RPSBLAST alignment for GI: 254781060 and conserved domain: PRK10575

>gnl|CDD|182561 PRK10575, PRK10575, iron-hydroxamate transporter ATP-binding subunit; Provisional. Length = 265
 Score = 47.1 bits (112), Expect = 4e-06
 Identities = 65/228 (28%), Positives = 99/228 (43%), Gaps = 44/228 (19%)

Query: 22  LNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSIVERASKG 81
           L+L     +V  ++G NGSGKSTL  +L  H+    + G+IL   + +  WS    A K 
Sbjct: 30  LSLTFPAGKVTGLIGHNGSGKSTLLKMLGRHQ--PPSEGEILLDAQPLESWSSKAFARKV 87

Query: 82  IFLAFQYPVEIPGIIMMQFLKI-------ALNEQRKARNEKELLIPDFTRKVRKITAELG 134
            +L  Q P    G+ + + + I       AL   R    ++E        KV +  + +G
Sbjct: 88  AYLPQQLP-AAEGMTVRELVAIGRYPWHGALG--RFGAADRE--------KVEEAISLVG 136

Query: 135 INMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLC-ILDETDSGLDIDALKIAAQGVNAL 193
           +    L   L    SGGE++ A I  M + + S C +LDE  S LDI      A  V+ L
Sbjct: 137 LK--PLAHRLVDSLSGGERQRAWI-AMLVAQDSRCLLLDEPTSALDI------AHQVDVL 187

Query: 194 R-----SQDRSFLIITHYQRLLNYIKP-----DTIHVLHNGKIIKTGD 231
                 SQ+R   +I     +L+ I       D +  L  G++I  G 
Sbjct: 188 ALVHRLSQERGLTVIA----VLHDINMAARYCDYLVALRGGEMIAQGT 231