BLAST/PSIBLAST alignment of GI: 254781060 and GI: 222148790 at iteration 1
>gi|222148790|ref|YP_002549747.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium vitis S4] Length = 251
>gi|221735776|gb|ACM36739.1| ABC transporter nucleotide binding/ATPase protein [Agrobacterium vitis S4] Length = 251
 Score =  375 bits (962), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 181/249 (72%), Positives = 208/249 (83%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           MLEI+NL A+I +  TEIIRGLNL V+  EV AIMGPNGSGKSTLSY+LSG  DYE+T G
Sbjct: 1   MLEIRNLHARIAEDGTEIIRGLNLTVKAGEVAAIMGPNGSGKSTLSYILSGRSDYEVTEG 60

Query: 61  DILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIP 120
           +ILY GESIL+    ERA+KGIFLAFQYPVEIPG+  MQFLK+A+NEQRKAR E EL  P
Sbjct: 61  EILYNGESILELDPAERAAKGIFLAFQYPVEIPGVATMQFLKVAMNEQRKARGEAELTTP 120

Query: 121 DFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDI 180
           DF R+V++   EL IN DMLKRPLN+GFSGGEKK AEILQM LL P LCILDETDSGLDI
Sbjct: 121 DFIRRVKEAAGELKINPDMLKRPLNVGFSGGEKKRAEILQMALLAPQLCILDETDSGLDI 180

Query: 181 DALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTGDYSIALDLEE 240
           DALKI A GVNAL+S DR+ ++ITHYQRLL+YI PDT+HVL+ G+IIKTGD S+ALDLE 
Sbjct: 181 DALKIVADGVNALKSPDRATIVITHYQRLLDYIVPDTVHVLYKGQIIKTGDKSLALDLEA 240

Query: 241 NGYAELIKE 249
           NGYA++I E
Sbjct: 241 NGYADIIGE 249