%)

Query: 1   MVAVRETV-DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRL 59
           M  V  T  + VRK+   +Y++GF T++  +   KGLNED+IR IS KK EP+WMLE+RL
Sbjct: 12  MEEVNNTNNEYVRKLTEQKYEFGFTTDVHTEIIEKGLNEDVIRLISDKKGEPEWMLEFRL 71

Query: 60  LAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPI 119
            AYR WLTM  PSW  +  P I++ ++ YYA P +        ++DPEL +T++KLGIP+
Sbjct: 72  KAYRHWLTMTQPSWGHVTLPDINYQEISYYADPMAKKPAN--KELDPELEKTFDKLGIPL 129

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            E+  L+G      AVDA+ DSVSV TTFKE+LK+ GVIF  + EAI EH  LV++YL T
Sbjct: 130 EERLALSGT-----AVDAIMDSVSVKTTFKEKLKEKGVIFCSMGEAIKEHSALVRQYLGT 184

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DNF+AALNSAVF+DGSFV+IPKGVRCPMELS+YFRIN + TGQFERTLI+A++ +
Sbjct: 185 VVPYHDNFFAALNSAVFSDGSFVFIPKGVRCPMELSSYFRINARNTGQFERTLIVAEDDA 244

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA+VE++ ++NAE+KYSTVQNWYPGD  GKGG+ N VTKRG
Sbjct: 245 YVSYLEGCTAPMRDENQLHAAIVEIIVMNNAEVKYSTVQNWYPGDEHGKGGVLNLVTKRG 304

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           DCRG+ SK+SWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N  Q+ D+GTKM+H+ 
Sbjct: 305 DCRGVNSKLSWTQVETGSAITWKYPSCILRGDGSQAEFYSVAVTNHHQEADTGTKMIHMG 364

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNTTS I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G+ CGAHT PY++  
Sbjct: 365 KNTTSTIISKGISAGHSQNSYRGLVRATANADNARNYSSCDSLLLGSECGAHTFPYMDIH 424

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N S  +EHEATTSKIS++ LFYC QRGIP E A+ LIVNG+ +EVL KLPMEFAVEAQKL
Sbjct: 425 NDSAIVEHEATTSKISEDQLFYCNQRGIPTEDAVGLIVNGYAKEVLNKLPMEFAVEAQKL 484

Query: 480 IDISLEGSVG 489
           + +SLEG+VG
Sbjct: 485 LSVSLEGTVG 494


>gi|256422370|ref|YP_003123023.1| FeS assembly protein SufB [Chitinophaga pinensis DSM 2588]
 gi|256037278|gb|ACU60822.1| FeS assembly protein SufB [Chitinophaga pinensis DSM 2588]
          Length = 481

 Score =  533 bits (1373), Expect = e-149,   Method: Composition-based stats.
 Identities = 316/486 (65%), Positives = 380/486 (78%), Gaps = 5/486 (1%)

Query: 4   VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYR 63
           +R + + +  I   +Y++GF T+I+++ AP GLNED IRFISAKK EP+WMLEWRL  ++
Sbjct: 1   MRNSNEIIDDIANREYEFGFTTDIEMEMAPVGLNEDTIRFISAKKEEPEWMLEWRLKGFQ 60

Query: 64  RWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQE 123
            +  M+ P W     P +D   L YYAAPK      SLD+VDPELL T+EKLGIPI EQ+
Sbjct: 61  AFKKMQFPKWQHFEMPELDLQKLSYYAAPKKKKQLGSLDEVDPELLATFEKLGIPINEQK 120

Query: 124 ILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPV 183
            LAGV    V          V TTFK +L++ G+IF    EA+  HPDLVKKYL TVVP 
Sbjct: 121 ALAGVAVDVVFDSVS-----VATTFKAKLQELGIIFCSFGEAVRNHPDLVKKYLGTVVPH 175

Query: 184 GDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSY 243
            DN +AALN+AVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLIIAD+ SYVSY
Sbjct: 176 SDNIFAALNAAVFSDGSFVYIPKGVRCPMELSTYFRINAENTGQFERTLIIADDNSYVSY 235

Query: 244 LEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRG 303
           LEGCTAP+RDENQLHAAVVEL+A+D+AEIKYSTVQNWYPGD  G GGIYNFVTKRG C+G
Sbjct: 236 LEGCTAPRRDENQLHAAVVELIAMDHAEIKYSTVQNWYPGDKDGNGGIYNFVTKRGICKG 295

Query: 304 MRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTT 363
             SKISWTQ+ETGSAITWKYPS +L+G+ + GEFYS+A++   Q  D+GTK+ HL +NT 
Sbjct: 296 KSSKISWTQVETGSAITWKYPSVILQGDDAEGEFYSVAVTRNKQIADTGTKIYHLGRNTR 355

Query: 364 SRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSC 423
           SRI+SKGISAG S+NTYRG V V   AA++RNFTQCDSLLIG+ CGAHT PYIES+NS+ 
Sbjct: 356 SRIISKGISAGLSDNTYRGLVQVGPRAANARNFTQCDSLLIGDRCGAHTFPYIESRNSTA 415

Query: 424 NLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDIS 483
            +EHEATTSKI ++ +FY  QRGI  E A+ALIVNG+ +EVL +LPMEFAVEA+KL+ I+
Sbjct: 416 TVEHEATTSKIGEDQIFYLNQRGIETEKAVALIVNGYAQEVLNQLPMEFAVEARKLLSIT 475

Query: 484 LEGSVG 489
           LEGSVG
Sbjct: 476 LEGSVG 481


>gi|332881712|ref|ZP_08449360.1| FeS assembly protein SufB [Capnocytophaga sp. oral taxon 329 str.
           F0087]
 gi|332680351|gb|EGJ53300.1| FeS assembly protein SufB [Capnocytophaga sp. oral taxon 329 str.
           F0087]
          Length = 507

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 305/482 (63%), Positives = 389/482 (80%), Gaps = 8/482 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           VR++   +Y+YGF T++Q +   +GLNED++R IS+KK EP+W+LE+RL A+R W T K 
Sbjct: 31  VREVAHKKYEYGFSTDVQTEIIERGLNEDVVRLISSKKEEPEWLLEFRLQAFRYWQTQKQ 90

Query: 71  PSWARIRYPAIDFDDLYYYAAPKS---IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           PSWA ++ P ID+  + YYA P       GP+SLD++DPEL++T++KLGIP+ E+  L+G
Sbjct: 91  PSWAHLKMPEIDYQAISYYADPTKGMKKDGPKSLDEIDPELMKTFDKLGIPLEERLALSG 150

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                 AVDAV DSVSV TTFKE+L + G+IF  ISEA+ E+PDLVK+YL +VVP  DN+
Sbjct: 151 T-----AVDAVMDSVSVKTTFKEKLSERGIIFCSISEAVREYPDLVKQYLGSVVPYRDNY 205

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+ D+G YVSYLEGC
Sbjct: 206 FAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVCDDGGYVSYLEGC 265

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAA+VE+V  +NAE+KYSTVQNWYPGD++G+GG+ N VTKRG  RG  SK
Sbjct: 266 TAPMRDENQLHAAIVEIVVNENAEVKYSTVQNWYPGDAEGRGGVLNLVTKRGHLRGANSK 325

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           +SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL ++T S I+
Sbjct: 326 LSWTQVETGSAITWKYPSCILSGDHSQAEFYSVAVTNNYQQADTGTKMIHLGRDTKSTII 385

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S N+YRG V V   A  +RN++ CDSLL+G+ CGAHT PY++ +N +  +EH
Sbjct: 386 SKGISAGKSQNSYRGLVRVAPKANGARNYSSCDSLLLGSECGAHTFPYMDVRNETAIVEH 445

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKIS+E LFYC QRGIP E A+ LIVNG+ ++V+ KLPMEFAVEAQKL+++SLEG+
Sbjct: 446 EATTSKISEEQLFYCNQRGIPTEEAVGLIVNGYAKDVINKLPMEFAVEAQKLLNVSLEGT 505

Query: 488 VG 489
           VG
Sbjct: 506 VG 507


>gi|78778460|ref|YP_396572.1| cysteine desulfurase activator complex subunit SufB
           [Prochlorococcus marinus str. MIT 9312]
 gi|78711959|gb|ABB49136.1| Iron-regulated ABC transporter membrane component SufB
           [Prochlorococcus marinus str. MIT 9312]
          Length = 480

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 297/479 (62%), Positives = 374/479 (78%), Gaps = 5/479 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           V+ +  + YKYGF T+I+ +K  KGLNEDIIR IS KK EP ++L++RL A+++W  M++
Sbjct: 7   VKDVVKEPYKYGFVTDIETEKIAKGLNEDIIRLISEKKEEPKYLLDFRLKAFKKWQKMEE 66

Query: 71  PSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQT 130
           P+WA + Y  I++ D+ YY+APK      SLD+VDP+LL T++KLGIP+ EQ+ L     
Sbjct: 67  PNWAELGYKEINYQDIIYYSAPKQKEKISSLDEVDPKLLETFDKLGIPLTEQKKL----- 121

Query: 131 SKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAA 190
           + VAVDAVFDSVS+ TTF+EEL + GVIF  ISEA+  H DL++KYL TVVP GDN++AA
Sbjct: 122 TNVAVDAVFDSVSIATTFREELAEHGVIFCSISEAVKNHSDLIEKYLGTVVPAGDNYFAA 181

Query: 191 LNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAP 250
           LNSAVF+DGSFVYIPKGV CPM+LS+YFRIN   +GQFERTLIIA+E S VSYLEGCTAP
Sbjct: 182 LNSAVFSDGSFVYIPKGVTCPMDLSSYFRINSGDSGQFERTLIIAEESSSVSYLEGCTAP 241

Query: 251 QRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISW 310
             D N LHAAVVEL+ALD+A IKYSTVQNWY GD +G GGI+NFVTKRG C G RSKISW
Sbjct: 242 MFDTNTLHAAVVELIALDDAAIKYSTVQNWYAGDEKGVGGIFNFVTKRGKCLGKRSKISW 301

Query: 311 TQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKG 370
           +Q+ETGSAITWKYPSCLL GE+S GEFYS+A++N  QQ D+GTKM+H+   T S IVSKG
Sbjct: 302 SQVETGSAITWKYPSCLLLGEESVGEFYSVALTNNLQQADTGTKMIHIGPKTKSTIVSKG 361

Query: 371 ISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEAT 430
           ISAG S N+YRG V +   A  SRN++QCDS+LIG+   A+T PYI+S+  +  +EHEA+
Sbjct: 362 ISAGNSINSYRGLVKMGTKAIGSRNYSQCDSMLIGDQASANTFPYIKSQQPNSEIEHEAS 421

Query: 431 TSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           T +IS++ LFY   RGI  E AI+++V+GF R+V  +LPMEFA EA KL+ + LEGSVG
Sbjct: 422 TCRISEDQLFYLQSRGIEFEEAISMMVSGFCRDVFNQLPMEFAAEADKLLALKLEGSVG 480


>gi|330997784|ref|ZP_08321619.1| FeS assembly protein SufB [Paraprevotella xylaniphila YIT 11841]
 gi|329569672|gb|EGG51437.1| FeS assembly protein SufB [Paraprevotella xylaniphila YIT 11841]
          Length = 507

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 302/482 (62%), Positives = 387/482 (80%), Gaps = 8/482 (1%)

Query: 11  VRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKD 70
           VR++   +Y+YGF T++Q +   +GLNED++R IS+KK EP+W+LE+RL A+R W   + 
Sbjct: 31  VREVAHKKYEYGFSTDVQTEIIERGLNEDVVRLISSKKEEPEWLLEFRLQAFRYWQAQEQ 90

Query: 71  PSWARIRYPAIDFDDLYYYAAPKS---IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           PSWA ++ P ID+  + YYA P       GP+SLD++DPEL++T++KLGIP+ E+  L+G
Sbjct: 91  PSWAHLKIPEIDYQAISYYADPTKGMKKDGPKSLDEIDPELMKTFDKLGIPLEERLALSG 150

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                 AVDAV DSVSV TTFKE+L + G+IF  ISEA+ E+PDLV++YL +VVP  DN+
Sbjct: 151 T-----AVDAVMDSVSVKTTFKEKLSERGIIFCSISEAVREYPDLVRQYLGSVVPYRDNY 205

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGVRCPMELSTYFRIN + TGQFERTLI+ D+G YVSYLEGC
Sbjct: 206 FAALNSAVFSDGSFVYIPKGVRCPMELSTYFRINARNTGQFERTLIVCDDGGYVSYLEGC 265

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAA+VE+V  +NAE+KYSTVQNWYPGD++G+GG+ N VTKRG  RG  SK
Sbjct: 266 TAPMRDENQLHAAIVEIVVNENAEVKYSTVQNWYPGDAEGRGGVLNLVTKRGHLRGANSK 325

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           +SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N +QQ D+GTKM+HL  +T S I+
Sbjct: 326 LSWTQVETGSAITWKYPSCILSGDHSQAEFYSVAVTNNYQQADTGTKMIHLGCDTKSTII 385

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG S N+YRG V V   A  +RN++ CDSLL+G+ CGAHT PY++ +N +  +EH
Sbjct: 386 SKGISAGKSQNSYRGLVRVAPKADGARNYSSCDSLLLGSECGAHTFPYMDVRNETAIVEH 445

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKIS+E LFYC QRGIP E A+ LIVNG+ ++V+ KLPMEFAVEAQKL+++SLEG+
Sbjct: 446 EATTSKISEEQLFYCNQRGIPTEEAVGLIVNGYAKDVINKLPMEFAVEAQKLLNVSLEGT 505

Query: 488 VG 489
           VG
Sbjct: 506 VG 507


>gi|260885287|ref|ZP_05896841.1| FeS assembly protein SufB [Prevotella tannerae ATCC 51259]
 gi|260852984|gb|EEX72853.1| FeS assembly protein SufB [Prevotella tannerae ATCC 51259]
          Length = 491

 Score =  533 bits (1372), Expect = e-149,   Method: Composition-based stats.
 Identities = 299/487 (61%), Positives = 382/487 (78%), Gaps = 7/487 (1%)

Query: 3   AVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAY 62
            + +  D +R+    +Y+YGF T+++ +  P GLNED+IR IS KK EP+W+LE+RL A+
Sbjct: 12  TMADEKDIIRETFDKKYEYGFTTDVETEIIPTGLNEDVIRLISHKKEEPEWLLEFRLRAF 71

Query: 63  RRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQ 122
             W T+  P W  +  PAID+  + YYA P      +   ++DPEL++T++KLGIP+ E+
Sbjct: 72  HYWQTLAQPEWGHVNLPAIDYQAISYYADPLKKKSGK--KEIDPELMKTFDKLGIPLEER 129

Query: 123 EILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVP 182
             L+G     VAVDAV DSVSV TTFK++L++ G+IF  +SEA+ E+PDLV+KYL +VVP
Sbjct: 130 LALSG-----VAVDAVMDSVSVKTTFKDKLQEKGIIFCSMSEAVRENPDLVRKYLGSVVP 184

Query: 183 VGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVS 242
             DN++AALNSAVF+DGSFVYIPKG+RCPMELS+YFRIN + TGQFERTLI+ ++G YVS
Sbjct: 185 YRDNYFAALNSAVFSDGSFVYIPKGIRCPMELSSYFRINARNTGQFERTLIVCEDGGYVS 244

Query: 243 YLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCR 302
           YLEGCTAPQRDENQLHAA+VE++    AE+KYSTVQNWYPGDS+G+GG+YN VTKRG  R
Sbjct: 245 YLEGCTAPQRDENQLHAAIVEIIVEKEAEVKYSTVQNWYPGDSEGRGGVYNLVTKRGQLR 304

Query: 303 GMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNT 362
           G  SK+SWTQ+ETGSAITWKYPSC+L G+ S  EFYS+A++N  Q+ D+GTKM+HL KNT
Sbjct: 305 GANSKLSWTQVETGSAITWKYPSCVLMGDNSQAEFYSVAVTNHHQEADTGTKMIHLGKNT 364

Query: 363 TSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSS 422
            S IVSKGISAG S N+YRG V     A  +RN++ CDSLL+G+ CGAHT PYI+  N++
Sbjct: 365 RSTIVSKGISAGKSQNSYRGLVKCSSRADGARNYSSCDSLLLGSECGAHTFPYIDVNNNN 424

Query: 423 CNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDI 482
             +EHEATTSKIS++ LFYC QRGIP EAA+ LIVNG+ +EV+ KLPMEFAVEAQKL+ +
Sbjct: 425 AIVEHEATTSKISEDQLFYCNQRGIPPEAAVDLIVNGYAKEVINKLPMEFAVEAQKLLSL 484

Query: 483 SLEGSVG 489
           SLEGSVG
Sbjct: 485 SLEGSVG 491


>gi|152990761|ref|YP_001356483.1| Fe-S cluster assembly protein SufB [Nitratiruptor sp. SB155-2]
 gi|151422622|dbj|BAF70126.1| Fe-S cluster assembly protein SufB [Nitratiruptor sp. SB155-2]
          Length = 477

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 315/482 (65%), Positives = 391/482 (81%), Gaps = 7/482 (1%)

Query: 8   VDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLT 67
           ++KV KI    Y+ GFE +++ +KAP GL ED I+FIS+KKNEP+WMLE RL A+  W  
Sbjct: 3   MEKVDKIINSDYELGFEIDVEEEKAPPGLTEDTIKFISSKKNEPEWMLELRLKAFHAWQK 62

Query: 68  MKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           M++P WA++ YP ID+  + Y+AAPK     +SLD+VDPE+LR YEKLGIP+ EQ+ LAG
Sbjct: 63  MEEPRWAKVTYPPIDYQSISYWAAPK--KALESLDEVDPEILRAYEKLGIPLEEQKALAG 120

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
                VAVDAV DSVSV TTF EEL K G+IF  ISEAI ++PDLVKKY+ +VVP+ DN+
Sbjct: 121 -----VAVDAVLDSVSVKTTFVEELNKLGIIFCSISEAIRDYPDLVKKYMFSVVPMTDNY 175

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DG+FVYIPKGV+CPMELSTYFRIN + TGQFERTLIIADEGSYVSY EGC
Sbjct: 176 FAALNSAVFSDGTFVYIPKGVKCPMELSTYFRINAQNTGQFERTLIIADEGSYVSYNEGC 235

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           +AP RDENQLHAAVVEL+A  +A I YST+QNWYPGD +G+GGIYNFVTKRG C G  SK
Sbjct: 236 SAPSRDENQLHAAVVELIAHKDAHINYSTIQNWYPGDIEGRGGIYNFVTKRGLCEGENSK 295

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           I+WTQ+ETGS ITWKYPSC+L+G+ S GEFYS+AI+   QQ D+GTKM+H+ KNT S I+
Sbjct: 296 ITWTQVETGSVITWKYPSCILKGDNSVGEFYSVAITRLAQQADTGTKMIHMGKNTKSVII 355

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISA    N+YRG V +H  A  ++NF++CDSLLIG++CGAHT PY+ESK ++  +EH
Sbjct: 356 SKGISAQKGQNSYRGLVKIHENAKGAKNFSECDSLLIGDSCGAHTFPYLESKCANAEVEH 415

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKIS+E LFY  QRG+ EE A+++IV+GF ++VL KLPMEFAVEA+ L+D++LEGS
Sbjct: 416 EATTSKISEEQLFYLRQRGVSEEDAVSMIVHGFCKDVLSKLPMEFAVEAKALLDLTLEGS 475

Query: 488 VG 489
           VG
Sbjct: 476 VG 477


>gi|91216153|ref|ZP_01253121.1| hypothetical protein P700755_05729 [Psychroflexus torquis ATCC
           700755]
 gi|91185670|gb|EAS72045.1| hypothetical protein P700755_05729 [Psychroflexus torquis ATCC
           700755]
          Length = 481

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 317/489 (64%), Positives = 392/489 (80%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    + ++  +++   +Y+YGF T ++ D  P GLNED++  IS KK EPDWM +WRL 
Sbjct: 1   MAYTEQELE--KELQNKEYEYGFYTEMESDTFPPGLNEDVVIGISKKKEEPDWMTQWRLD 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AYR WLTMK+P WA I Y   D+  + YY+AP +     SLD+VDPE+L T++KLGI I 
Sbjct: 59  AYRHWLTMKEPDWANIGYEKPDYQAISYYSAPGTKPKYDSLDEVDPEMLETFKKLGISID 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAG     VA+D V DS+SV TTFK+ L + G+IF  ISEAI E+P+L+KKY+ +V
Sbjct: 119 EQKKLAG-----VAMDVVIDSISVTTTFKKTLAEKGIIFCSISEAIQEYPELIKKYMGSV 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN++AALNSAVF DGSF YIPKGVRCPMELSTYFRIN+  TGQFERTL+IA++ SY
Sbjct: 174 VPTSDNYFAALNSAVFGDGSFCYIPKGVRCPMELSTYFRINQANTGQFERTLVIAEDSSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALDNAEIKYSTVQNWYPG+ +G GG++NFVTKRG 
Sbjct: 234 VSYLEGCTAPMRDENQLHAAVVELVALDNAEIKYSTVQNWYPGNKEGIGGVFNFVTKRGI 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSAITWKYPSC+L+G+ S GEFYSIA++N +QQ D+GTKM+H+ K
Sbjct: 294 C-EKNAKISWTQVETGSAITWKYPSCILKGDNSIGEFYSIAVTNNYQQADTGTKMIHIGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V +++GA ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 353 NTKSTIISKGISAGNSQNSYRGLVQINKGAVNARNFSQCDSLLMGNRCGAHTFPYIEAKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATT+KI ++ +FYC QRGI  E AIALIVNG+ ++VL KLPMEFAVEAQKL+
Sbjct: 413 KTAQVEHEATTTKIGEDQIFYCNQRGIDTEKAIALIVNGYSKDVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|281422604|ref|ZP_06253603.1| FeS assembly protein SufB [Prevotella copri DSM 18205]
 gi|281403274|gb|EFB33954.1| FeS assembly protein SufB [Prevotella copri DSM 18205]
          Length = 483

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 304/490 (62%), Positives = 382/490 (77%), Gaps = 8/490 (1%)

Query: 1   MVA-VRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRL 59
           M    +E    V+ +   +Y+YGF T++  +   KGLNED++R IS KK EPDWMLE+RL
Sbjct: 1   MAEKEKEQNQVVKDVIDQKYEYGFTTDVHTEIIEKGLNEDVVRLISQKKGEPDWMLEFRL 60

Query: 60  LAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPI 119
            AY  W T+K+P W  +  P ID+ ++ YYA P +        ++DPEL +T++KLGIP+
Sbjct: 61  KAYNYWKTLKEPKWGHVHVPPIDYQEISYYADPLAKKPKN--KEIDPELEKTFDKLGIPL 118

Query: 120 REQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLST 179
            E+  L+G      AVDA+ DSVSV TTFKE+L++ GVIF  I EA+ EHPDLV++YL T
Sbjct: 119 EERLALSGT-----AVDAIMDSVSVKTTFKEKLREKGVIFCSIGEAVKEHPDLVREYLGT 173

Query: 180 VVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGS 239
           VVP  DNFYAALNS VF+DGSFVYIPKGVRCPMELS+YFRIN + TGQFERTLIIAD+ +
Sbjct: 174 VVPYRDNFYAALNSCVFSDGSFVYIPKGVRCPMELSSYFRINARNTGQFERTLIIADDDA 233

Query: 240 YVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRG 299
           YVSYLEGCTAP RDENQLHAA+VE++  DNAE+KYSTVQNWYPGD  GKGG+ N VTKRG
Sbjct: 234 YVSYLEGCTAPMRDENQLHAAIVEIIVKDNAEVKYSTVQNWYPGDEHGKGGVLNLVTKRG 293

Query: 300 DCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLA 359
           D RG+ SK+SWTQ+ETGSAITWKYPSC+LRG+ S  EFYS+A++N +Q+ D+GTKM+H+ 
Sbjct: 294 DLRGVNSKLSWTQVETGSAITWKYPSCILRGDNSVAEFYSVAVTNNYQEADTGTKMIHMG 353

Query: 360 KNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESK 419
           KNT S I+SKGISAG S N+YRG V     A ++RN++ CDSLL+G++CGAHT PY+++ 
Sbjct: 354 KNTKSTIISKGISAGHSQNSYRGLVRATSNADNARNYSSCDSLLLGSDCGAHTFPYMDAH 413

Query: 420 NSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKL 479
           N +   EHEATTSKIS++ LFYC QRGIP E A+ LIVNG+ ++VL KLPMEFAVEAQKL
Sbjct: 414 NDTAVFEHEATTSKISEDQLFYCNQRGIPTEEAVGLIVNGYAKDVLNKLPMEFAVEAQKL 473

Query: 480 IDISLEGSVG 489
           + +SLEG+VG
Sbjct: 474 LSVSLEGTVG 483


>gi|15234447|ref|NP_192386.1| ATABC1 (ATP BINDING CASSETTE PROTEIN 1); ATPase, coupled to
           transmembrane movement of substances / protein binding /
           transporter [Arabidopsis thaliana]
 gi|75216473|sp|Q9ZS97|AB8I_ARATH RecName: Full=UPF0051 protein ABCI8, chloroplastic; AltName:
           Full=ABC transporter I family member 8; Short=ABC
           transporter ABCI.8; Short=AtABCI8; AltName:
           Full=Non-intrinsic ABC protein 1; Short=Protein ABC1;
           AltName: Full=Plastid sufB-like protein; AltName:
           Full=Protein LONG AFTER FAR-RED 6; Flags: Precursor
 gi|4115931|gb|AAD03441.1| contains similarity to Guillardia theta ABC transporter
           (GB:AF041468) [Arabidopsis thaliana]
 gi|7267235|emb|CAB80842.1| putative ABC transporter [Arabidopsis thaliana]
 gi|15529143|gb|AAK97666.1| AT4g04770/T4B21_16 [Arabidopsis thaliana]
 gi|15912265|gb|AAL08266.1| AT4g04770/T4B21_16 [Arabidopsis thaliana]
 gi|22655482|gb|AAM98333.1| At4g04770/T4B21_16 [Arabidopsis thaliana]
 gi|38175819|tpg|DAA01952.1| TPA_exp: putative ABC transporter 1 [Arabidopsis thaliana]
 gi|332657023|gb|AEE82423.1| UPF0051 protein ABCI8 [Arabidopsis thaliana]
          Length = 557

 Score =  532 bits (1371), Expect = e-149,   Method: Composition-based stats.
 Identities = 295/478 (61%), Positives = 359/478 (75%), Gaps = 6/478 (1%)

Query: 12  RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP 71
           + +D D+ KYGF  +I     PKGL+E+ IR IS  K EPDWMLE+R  AY ++L +++P
Sbjct: 86  QNLDYDK-KYGFVEDIDSFTIPKGLSEETIRLISKLKEEPDWMLEFRFKAYAKFLKLEEP 144

Query: 72  SWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTS 131
            W+  RYP+I+F D+ YY+APK      SLD+VDP+LL  ++KLG+P+ EQ+ LA     
Sbjct: 145 KWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEVDPQLLEYFDKLGVPLTEQKRLA----- 199

Query: 132 KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAAL 191
            VAVDAV DSVS+ TT ++ L+KSGVIF  ISEAI E+PDL+KKYL  VVP  DN+YAAL
Sbjct: 200 NVAVDAVIDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIKKYLGRVVPSDDNYYAAL 259

Query: 192 NSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQ 251
           NSAVF+DGSF YIPK  RCPM +STYFRIN   TGQFERTLI+A+EGS+V YLEGCTAP 
Sbjct: 260 NSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVAEEGSFVEYLEGCTAPS 319

Query: 252 RDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWT 311
            D NQLHAAVVEL     AEIKYSTVQNWY GD QGKGGIYNFVTKRG C G RSKISWT
Sbjct: 320 YDTNQLHAAVVELYCGKGAEIKYSTVQNWYAGDEQGKGGIYNFVTKRGLCAGDRSKISWT 379

Query: 312 QLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGI 371
           Q+ETGSAITWKYPS +L G+ S GEFYS+A++N +QQ D+GTKM+H  KNT SRI+SKGI
Sbjct: 380 QVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHKGKNTKSRIISKGI 439

Query: 372 SAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATT 431
           SAG S N YRG V V   A  ++N + CDS+LIG+   A+T PYI+ KN S  +EHEA+T
Sbjct: 440 SAGHSRNCYRGLVQVQSKAEGAKNTSTCDSMLIGDKAAANTYPYIQVKNPSAKVEHEAST 499

Query: 432 SKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           SKI ++ LFY  QRGI  E A+A +++GF R+V  KLP EF  E  +L+ I LEGSVG
Sbjct: 500 SKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAEVNQLMSIKLEGSVG 557


>gi|11465706|ref|NP_053850.1| putative ABC transporter [Porphyra purpurea]
 gi|1723328|sp|P51240|YCF24_PORPU RecName: Full=UPF0051 protein ycf24; AltName: Full=ORF487
 gi|1276706|gb|AAC08126.1| hypothetical chloroplast ORF 24 [Porphyra purpurea]
          Length = 487

 Score =  531 bits (1369), Expect = e-149,   Method: Composition-based stats.
 Identities = 289/492 (58%), Positives = 382/492 (77%), Gaps = 8/492 (1%)

Query: 1   MVAVRETVDKVRKID---VDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEW 57
           MV  +  + +   +D      YKYGF T+++ ++ P+G++ ++++ IS KKNEP+++L +
Sbjct: 1   MVNTQNQISQTSDLDYIVNQPYKYGFTTSVESEQFPRGISREVVKLISKKKNEPEYLLNF 60

Query: 58  RLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGI 117
           RL AY +W  MK+P WA +++P IDF+ + YYA PK      SLD+VDPE+L T+ KLGI
Sbjct: 61  RLKAYEKWTKMKNPKWAHLKHPNIDFNSIIYYAVPKLKKELNSLDEVDPEILDTFNKLGI 120

Query: 118 PIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYL 177
            + EQ+ L+      VAVDAVFDSVS+ TTFK+EL ++GVIF  ISEAI  +PDL++KYL
Sbjct: 121 SLNEQKRLS-----NVAVDAVFDSVSIATTFKKELAEAGVIFCSISEAIRNYPDLIQKYL 175

Query: 178 STVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADE 237
            TVVP GDN++AALNSAVF+DGSF YIP    CP+ELSTYFRIN + +GQFERTLI+AD 
Sbjct: 176 GTVVPSGDNYFAALNSAVFSDGSFCYIPPDTVCPLELSTYFRINNEESGQFERTLIVADR 235

Query: 238 GSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTK 297
           GS VSYLEGCTAPQ D NQLHAA+VEL+ALD+AEIKYSTVQNWY G+  GKGGIYNFVTK
Sbjct: 236 GSKVSYLEGCTAPQYDTNQLHAAIVELIALDDAEIKYSTVQNWYAGNKDGKGGIYNFVTK 295

Query: 298 RGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLH 357
           RG C G  SKISWTQ+ETGSAITWKYP C+L G+ S GEFYS+A++N +Q+ D+GTKM+H
Sbjct: 296 RGLCSGKNSKISWTQVETGSAITWKYPGCILAGDNSQGEFYSVALTNNYQEADTGTKMIH 355

Query: 358 LAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIE 417
           +  NT S+I+SKGISAG S N+YRG V +   + +SRN++QCDSLLIG +  A+T PYI+
Sbjct: 356 IGNNTKSKIISKGISAGKSKNSYRGLVKIGPQSFNSRNYSQCDSLLIGQSSQANTFPYIQ 415

Query: 418 SKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQ 477
            +N +  +EHEA+TSKIS++ +FY LQRGI  E +++L+++GF ++V  +LPMEFAVEA 
Sbjct: 416 VQNPTAKVEHEASTSKISEDQIFYFLQRGINLEESVSLMISGFCKDVFNELPMEFAVEAD 475

Query: 478 KLIDISLEGSVG 489
           +L+ + LEG+VG
Sbjct: 476 RLLSLKLEGTVG 487


>gi|282892128|ref|ZP_06300603.1| hypothetical protein pah_c207o067 [Parachlamydia acanthamoebae str.
           Hall's coccus]
 gi|281498023|gb|EFB40367.1| hypothetical protein pah_c207o067 [Parachlamydia acanthamoebae str.
           Hall's coccus]
          Length = 489

 Score =  531 bits (1369), Expect = e-149,   Method: Composition-based stats.
 Identities = 298/478 (62%), Positives = 385/478 (80%), Gaps = 6/478 (1%)

Query: 13  KIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPS 72
                 YKYGF TN++ D   KGLNED+IR +S KKNEP +ML++RL AY++WL M++P 
Sbjct: 17  NFQDSDYKYGFVTNVETDSFAKGLNEDVIRALSEKKNEPAFMLDFRLKAYQKWLEMEEPH 76

Query: 73  WARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSK 132
           W    YP ID+ ++ YY+APK     +SL+DVDPE+L+T+++LGIP+ EQ  LA      
Sbjct: 77  WLNANYPPIDYQNIRYYSAPKMKPQHESLEDVDPEVLKTFQRLGIPLDEQMRLA-----N 131

Query: 133 VAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALN 192
           VAVD VFDSVS+ TTFK++L ++GV+   ISEAI ++P+LV+KY+ +VVP+GDNF+AALN
Sbjct: 132 VAVDMVFDSVSIGTTFKKKLDEAGVVLCSISEAIQKYPELVEKYMGSVVPIGDNFFAALN 191

Query: 193 SAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQR 252
           SAVFTDGSFVY+PKGV  PMELSTYFRIN+K +GQFERTLIIA++ S+VSYLEGCTAP  
Sbjct: 192 SAVFTDGSFVYVPKGVISPMELSTYFRINDKESGQFERTLIIAEDDSFVSYLEGCTAPAY 251

Query: 253 DENQLHAAVVELVALDNAEIKYSTVQNWYPGD-SQGKGGIYNFVTKRGDCRGMRSKISWT 311
           D NQLHAAVVELVALD A+IKY+TVQNWY G+   G+GG+YNFVTKRG C G+ SKISWT
Sbjct: 252 DNNQLHAAVVELVALDRAQIKYATVQNWYAGNPKTGEGGVYNFVTKRGRCAGVHSKISWT 311

Query: 312 QLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGI 371
           Q+E G+AITWKYPSC+L+G+ S GEFYS+A++NG  Q D+GTKM+HL KNT+S I+SKGI
Sbjct: 312 QVEVGAAITWKYPSCILQGDNSIGEFYSVALTNGKMQADTGTKMIHLGKNTSSTIISKGI 371

Query: 372 SAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATT 431
           SA  S+N+YRG V V   A  +RN+TQCDS+L+G+ C A+T PYIE  NS+ ++EHEA+T
Sbjct: 372 SADSSHNSYRGLVKVAPRAEGARNYTQCDSMLVGDQCTANTFPYIEVGNSTGSVEHEAST 431

Query: 432 SKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           SK+++E LFY  QRGI +E AI++IVNGF ++V+++LP+EFAVEAQKL+ + LE SVG
Sbjct: 432 SKLNEEQLFYFRQRGISQEDAISMIVNGFCKDVIRELPLEFAVEAQKLLTLKLENSVG 489


>gi|297813861|ref|XP_002874814.1| ATABC1 [Arabidopsis lyrata subsp. lyrata]
 gi|297320651|gb|EFH51073.1| ATABC1 [Arabidopsis lyrata subsp. lyrata]
          Length = 556

 Score =  531 bits (1368), Expect = e-149,   Method: Composition-based stats.
 Identities = 293/478 (61%), Positives = 359/478 (75%), Gaps = 6/478 (1%)

Query: 12  RKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP 71
           + +D D+ KYGF  +I     PKGL+E+ IR IS  K EPDWMLE+R  AY ++L +++P
Sbjct: 85  QNLDYDK-KYGFVEDIDSFTIPKGLSEETIRLISKLKEEPDWMLEFRFKAYAKFLKLEEP 143

Query: 72  SWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTS 131
            W+  RYP+I+F D+ YY+APK      SLD+ DP+LL  ++KLG+P+ EQ+ LA     
Sbjct: 144 KWSDNRYPSINFQDMCYYSAPKKKPTLNSLDEADPQLLEYFDKLGVPLTEQKRLA----- 198

Query: 132 KVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAAL 191
            VAVDAV DSVS+ TT ++ L+KSGVIF  ISEAI E+PDL+KKYL  VVP  DN+YA+L
Sbjct: 199 NVAVDAVLDSVSIATTHRKTLEKSGVIFCSISEAIREYPDLIKKYLGRVVPSDDNYYASL 258

Query: 192 NSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTAPQ 251
           NSAVF+DGSF YIPK  RCPM +STYFRIN   TGQFERTLI+A+EGS+V YLEGCTAP 
Sbjct: 259 NSAVFSDGSFCYIPKNTRCPMPISTYFRINAMETGQFERTLIVAEEGSFVEYLEGCTAPS 318

Query: 252 RDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWT 311
            D NQLHAAVVEL     AEIKYSTVQNWY GD QGKGGIYNFVTKRG C G RSKISWT
Sbjct: 319 YDTNQLHAAVVELYCGKGAEIKYSTVQNWYAGDEQGKGGIYNFVTKRGLCAGDRSKISWT 378

Query: 312 QLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGI 371
           Q+ETGSAITWKYPS +L G+ S GEFYS+A++N +QQ D+GTKM+H  KNT SRI+SKGI
Sbjct: 379 QVETGSAITWKYPSVVLEGDDSVGEFYSVALTNNYQQADTGTKMIHKGKNTKSRIISKGI 438

Query: 372 SAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATT 431
           SAG S N YRG V V   A +++N + CDS+LIG+   A+T PYI+ KN S  +EHEA+T
Sbjct: 439 SAGHSRNCYRGLVQVQSKAENAKNTSTCDSMLIGDKAAANTYPYIQVKNPSAKVEHEAST 498

Query: 432 SKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           SKI ++ LFY  QRGI  E A+A +++GF R+V  KLP EF  E  +L+ I LEGSVG
Sbjct: 499 SKIGEDQLFYFQQRGIDHERALAAMISGFCRDVFNKLPDEFGAEVNQLMSIKLEGSVG 556


>gi|332292137|ref|YP_004430746.1| FeS assembly protein SufB [Krokinobacter diaphorus 4H-3-7-5]
 gi|332170223|gb|AEE19478.1| FeS assembly protein SufB [Krokinobacter diaphorus 4H-3-7-5]
          Length = 481

 Score =  531 bits (1368), Expect = e-149,   Method: Composition-based stats.
 Identities = 322/489 (65%), Positives = 397/489 (81%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    +  D   ++   +Y+YGF T+I+ +  P GLNEDIIR IS KK+EP WM EWRL 
Sbjct: 1   MAYTED--DLREELKTKEYEYGFFTDIESETFPVGLNEDIIRAISKKKDEPQWMTEWRLE 58

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           AY+ WL+M++P WA + Y   DF  + YY+AP ++   ++LDDVDP+LL  Y+KLGI + 
Sbjct: 59  AYKVWLSMEEPDWANVNYEKPDFQAIAYYSAPVAVDPNKTLDDVDPDLLAMYKKLGISVD 118

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ +     + +A+D V DSVSV TTFK+ L + G+IFM ISEAI EHP+LV+K+L T+
Sbjct: 119 EQKKM-----NNIAMDIVVDSVSVATTFKKTLAEKGIIFMSISEAIKEHPELVRKHLGTI 173

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VPV DN+YAALNSAVF+DGSF YIPKGV+CPMELSTYFRIN+ GTGQFERTL++ADEGSY
Sbjct: 174 VPVKDNYYAALNSAVFSDGSFCYIPKGVKCPMELSTYFRINQGGTGQFERTLLVADEGSY 233

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVEL+A+D+AEIKYSTVQNWYPG+++GKGG+YNFVTKRG 
Sbjct: 234 VSYLEGCTAPSRDENQLHAAVVELIAMDDAEIKYSTVQNWYPGNAEGKGGVYNFVTKRGL 293

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N  QQ D+GTKM+HL K
Sbjct: 294 C-EKNAKISWTQVETGSAVTWKYPSCILKGDNSIGEFYSIAVTNNHQQADTGTKMIHLGK 352

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++ GA ++RNF+QCDSLL+GN CGAHT PYIE+KN
Sbjct: 353 NTKSTIISKGISAGKSQNSYRGLVKINAGATNARNFSQCDSLLMGNECGAHTFPYIETKN 412

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            +  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 413 KTAQVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 472

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 473 EISLEGSVG 481


>gi|187931696|ref|YP_001891680.1| cysteine desulfurase activator complex subunit SufB [Francisella
           tularensis subsp. mediasiatica FSC147]
 gi|187712605|gb|ACD30902.1| sufS activator complex, sufB subunit [Francisella tularensis subsp.
           mediasiatica FSC147]
          Length = 480

 Score =  531 bits (1368), Expect = e-149,   Method: Composition-based stats.
 Identities = 334/481 (69%), Positives = 400/481 (83%), Gaps = 4/481 (0%)

Query: 9   DKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTM 68
           + + KI    Y++GF TNI+ +    GLNED+IR ISA+KNE +++LEWRL AY +WL M
Sbjct: 3   ENLDKIIEQDYEHGFVTNIEAETIEAGLNEDVIRLISARKNELEFLLEWRLKAYHKWLEM 62

Query: 69  KDPSWARIRYPAIDFDDLYYYAAPKS-IVGPQSLDDVDPELLRTYEKLGIPIREQEILAG 127
           K P WA + YP IDF  + YY++PKS    P+SLD+VDPE++ TY KLGIP+ EQ++LAG
Sbjct: 63  KSPKWADLNYPPIDFQAISYYSSPKSLKNHPKSLDEVDPEIIETYNKLGIPLHEQKMLAG 122

Query: 128 VQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNF 187
           V    +AVDAVFDSVSVVTTFKE+L ++GVIF PISEA+ ++P+LV+KYL +VVP GDNF
Sbjct: 123 V--RNIAVDAVFDSVSVVTTFKEKLAEAGVIFCPISEAVQKYPELVQKYLGSVVPQGDNF 180

Query: 188 YAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGC 247
           +AALNSAVF+DGSFVYIPKGV CPMELSTYFRIN   TGQFERTLIIADEGSYVSYLEGC
Sbjct: 181 FAALNSAVFSDGSFVYIPKGVTCPMELSTYFRINAMNTGQFERTLIIADEGSYVSYLEGC 240

Query: 248 TAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSK 307
           TAP RDENQLHAAVVELVALD AEIKYSTVQNWYPGD  GKGGIYNFVTKRG C    +K
Sbjct: 241 TAPMRDENQLHAAVVELVALDGAEIKYSTVQNWYPGDKDGKGGIYNFVTKRGVCH-KNAK 299

Query: 308 ISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIV 367
           ISWTQ+ETGSAITWKYPS +LRG+ S GEFYS+A++   QQ D+GTKM+HL KNT S I+
Sbjct: 300 ISWTQVETGSAITWKYPSVVLRGDNSIGEFYSVALTRHAQQADTGTKMIHLGKNTKSTII 359

Query: 368 SKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEH 427
           SKGISAG ++  YRG V +   AA++RNF+QCDSLLIG+NCGAHT PYIE+K++S  +EH
Sbjct: 360 SKGISAGKASQAYRGLVRISPNAANARNFSQCDSLLIGHNCGAHTYPYIENKSNSSQIEH 419

Query: 428 EATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           EATTSKISD+ LFYC QRG+ EE AIA+IVNGF +EV +KLP+EFAVEAQKL+++SLEG+
Sbjct: 420 EATTSKISDDQLFYCKQRGLSEEDAIAMIVNGFCKEVFKKLPLEFAVEAQKLMEVSLEGA 479

Query: 488 V 488
           V
Sbjct: 480 V 480


>gi|149369536|ref|ZP_01889388.1| iron-regulated ABC transporter, membrane-spanning permease
           [unidentified eubacterium SCB49]
 gi|149356963|gb|EDM45518.1| iron-regulated ABC transporter, membrane-spanning permease
           [unidentified eubacterium SCB49]
          Length = 482

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 325/489 (66%), Positives = 390/489 (79%), Gaps = 7/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M    E  D  ++++  +Y+YGF T+I+ +  P GLNEDI+R IS KK EP WM +WRL 
Sbjct: 1   MSKYTE-DDLKKELETKEYEYGFYTDIESETFPIGLNEDIVRAISKKKEEPQWMTDWRLE 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           ++R W TM++P WA + Y   DF  + YY+AP       S+DDVDPELL T+ KLGI + 
Sbjct: 60  SFRYWKTMEEPEWANVHYDKPDFQAISYYSAPNGKPKYDSIDDVDPELLETFNKLGISLD 119

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           EQ+ LAG     VA+D V DSVSV TTFK  L + G+IF  ISEAI EHP+LV+KY+ +V
Sbjct: 120 EQKKLAG-----VAMDVVVDSVSVATTFKSTLAEKGIIFCSISEAIKEHPELVRKYIGSV 174

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DNFYAALNSAVF+DGSF YIPKGVRCPMELSTYFRIN+  TGQFERTL++ADEGSY
Sbjct: 175 VPQKDNFYAALNSAVFSDGSFCYIPKGVRCPMELSTYFRINQANTGQFERTLVVADEGSY 234

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVELVALD+AEIKYSTVQNW+PG+ +GKGG+YNFVTKRG 
Sbjct: 235 VSYLEGCTAPSRDENQLHAAVVELVALDDAEIKYSTVQNWFPGNKEGKGGVYNFVTKRGI 294

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
           C    +KISWTQ+ETGSA+TWKYPSC+L+G+ S GEFYSIA++N FQQ D+GTKM+H+ K
Sbjct: 295 C-EKNAKISWTQVETGSAVTWKYPSCILKGDNSIGEFYSIAVTNNFQQADTGTKMIHIGK 353

Query: 361 NTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKN 420
           NT S I+SKGISAG S N+YRG V ++R A ++RNF+QCDSLL+GN CGAHT PYIE+ N
Sbjct: 354 NTRSTIISKGISAGKSQNSYRGLVKINRNADNARNFSQCDSLLMGNACGAHTFPYIEADN 413

Query: 421 SSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLI 480
            S  +EHEATTSKI ++ +FYC QRGI  E AIALIVNGF +EVL KLPMEFAVEAQKL+
Sbjct: 414 KSAQVEHEATTSKIGEDQIFYCNQRGIDTEKAIALIVNGFSKEVLNKLPMEFAVEAQKLL 473

Query: 481 DISLEGSVG 489
           +ISLEGSVG
Sbjct: 474 EISLEGSVG 482


>gi|260591776|ref|ZP_05857234.1| FeS assembly protein SufB [Prevotella veroralis F0319]
 gi|260536060|gb|EEX18677.1| FeS assembly protein SufB [Prevotella veroralis F0319]
          Length = 481

 Score =  531 bits (1367), Expect = e-148,   Method: Composition-based stats.
 Identities = 295/489 (60%), Positives = 379/489 (77%), Gaps = 8/489 (1%)

Query: 1   MVAVRETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLL 60
           M   +   + V+K+   +Y++GF T++  +  PKGLNEDI+R IS KK EP+W+L++RL 
Sbjct: 1   MSENKNN-EFVKKVAEQKYEFGFTTDVHTEVIPKGLNEDIVRLISQKKGEPEWLLDFRLK 59

Query: 61  AYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIR 120
           A+  W  +  P+W  +  P +   D+ YYA P +        ++DPEL +T++KLGIP+ 
Sbjct: 60  AFHYWEALPIPTWGHLHLPDLHLQDISYYADPLAKKPKN--KEIDPELEKTFDKLGIPLE 117

Query: 121 EQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTV 180
           E+  L+G      AVDA+ DSVSV TTFK++L + G+IF  I EA+ EHPDLV+KYL +V
Sbjct: 118 ERLALSGT-----AVDAIMDSVSVKTTFKKQLAEKGIIFCSIGEAVKEHPDLVRKYLGSV 172

Query: 181 VPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSY 240
           VP  DN+ AALNSAVF+DGSFVYIPKGVRCPMELS+YFRIN   TGQFERTLI+AD+ SY
Sbjct: 173 VPYRDNYSAALNSAVFSDGSFVYIPKGVRCPMELSSYFRINAINTGQFERTLIVADDDSY 232

Query: 241 VSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGD 300
           VSYLEGCTAP RDENQLHAAVVE+V LDNAE+KYSTVQNWYPGD  GKGG+ N VTKRG+
Sbjct: 233 VSYLEGCTAPMRDENQLHAAVVEIVVLDNAEVKYSTVQNWYPGDENGKGGVLNLVTKRGE 292

Query: 301 CRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAK 360
            RG+ SK+SWTQ+ETGSAITWKYPSC+L+G+