RPSBLAST alignment for GI: 254781060 and conserved domain: PRK11650

>gnl|CDD|183258 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional. Length = 356
 Score = 52.5 bits (127), Expect = 1e-07
 Identities = 31/93 (33%), Positives = 55/93 (59%), Gaps = 10/93 (10%)

Query: 1  MLEIKNLRAKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAG 60
           L+++ +R K  D  T++I+G++L V   E + ++GP+G GKSTL  +++G +   IT+G
Sbjct: 3  GLKLQAVR-KSYDGKTQVIKGIDLDVADGEFIVLVGPSGCGKSTLLRMVAGLE--RITSG 59

Query: 61 DILYKGESILDWSIVERASKGIFLAFQ----YP 89
          +I   G  + +   +E A + I + FQ    YP
Sbjct: 60 EIWIGGRVVNE---LEPADRDIAMVFQNYALYP 89