RPSBLAST alignment for GI: 254781060 and conserved domain: COG1101

>gnl|CDD|31298 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only]. Length = 263
 Score = 66.1 bits (161), Expect = 8e-12
 Identities = 62/235 (26%), Positives = 112/235 (47%), Gaps = 13/235 (5%)

Query: 1   MLEIKNLRA---KIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           M+ + N      K    +   + GL+L++   + V ++G NG+GKSTL   ++G  D + 
Sbjct: 1   MISLSNATKTFFKGTPLEKRALNGLSLEIAEGDFVTVIGSNGAGKSTLLNAIAG--DLKP 58

Query: 58  TAGDILYKGESILDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQR-KARNEKE 116
           T+G IL  G  +   S+ +RA+  +   FQ P+      +     +AL E R K R    
Sbjct: 59  TSGQILIDGVDVTKKSVAKRANL-LARVFQDPLAGTAPELTIEENLALAESRGKKRGLSS 117

Query: 117 LLIPDFTRKVRKITAELGINM-DMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETD 175
            L        R+  A LG+ + + L   + L  SGG+++   +L   L  P + +LDE  
Sbjct: 118 ALNERRRSSFRERLARLGLGLENRLSDRIGL-LSGGQRQALSLLMATLHPPKILLLDEHT 176

Query: 176 SGLDIDALKIAAQGVNALRSQDR-SFLIITHY-QRLLNYIKPDTIHVLHNGKIIK 228
           + LD    +   +    +  + + + L++TH  +  L+Y   + + +LH+GKI+ 
Sbjct: 177 AALDPKTAEFVMELTAKIVEEHKLTTLMVTHNMEDALDY--GNRLIMLHSGKIVL 229