RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254781059|ref|YP_003065472.1| cysteine desulfurase activator
complex subunit SufB [Candidatus Liberibacter asiaticus str. psy62]
         (489 letters)



>d1vh4a_ b.80.6.1 (A:) Stabilizer of iron transporter SufD
           {Escherichia coli [TaxId: 562]}
          Length = 413

 Score =  162 bits (410), Expect = 6e-41
 Identities = 72/397 (18%), Positives = 131/397 (32%), Gaps = 28/397 (7%)

Query: 109 LRTYEKLGIPIREQEI-----LAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMP-- 161
           L+   + G+P R+ E      L G+  S+    A   S          L    ++F+   
Sbjct: 25  LQQLLRTGLPTRKHENWKYTPLEGLINSQFVSIAGEISPQQRDALALTLDSVRLVFVDGR 84

Query: 162 ISEAICEHPDLVK-------KYLSTVVPVGDNFYAALNSAVFTDGSFVYIPKGVRCPMEL 214
              A+ +  +                  +    +  L  ++    + + + +G R    L
Sbjct: 85  YVPALSDATEGSGYEVSINDDRQGLPDAIQAEVFLHLTESLAQSVTHIAVKRGQRPAKPL 144

Query: 215 STYF----RINEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQLHAAVVELVALDNA 270
                      E+      R  +   EG+  + +E   +   D      A   +    NA
Sbjct: 145 LLMHITQGVAGEEVNTAHYRHHLDLAEGAEATVIEHFVSLN-DARHFTGARFTINVAANA 203

Query: 271 EIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLETGSAITWKYPSCLLRG 330
            +++  +    P          +            +         G A+     S  L G
Sbjct: 204 HLQHIKLAFENPL--------SHHFAHNDLLLAEDATAFSHSFLLGGAVLRHNTSTQLNG 255

Query: 331 EQSCGEFYSIAISNGFQQIDSGTKMLHLAKNTTSRIVSKGISAGFSNNTYRGKVSVHRGA 390
           E S     S+A+    +  D+ T + H      SR + K I +      + G ++V + A
Sbjct: 256 ENSTLRINSLAMPVKNEVCDTRTWLEHNKGFCNSRQLHKTIVSDKGRAVFNGLINVAQHA 315

Query: 391 AHSRNFTQCDSLLIGNNCGAHTIPYIESKNSSCNLEHEATTSKISDEHLFYCLQRGIPEE 450
             +      ++LL+G      T P +E         H AT  +I DE +FY   RGI ++
Sbjct: 316 IKTDGQMTNNNLLMGKLAEVDTKPQLEIYADDVKCSHGATVGRIDDEQIFYLRSRGINQQ 375

Query: 451 AAIALIVNGFVREVLQKLPMEFAVEA-QKLIDISLEG 486
            A  +I+  F  E+ + L  E   +     I   L G
Sbjct: 376 DAQQMIIYAFAAELTEALRDEGLKQQVLARIGQRLPG 412


>d1peqa2 c.7.1.2 (A:175-699) R1 subunit of ribonucleotide reductase,
           C-terminal domain {Salmonella typhimurium [TaxId:
           90371]}
          Length = 525

 Score = 32.6 bits (73), Expect = 0.067
 Identities = 13/102 (12%), Positives = 30/102 (29%)

Query: 39  DIIRFISAKKNEPDWMLEWRLLAYRRWLTMKDPSWARIRYPAIDFDDLYYYAAPKSIVGP 98
           DI+RF+  K+   D  +  + L+    +       A+       F             G 
Sbjct: 91  DILRFLDTKRENADEKIRIKTLSLGVVIPDITFRLAKENAQMALFSPYDIQRRYGKPFGD 150

Query: 99  QSLDDVDPELLRTYEKLGIPIREQEILAGVQTSKVAVDAVFD 140
            ++ +   EL+         I  ++    +   +      + 
Sbjct: 151 IAISERYDELIADPHVRKTYINARDFFQTLAEIQFESGYPYI 192


>d1qf6a4 d.104.1.1 (A:242-532) Threonyl-tRNA synthetase (ThrRS)
           {Escherichia coli [TaxId: 562]}
          Length = 291

 Score = 27.3 bits (60), Expect = 3.2
 Identities = 18/145 (12%), Positives = 30/145 (20%), Gaps = 9/145 (6%)

Query: 199 GSFVYIPKGVRCPMELSTYFR-INEKGTGQFERTLIIADEGSYVSYLEGCTAPQRDENQL 257
           G   +   G     EL  + R   ++   Q  +   + D   +     G     +D    
Sbjct: 21  GMVFWHNDGWTIFRELEVFVRSKLKEYQYQEVKGPFMMDRVLW--EKTGHWDNYKDAMFT 78

Query: 258 HAAVVELVALDNA--EIKYSTVQNWYPGDSQGKGGIYNFVTKRGDCRGMRSKISWTQLET 315
            ++      +                         +  F    G C       S   L  
Sbjct: 79  TSSENREYCIKPMNCPGHVQIFNQGLKSYRDLPLRMAEF----GSCHRNEPSGSLHGLMR 134

Query: 316 GSAITWKYPSCLLRGEQSCGEFYSI 340
               T          EQ   E    
Sbjct: 135 VRGFTQDDAHIFCTEEQIRDEVNGC 159


>d1t62a_ b.122.1.4 (A:) Hypothetical protein EF3133 {Enterococcus
           faecalis [TaxId: 1351]}
          Length = 166

 Score = 26.3 bits (58), Expect = 5.8
 Identities = 10/29 (34%), Positives = 15/29 (51%)

Query: 148 FKEELKKSGVIFMPISEAICEHPDLVKKY 176
           FKEEL    + F P    +C+  ++V  Y
Sbjct: 124 FKEELAPYQLQFYPDMLLVCQSFEVVDLY 152


>d2e2dc1 b.40.3.1 (C:1001-1180) TIMP-2 {Cow (Bos taurus) [TaxId:
           9913]}
          Length = 180

 Score = 26.1 bits (57), Expect = 6.7
 Identities = 11/67 (16%), Positives = 25/67 (37%), Gaps = 3/67 (4%)

Query: 116 GIPIREQEILAGVQTSKVAVDAVFDSVSVVTTFKEELKKSGVIFMPISEAIC-EHPDLVK 174
              + ++E+ +G       +  +   +  +  FK   +    I+   + A+C    D+  
Sbjct: 21  AKAVNKKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPDQDIEFIYTAPAAAVCGVSLDIGG 80

Query: 175 K--YLST 179
           K  YL  
Sbjct: 81  KKEYLIA 87


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.318    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0577    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 1,855,961
Number of extensions: 89659
Number of successful extensions: 200
Number of sequences better than 10.0: 1
Number of HSP's gapped: 200
Number of HSP's successfully gapped: 10
Length of query: 489
Length of database: 2,407,596
Length adjustment: 89
Effective length of query: 400
Effective length of database: 1,185,626
Effective search space: 474250400
Effective search space used: 474250400
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 55 (25.3 bits)