RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR02314

>gnl|CDD|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein. Members of this family are the ATP-binding protein of the D-methionine ABC transporter complex. Known members belong to the Proteobacteria. Length = 343
 Score = 41.4 bits (97), Expect = 2e-04
 Identities = 60/243 (24%), Positives = 112/243 (46%), Gaps = 27/243 (11%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGL---NLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           M+++ N+  K+    T+ I+ L   +L V   ++  ++G +G+GKSTL   ++  +    
Sbjct: 1   MIKLSNI-TKVFHQGTKTIQALNNVSLHVPAGQIYGVIGASGAGKSTLIRCVNLLE--RP 57

Query: 58  TAGDILYKGESILDWSIVE--RASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEK 115
           T+G ++  G+ +   S  E  +A + I + FQ+   +    +   + + L      ++E 
Sbjct: 58  TSGSVIVDGQDLTTLSNSELTKARRQIGMIFQHFNLLSSRTVFGNVALPLELDNTPKDEI 117

Query: 116 ELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETD 175
           +       RKV ++ A +G+       P NL  SGG+K+   I +     P + + DE  
Sbjct: 118 K-------RKVTELLALVGLGDKHDSYPSNL--SGGQKQRVAIARALASNPKVLLCDEAT 168

Query: 176 SGLDIDALKIAAQGVNAL-----RSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
           S LD        Q +  L     R    + L+ITH   ++  I  D + V+ NG++I+ G
Sbjct: 169 SALD----PATTQSILELLKEINRRLGLTILLITHEMDVVKRI-CDCVAVISNGELIEQG 223

Query: 231 DYS 233
             S
Sbjct: 224 TVS 226