RPSBLAST alignment for GI: 254781060 and conserved domain: PRK14241

>gnl|CDD|184587 PRK14241, PRK14241, phosphate transporter ATP-binding protein; Provisional. Length = 258
 Score = 45.9 bits (109), Expect = 1e-05
 Identities = 59/201 (29%), Positives = 96/201 (47%), Gaps = 35/201 (17%)

Query: 22  LNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEITA-----GDILYKGESILDWSI-- 74
           +NL +EP  V A +GP+G GKST   L + ++ +E+       G++L  GE +    +  
Sbjct: 23  VNLNIEPRSVTAFIGPSGCGKST--VLRTLNRMHEVIPGARVEGEVLLDGEDLYGPGVDP 80

Query: 75  --VERASKGIFLAFQYPVEIPGIIMMQ--FLKIALNEQRKARNEKELLIPDFTRKVRKIT 130
             V R    I + FQ P   P + +       + LN  R  ++  EL+     + +R   
Sbjct: 81  VAVRRT---IGMVFQRPNPFPTMSIRDNVVAGLKLNGVRNKKDLDELV----EKSLR--- 130

Query: 131 AELGINM-----DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD-IDALK 184
              G N+     D L +P   G SGG+++   I +   +EP + ++DE  S LD I  L 
Sbjct: 131 ---GANLWNEVKDRLDKP-GGGLSGGQQQRLCIARAIAVEPDVLLMDEPCSALDPISTLA 186

Query: 185 IAAQGVNALRSQDRSFLIITH 205
           I    +N L+ QD + +I+TH
Sbjct: 187 I-EDLINELK-QDYTIVIVTH 205