RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR02673

>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE. This model describes FtsE, a member of the ABC transporter ATP-binding protein family. This protein, and its permease partner FtsX, localize to the division site. In a number of species, the ftsEX gene pair is located next to FtsY, the signal recognition particle-docking protein. Length = 214
 Score = 41.9 bits (99), Expect = 2e-04
 Identities = 19/72 (26%), Positives = 34/72 (47%), Gaps = 5/72 (6%)

Query: 1  MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI-TA 59
          M+E  N+ +K        +  ++L +   E + + GP+G+GK+TL  LL G       + 
Sbjct: 1  MIEFHNV-SKAYPGGVAALHDVSLHIRKGEFLFLTGPSGAGKTTLLKLLYG---ALTPSR 56

Query: 60 GDILYKGESILD 71
          G +   GE +  
Sbjct: 57 GQVRIAGEDVNR 68