RPSBLAST alignment for GI: 254781060 and conserved domain: COG1135

>gnl|CDD|31330 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]. Length = 339
 Score = 64.5 bits (157), Expect = 2e-11
 Identities = 49/240 (20%), Positives = 108/240 (45%), Gaps = 24/240 (10%)

Query: 1   MLEIKNLR---AKIVDTDTEIIRGLNLKVEPSEVVAIMGPNGSGKSTLSYLLSGHKDYEI 57
           M+E++N+     +        +  ++L++   E+  I+G +G+GKSTL  L++  +    
Sbjct: 1   MIELENVSKTFGQTGTGTVTALDDVSLEIPKGEIFGIIGYSGAGKSTLLRLINLLERP-- 58

Query: 58  TAGDILYKGESI--LDWSIVERASKGIFLAFQYPVEIPGIIMMQFLKIALNEQRKARNEK 115
           T+G +   G+ +  L  + + +  + I + FQ+   +    + + +   L      + E 
Sbjct: 59  TSGSVFVDGQDLTALSEAELRQLRQKIGMIFQHFNLLSSRTVFENVAFPLELAGVPKAEI 118

Query: 116 ELLIPDFTRKVRKITAELGINMDMLKRPLNLGFSGGEKKIAEILQMRLLEPSLCILDETD 175
           +       ++V ++   +G++    + P  L  SGG+K+   I +     P + + DE  
Sbjct: 119 K-------QRVAELLELVGLSDKADRYPAQL--SGGQKQRVAIARALANNPKILLCDEAT 169

Query: 176 SGLDIDALKIAAQGVNALRSQDRSF----LIITHYQRLLNYIKPDTIHVLHNGKIIKTGD 231
           S LD    +     +  L+  +R      ++ITH   ++  I  D + VL  G++++ G 
Sbjct: 170 SALDP---ETTQSILELLKDINRELGLTIVLITHEMEVVKRI-CDRVAVLDQGRLVEEGT 225