RPS-BLAST 2.2.22 [Sep-27-2009]

Database: CddA 
           21,609 sequences; 6,263,737 total letters

Searching..................................................done

Query= gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator
complex subunit SufB [Candidatus Liberibacter asiaticus str. psy62]
         (489 letters)



>gnl|CDD|177024 CHL00085, ycf24, putative ABC transporter.
          Length = 485

 Score =  805 bits (2082), Expect = 0.0
 Identities = 314/480 (65%), Positives = 387/480 (80%), Gaps = 5/480 (1%)

Query: 10  KVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMK 69
            + K+    YKYGF T I+ ++ PKGLNEDI+R IS KKNEP ++L +RL AY++W  MK
Sbjct: 11  NLTKLVNQPYKYGFSTLIETERLPKGLNEDIVRLISKKKNEPIFLLIFRLKAYKKWKKMK 70

Query: 70  DPSWARIRYPAIDFDDLYYYAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQ 129
           +P WA ++YP ID+ D+ YY+APK      SLD+VDPELL T+EKLGI + EQ+ LA   
Sbjct: 71  EPDWAFLKYPEIDYQDISYYSAPKLKKKLNSLDEVDPELLDTFEKLGISLNEQKRLA--- 127

Query: 130 TSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYA 189
              VAVDAVFDSVS+ TTFKEEL K+GVIF  ISEAI ++P+L+KKYL +VVP+GDN++A
Sbjct: 128 --NVAVDAVFDSVSIGTTFKEELAKAGVIFCSISEAIQKYPELIKKYLGSVVPIGDNYFA 185

Query: 190 ALNSAVFTDGSFVYIPKGVRCPMELSTYFRINEKGTGQFERTLIIADEGSYVSYLEGCTA 249
           ALNSAVF+DGSF YIPK  +CP+ELSTYFRIN + +GQFERTLIIA+E SYVSYLEGCTA
Sbjct: 186 ALNSAVFSDGSFCYIPKDTKCPLELSTYFRINNEESGQFERTLIIAEENSYVSYLEGCTA 245

Query: 250 PQRDENQLHAAVVELVALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKIS 309
           PQ D NQLHAAVVEL+AL+NAEIKYSTVQNWY GD  G+GGIYNFVTKRG C G  SKIS
Sbjct: 246 PQYDTNQLHAAVVELIALENAEIKYSTVQNWYAGDENGEGGIYNFVTKRGLCAGKNSKIS 305

Query: 310 WTQLETGSAITWKYPSCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSK 369
           WTQ+ETGSAITWKYPSC+L G+ S GEFYS+A++N +QQ D+GTKM+H+ KNT SRI+SK
Sbjct: 306 WTQVETGSAITWKYPSCILIGDNSQGEFYSVALTNNYQQADTGTKMIHIGKNTKSRIISK 365

Query: 370 GISAGFSNNTYRGKVSVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEA 429
           GISAG S N+YRG V +   A +SRN++QCDSLLIGN   A+T PYI+ +NS+  +EHEA
Sbjct: 366 GISAGKSKNSYRGLVKIGPKALNSRNYSQCDSLLIGNKSQANTFPYIQVQNSTAKIEHEA 425

Query: 430 TTSKISDEHLFYCLQRGIPEEAAIALIVNGFVREVLQKLPMEFAVEAQKLIDISLEGSVG 489
           +TSKI +E LFY LQRGI  E AI+L+++GF ++V  KLPMEFA+EA +L+ + LEGSVG
Sbjct: 426 STSKIGEEQLFYFLQRGINLEEAISLLISGFCKDVFNKLPMEFALEADRLLSLKLEGSVG 485


>gnl|CDD|31063 COG0719, SufB, ABC-type transport system involved in Fe-S cluster
           assembly, permease component [Posttranslational
           modification, protein turnover, chaperones].
          Length = 412

 Score =  430 bits (1106), Expect = e-121
 Identities = 188/452 (41%), Positives = 256/452 (56%), Gaps = 44/452 (9%)

Query: 40  IIRFISAKKNEPDWMLEWRLLAYRRWLTMKDP-SWA-RIRYPAIDFDDLYYYAAPKSIVG 97
           +I  ISA+K+EP+WML  RL A R    ++ P     R     +DF D  YY AP     
Sbjct: 1   MIELISARKDEPEWMLALRLKALRASPDLEMPEVPTRRDELWELDFLDRLYYLAPGEA-- 58

Query: 98  PQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGV 157
                        ++++LGIP  E+            V A  DSV V      EL   GV
Sbjct: 59  -------------SFKRLGIPDAEE------------VLAQCDSVVVYHAVSGELAPEGV 93

Query: 158 IFMPISEAICEHPDLVKKYL-STVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMELST 216
           I   I +   EHPDLVKKY    VVP  D+ +AALN+A+F+DG+F+Y+PKGV  P  +  
Sbjct: 94  IVEDILK---EHPDLVKKYFGKGVVPDDDDKFAALNAALFSDGTFIYVPKGVEVPTPIQL 150

Query: 217 YFRINEKGTG-QFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYS 275
           YF IN + TG QFERTLII +EG+ ++ +EGC+AP      LH  VVE+   +NA + Y+
Sbjct: 151 YFIINGENTGVQFERTLIIVEEGAEITVIEGCSAP-VGSGSLHNGVVEIFVGENASLTYT 209

Query: 276 TVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCG 335
           TVQNW P        +YN +TKR       + + WTQ+  GS +T KYPS  L+GE + G
Sbjct: 210 TVQNWSP--------VYNHLTKRAAVEEEDATVRWTQVTLGSKVTRKYPSVRLKGEGADG 261

Query: 336 EFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRN 395
           E  S+A + G Q +D GTKM+H   NT S I+SKGI    +   +RG + + +GA  S  
Sbjct: 262 ELLSVAFAGGGQHMDVGTKMIHNGPNTRSNILSKGIVKDGARTVFRGLIDIRKGATGSDA 321

Query: 396 FTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIAL 455
           + +C +LL+ ++  A T+P +E +       HEAT  +I +E LFY + RG+ EE A  L
Sbjct: 322 YQECRTLLLSDDARADTVPILEIETDDVKAGHEATVGRIDEEQLFYLMSRGLSEEEAKRL 381

Query: 456 IVNGFVREVLQKLPMEFAVEAQKLIDISLEGS 487
           IV GF+ EV+++LP E AVE Q LI I LEGS
Sbjct: 382 IVRGFLEEVIEELPEE-AVEEQLLIFIELEGS 412


>gnl|CDD|144885 pfam01458, UPF0051, Uncharacterized protein family (UPF0051). 
          Length = 230

 Score =  211 bits (539), Expect = 4e-55
 Identities = 76/239 (31%), Positives = 119/239 (49%), Gaps = 9/239 (3%)

Query: 222 EKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNAEIKYSTVQNWY 281
           E G  QF R LII +EG+ V+ +EGC +P    + LH  V E++  + A +KY+ +QN  
Sbjct: 1   ESGGAQFPRNLIIVEEGAEVTIIEGCASP-GAGDGLHNGVTEIIVGEGARLKYTKIQNE- 58

Query: 282 PGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRGEQSCGEFYSIA 341
                   G  +F T R       + +  T +  G  ++   P   L GE +  E   + 
Sbjct: 59  ------GKGSIHFATTRVRL-EEDATLESTSVSLGGKLSRNDPDVDLNGEGAEAELNGVY 111

Query: 342 ISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGAAHSRNFTQCDS 401
           ++ G Q +D+ TK+ H   NT SRI+ KG+    S   +RGK+ V +GA  +    +C +
Sbjct: 112 LAKGDQHVDTHTKVRHNGPNTRSRILYKGVLKDRSRGVFRGKIKVEKGAQKTDGHQECRN 171

Query: 402 LLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEEAAIALIVNGF 460
           LL+ +     T P +E         H AT  ++ +E LFY + RG+ EE A  L++ GF
Sbjct: 172 LLLSDKARVDTKPELEIYADDVKCSHGATVGQLDEEQLFYLMSRGLSEEEAKRLLIRGF 230


>gnl|CDD|147745 pfam05760, IER, Immediate early response protein (IER).  This
           family consists of several eukaryotic immediate early
           response (IER) 2 and 5 proteins. The role of IER5 is
           unclear although it play an important role in mediating
           the cellular response to mitogenic signals. Again,
           little is known about the function of IER2 although it
           is thought to play a role in mediating the cellular
           responses to a variety of extracellular signals.
          Length = 272

 Score = 30.3 bits (68), Expect = 1.2
 Identities = 10/15 (66%), Positives = 13/15 (86%)

Query: 470 MEFAVEAQKLIDISL 484
           ME A+EAQ++I ISL
Sbjct: 1   MECALEAQRIISISL 15


>gnl|CDD|36342 KOG1127, KOG1127, KOG1127, TPR repeat-containing protein [RNA
          processing and modification].
          Length = 1238

 Score = 27.3 bits (60), Expect = 8.5
 Identities = 17/61 (27%), Positives = 26/61 (42%), Gaps = 2/61 (3%)

Query: 6  ETVDKVRKIDVDQYKYGFETNIQVDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLA--YR 63
          E   KV K D D Y       + +    + L +    ++ A K +PD +L W+ L   Y 
Sbjct: 23 EQSKKVLKEDPDNYNAQVFLGVALWSLGQDLEKAAEHYVLAAKLDPDNLLAWKGLGNLYE 82

Query: 64 R 64
          R
Sbjct: 83 R 83


  Database: CddA
    Posted date:  Feb 4, 2011  9:38 PM
  Number of letters in database: 6,263,737
  Number of sequences in database:  21,609
  
Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0598    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 21609
Number of Hits to DB: 5,897,178
Number of extensions: 314201
Number of successful extensions: 693
Number of sequences better than 10.0: 1
Number of HSP's gapped: 684
Number of HSP's successfully gapped: 12
Length of query: 489
Length of database: 6,263,737
Length adjustment: 98
Effective length of query: 391
Effective length of database: 4,146,055
Effective search space: 1621107505
Effective search space used: 1621107505
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 59 (26.8 bits)