RPSBLAST alignment for GI: 254781060 and conserved domain: PRK13637

>gnl|CDD|184197 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 287
 Score = 54.3 bits (131), Expect = 3e-08
 Identities = 50/162 (30%), Positives = 79/162 (48%), Gaps = 15/162 (9%)

Query: 22  LNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITAGDILYKGESILDWSI-VERASK 80
           +N+++E  E V ++G  GSGKSTL   L+G    + T+G I+  G  I D  + +    K
Sbjct: 26  VNIEIEDGEFVGLIGHTGSGKSTLIQHLNGL--LKPTSGKIIIDGVDITDKKVKLSDIRK 83

Query: 81  GIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKITAELGINMDML 140
            + L FQYP E           IA        +E+E+       +V++    +G++ +  
Sbjct: 84  KVGLVFQYP-EYQLFEETIEKDIAFGPINLGLSEEEI-----ENRVKRAMNIVGLDYEDY 137

Query: 141 KRPLNLGFSGGEKK---IAEILQMRLLEPSLCILDETDSGLD 179
           K       SGG+K+   IA ++ M   EP + ILDE  +GLD
Sbjct: 138 KDKSPFELSGGQKRRVAIAGVVAM---EPKILILDEPTAGLD 176