RPSBLAST alignment for GI: 254781060 and conserved domain: PRK14245

>gnl|CDD|172733 PRK14245, PRK14245, phosphate ABC transporter ATP-binding protein; Provisional. Length = 250
 Score = 57.3 bits (138), Expect = 4e-09
 Identities = 51/198 (25%), Positives = 91/198 (45%), Gaps = 16/198 (8%)

Query: 15  DTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDY---EITAGDILYKGESILD 71
           D   ++G+++++E   VVA +GP+G GKST   L +   D        G+I   G +I D
Sbjct: 15  DFHALKGISMEIEEKSVVAFIGPSGCGKSTFLRLFNRMNDLIPATRLEGEIRIDGRNIYD 74

Query: 72  WSI-VERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKIT 130
             + V+   K + + FQ P   P  I   F  +A   +     +       F R+  + T
Sbjct: 75  KGVQVDELRKNVGMVFQRPNPFPKSI---FENVAYGLRVNGVKDNA-----FIRQRVEET 126

Query: 131 AELGINMDMLKRPLN---LGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKIAA 187
            +     D +K  L       SGG+++   I +   + PS+ ++DE  S LD  +     
Sbjct: 127 LKGAALWDEVKDKLKESAFALSGGQQQRLCIARAMAVSPSVLLMDEPASALDPISTAKVE 186

Query: 188 QGVNALRSQDRSFLIITH 205
           + ++ L+ +D + +I+TH
Sbjct: 187 ELIHELK-KDYTIVIVTH 203