RPSBLAST alignment of GI: 254781059 and MMDB domain: 1vh4_A_

>1vh4_A (A:) SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli}Length = 435
 Score =  394 bits (1014), Expect = e-111
 Identities = 72/469 (15%), Positives = 147/469 (31%), Gaps = 52/469 (11%)

Query: 29  VDKAPKGLNEDIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYY 88
           +       +  + ++    + E            ++ L    P+            + + 
Sbjct: 2   LMAGLPNSSNALQQWHHLFEAEGTKRSPQAQQHLQQLLRTGLPTR---------KHENWK 52

Query: 89  YAAPKSIVGPQSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFDSVSVVTTF 148
           Y   + ++  Q +        +  + L + +    +        V VD  +         
Sbjct: 53  YTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRL--------VFVDGRYVPA------ 98

Query: 149 KEELKKSGVIFMPISEAICEHPDLVKKYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGV 208
             +  +     + I++     P            +    +  L  ++    + + + +G 
Sbjct: 99  LSDATEGSGYEVSINDDRQGLP----------DAIQAEVFLHLTESLAQSVTHIAVKRGQ 148

Query: 209 RCPMELSTYF----RINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVEL 264
           R    L           E+      R  +   EG+  + +E   +   D      A   +
Sbjct: 149 RPAKPLLLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSL-NDARHFTGARFTI 207

Query: 265 VALDNAEIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYP 324
               NA +++  +              ++F           +         G A+     
Sbjct: 208 NVAANAHLQHIKLAFE-------NPLSHHFAHNDLLL-AEDATAFSHSFLLGGAVLRHNT 259

Query: 325 SCLLRGEQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKV 384
           S  L GE S     S+A+    +  D+ T + H      SR + K I +      + G +
Sbjct: 260 STQLNGENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLI 319

Query: 385 SVHRGAAHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQ 444
           +V + A  +      ++LL+G      T P +E         H AT  +I DE +FY   
Sbjct: 320 NVAQHAIKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRS 379

Query: 445 RGIPEEAAIALIVNGFVREVLQKLPME------FAVEAQKLIDISLEGS 487
           RGI ++ A  +I+  F  E+ + L  E       A   Q+L   + EG 
Sbjct: 380 RGINQQDAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGGAREGG 428