RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR00960

>gnl|CDD|130034 TIGR00960, 3a0501s02, Type II (General) Secretory Pathway (IISP) Family protein. Length = 216
 Score = 40.1 bits (94), Expect = 5e-04
 Identities = 17/69 (24%), Positives = 33/69 (47%), Gaps = 2/69 (2%)

Query: 1  MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
          M+  + +           +  LN  +   E+V ++G +G+GKST   L+ G +  + T G
Sbjct: 1  MIRFEQVSKAYPGGHQPALDNLNFHITKGEMVFLVGHSGAGKSTFLKLILGIE--KPTRG 58

Query: 61 DILYKGESI 69
           I + G+ +
Sbjct: 59 KIRFNGQDL 67