RPSBLAST alignment for GI: 254781060 and conserved domain: PRK14258

>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional. Length = 261
 Score = 41.9 bits (98), Expect = 2e-04
 Identities = 48/200 (24%), Positives = 96/200 (48%), Gaps = 17/200 (8%)

Query: 15  DTE-IIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYE---ITAGDILYKGESIL 70
           DT+ I+ G+++++  S+V AI+GP+G GKST    L+   + E      G + +  ++I 
Sbjct: 18  DTQKILEGVSMEIYQSKVTAIIGPSGCGKSTFLKCLNRMNELESEVRVEGRVEFFNQNIY 77

Query: 71  DWSI-VERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEKELLIPDFTRKVRKI 129
           +  + + R  + + +    P   P   M  +  +A   +      K L I D      K 
Sbjct: 78  ERRVNLNRLRRQVSMVHPKPNLFP---MSVYDNVAYGVKIVGWRPK-LEIDDIVESALK- 132

Query: 130 TAELGINMDMLKRPLN---LGFSGGEKKIAEILQMRLLEPSLCILDETDSGLD-IDALKI 185
            A+L    D +K  ++   L  SGG+++   I +   ++P + ++DE   GLD I ++K+
Sbjct: 133 DADL---WDEIKHKIHKSALDLSGGQQQRLCIARALAVKPKVLLMDEPCFGLDPIASMKV 189

Query: 186 AAQGVNALRSQDRSFLIITH 205
            +   +     + + +I++H
Sbjct: 190 ESLIQSLRLRSELTMVIVSH 209