RPSBLAST alignment for GI: 254781060 and conserved domain: PRK13650

>gnl|CDD|184209 PRK13650, cbiO, cobalt transporter ATP-binding subunit; Provisional. Length = 279
 Score = 46.6 bits (111), Expect = 6e-06
 Identities = 64/238 (26%), Positives = 109/238 (45%), Gaps = 35/238 (14%)

Query: 1   MLEIKNLRAKIVDTDTE--IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEIT 58
           ++E+KNL  K    D E   +  ++  V+  E ++I+G NGSGKST   L+ G  + E  
Sbjct: 4   IIEVKNLTFK-YKEDQEKYTLNDVSFHVKQGEWLSIIGHNGSGKSTTVRLIDGLLEAE-- 60

Query: 59  AGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFL------KIALNEQRKAR 112
           +G I+  G+ + + ++ +   K I + FQ P         QF+       +A   + K  
Sbjct: 61  SGQIIIDGDLLTEENVWDIRHK-IGMVFQNPDN-------QFVGATVEDDVAFGLENKGI 112

Query: 113 NEKELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKK---IAEILQMRLLEPSLC 169
             +E+       +V +    +G+     + P  L  SGG+K+   IA  + MR   P + 
Sbjct: 113 PHEEM-----KERVNEALELVGMQDFKEREPARL--SGGQKQRVAIAGAVAMR---PKII 162

Query: 170 ILDETDSGLDIDALKIAAQGVNALRSQDRSFLI-ITHYQRLLNYIKPDTIHVLHNGKI 226
           ILDE  S LD +      + +  +R   +  +I ITH   L      D + V+ NG++
Sbjct: 163 ILDEATSMLDPEGRLELIKTIKGIRDDYQMTVISITH--DLDEVALSDRVLVMKNGQV 218