RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR02633

>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein. Several bacterial species have enzymes xylose isomerase and xylulokinase enzymes for xylose utilization. Members of this protein family are the ATP-binding cassette (ABC) subunit of the known or predicted high-affinity xylose ABC transporter for xylose import. These genes, which closely resemble other sugar transport ABC transporter genes, typically are encoded near xylose utilization enzymes and regulatory proteins. Note that this form of the transporter contains two copies of the ABC transporter domain (pfam00005). Length = 500
 Score = 71.8 bits (176), Expect = 1e-13
 Identities = 67/242 (27%), Positives = 117/242 (48%), Gaps = 25/242 (10%)

Query: 1   MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSG---HKDYEI 57
           +LE+K +         + + G++L+V P E V + G NG+GKSTL  +LSG   H  ++ 
Sbjct: 1   LLEMKGIVKTF--GGVKALDGIDLEVRPGECVGLCGENGAGKSTLMKILSGVYPHGTWD- 57

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQ--FL--KIALNEQRKARN 113
             G+I + G  +   +I +    GI +  Q    +P + + +  FL  +I L   R A N
Sbjct: 58  --GEIYWSGSPLKASNIRDTERAGIVIIHQELTLVPELSVAENIFLGNEITLPGGRMAYN 115

Query: 114 EKELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDE 173
                      + + +  EL ++ D + RP+   + GG++++ EI +    +  L ILDE
Sbjct: 116 A-------MYLRAKNLLRELQLDADNVTRPVG-DYGGGQQQLVEIAKALNKQARLLILDE 167

Query: 174 TDSGLDIDALKIAAQGVNALRSQDRSFLIITHYQRLLNYIKP--DTIHVLHNGKIIKTGD 231
             S L     +I    +  L++   + + I+H    LN +K   DTI V+ +G+ + T D
Sbjct: 168 PSSSLTEKETEILLDIIRDLKAHGVACVYISHK---LNEVKAVCDTICVIRDGQHVATKD 224

Query: 232 YS 233
            S
Sbjct: 225 MS 226