RPSBLAST alignment for GI: 254781060 and conserved domain: TIGR03864

>gnl|CDD|163576 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system. Members of this protein family are the ATP-binding subunit of an ABC transporter system that is associated with PQQ biosynthesis and PQQ-dependent alcohol dehydrogenases. While this family shows homology to several efflux ABC transporter subunits, the presence of a periplasmic substrate-binding protein and association with systems for catabolism of alcohols suggests a role in import rather than detoxification. Length = 236
 Score = 63.5 bits (155), Expect = 4e-11
 Identities = 64/225 (28%), Positives = 94/225 (41%), Gaps = 40/225 (17%)

Query: 19  IRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERA 78
           +  ++  V P E VA++GPNG+GKSTL  LL+    Y    G I   G  +       R 
Sbjct: 17  LDDVSFTVRPGEFVALLGPNGAGKSTLFSLLTRL--YVAQEGQISVAGHDL-------RR 67

Query: 79  SKGIFLA-----FQYPVEIPGIIMMQFLKI--ALN----EQRKARNEKELLIPDFTRKVR 127
           +    LA     FQ P     + + Q L+   AL+     + + R    L       +  
Sbjct: 68  APRAALARLGVVFQQPTLDLDLSVRQNLRYHAALHGLSRAEARERIAALLARLGLAERAD 127

Query: 128 KITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAA 187
               EL               +GG ++  EI +  L  P+L +LDE   GLD  +     
Sbjct: 128 DKVREL---------------NGGHRRRVEIARALLHRPALLLLDEPTVGLDPASRAAIV 172

Query: 188 QGVNAL-RSQDRSFLIITHYQRLLNYIKP-DTIHVLHNGKIIKTG 230
             V AL R Q  S L  TH   L++ I+  D + VLH G+++  G
Sbjct: 173 AHVRALCRDQGLSVLWATH---LVDEIEADDRLVVLHRGRVLADG 214