RPSBLAST alignment for GI: 254781060 and conserved domain: PRK10790

>gnl|CDD|182733 PRK10790, PRK10790, putative multidrug transporter membrane\ATP-binding components; Provisional. Length = 592
 Score = 58.2 bits (141), Expect = 2e-09
 Identities = 63/225 (28%), Positives = 107/225 (47%), Gaps = 26/225 (11%)

Query: 13  DTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDW 72
             D  +++ +NL V     VA++G  GSGKSTL+ LL G+  Y +T G+I   G  +   
Sbjct: 351 RDDNLVLQNINLSVPSRGFVALVGHTGSGKSTLASLLMGY--YPLTEGEIRLDGRPLSSL 408

Query: 73  S-IVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITA 131
           S  V R  +G+ +  Q PV +          + L      R+  E  +      V+   A
Sbjct: 409 SHSVLR--QGVAMVQQDPVVLADTF---LANVTL-----GRDISEEQVWQALETVQ--LA 456

Query: 132 EL------GINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLDIDALKI 185
           EL      G+   + ++  NL  S G+K++  + ++ +  P + ILDE  + +D    + 
Sbjct: 457 ELARSLPDGLYTPLGEQGNNL--SVGQKQLLALARVLVQTPQILILDEATANIDSGTEQA 514

Query: 186 AAQGVNALRSQDRSFLIITHYQRLLNYIKPDTIHVLHNGKIIKTG 230
             Q + A+R    + ++I H  RL   ++ DTI VLH G+ ++ G
Sbjct: 515 IQQALAAVREHT-TLVVIAH--RLSTIVEADTILVLHRGQAVEQG 556