RPSBLAST alignment of GI: 254781059 and protein with PDBid: 1vh4

>1vh4_A SUFD protein; structural genomics, protein binding protein; 1.75A {Escherichia coli} SCOP: b.80.6.1 PDB: 2zu0_A* Length = 435
 Score =  174 bits (440), Expect = 6e-44
 Identities = 73/403 (18%), Positives = 133/403 (33%), Gaps = 33/403 (8%)

Query: 109 LRTYEKLGIPIREQEI-----LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMP-- 161
           L+   + G+P R+ E      L G+  S+    A   S          L    ++F+   
Sbjct: 35  LQQLLRTGLPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGR 94

Query: 162 ISEAICEHPDLVK-------KYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMEL 214
              A+ +  +                  +    +  L  ++    + + + +G R    L
Sbjct: 95  YVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPL 154

Query: 215 STYF----RINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNA 270
                      E+      R  +   EG+  + +E   +          A   +    NA
Sbjct: 155 LLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLNDA-RHFTGARFTINVAANA 213

Query: 271 EIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRG 330
            +++  +    P          +            +         G A+     S  L G
Sbjct: 214 HLQHIKLAFENPL--------SHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNG 265

Query: 331 EQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGA 390
           E S     S+A+    +  D+ T + H      SR + K I +      + G ++V + A
Sbjct: 266 ENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHA 325

Query: 391 AHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEE 450
             +      ++LL+G      T P +E         H AT  +I DE +FY   RGI ++
Sbjct: 326 IKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQ 385

Query: 451 AAIALIVNGFVREVLQKLPME------FAVEAQKLIDISLEGS 487
            A  +I+  F  E+ + L  E       A   Q+L   + EG 
Sbjct: 386 DAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPGGAREGG 428